(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00010360

fig|691437.3.peg.255   Geobacillus sp. C56-T3         VDKVAKINLAGTVIPHNWFSTITFENGKPDTIAIVLLSEIVYWYRPMFIKDEATGRIKEVRKRFKADLLQRSYDSFAEQFGFTKRQVRDAIKRLEDKGLIRREFRNIHVDGMTLTNVLFIELNPEKLSEFTYGIED−−−−−−−MTTDEIGSDVSTDRVLRSNVTP−−−−−−−−YTIERQTNTEITTKTTTNIDDDDKDEPINEISREEKTECNPVTEFEKAF−−−−−−−−−−GYLPPSILQQEFEQVIENGQFQEPEAIIVEAIRLARKQMPRNPARYISSILRNFEFMGLFTLEDVKEYNEMFEQKRK−−−−−−QA−−PR                                                               
fig|526982.3.peg.3714   Bacillus cereus Rock1-15     MNNKVLQIGQINFRGNVIDHGWFKTLTLDNGKPNIVAITILGEIVYWYKPTEVRSEESSQVQYKQKFKADTLQKSYQQLADSFGFTKRQVKEACDFLKERGLIKIEFRTILVNGTRCNNVMYVEPVPEMIQKISIIYWGNGNPPTLKSNSTI−−TLESKRVLHSKAIPSYDKTEESLTLERKTNTEITTNITTEITTNIN−−−−−−−−−−DDDATSSQKLIDQEFKTSYNFLLEKGIPLSEIAIQELGEFCDRFGNELVIHAVNKAI−−−DENVPK−−WRYIRSILSSWEKEKVKTLNDVAALDTRFEMSKK−−−−−−NN−−KRTGKGYSK−−−−−−−−−−RTEVVPDWLRKQEEQEPIQQPQQTQSKDFENNKKRLDEILNKYKNT
fig|1053238.3.peg.508   Bacillus cereus VD154     MNNKVLQIGQINFRGNVIDHGWFKTLTLDNGKPNIVAITILGEIVYWYKPTEVRSEESSQVQYKQKFKADTLQKSYQQLADSFGFTKRQVKEACDFLKERGLIKIEFRTILVNGTRCNNVMYVEPVPEMIQKISIIYWGNGNPPTLKSNSPI−−TLESKRVLHSKAIPSYDKTEESLTLERKTNTEITTNITT−−−−NIN−−−−−−−−−−DDDATSSQKLIDQEFKTSYNFLLEKGIPLSEIAIQELGEFCDRFGNELVIHAVNKAI−−−DENVPK−−WRYIRSILSSWEKEKVKTLNDVAALDTRFEMSKK−−−−−−NN−−KRTGKGYSK−−−−−−−−−−RTEVVPDCLRKQEEQEPIQQPQQTQSDNLEDNKKRLDEILNKYKNT
fig|527027.3.peg.3126   Bacillus thuringiensis serovar pakistani str. T13001     MNNKVLQIGQINFRGNVIDHGWFKTLTLDNGKPNIVAITILGEIVYWYKPTEVRSEESSQVQYKQKFKADTLQKSYQQLADSFGFTKRQVKEACDFLKERGLIKIEFRTILVNGTRCNNVMYVEPVPEMIQKISIIYWGNGNPPTLKSNSPI−−TLESKRVLHSKAIPSYDKTEESLTLERKTNTEITTNITT−−−−NIN−−−−−−−−−−DDDATSSQKLIDQEFKTSYNFLLEKGIPLSEIAIQELGEFCDRFGNELVIHAVNKAI−−−DENVPK−−WRYIRSILSSWEKEKVKTLNDVAALDTRFEMSKK−−−−−−NN−−KRTGKGYSK−−−−−−−−−−RTEVVPDCLRKQEEQEPIQQPQQTQSDNLEDNKKRLDEILNKYKNT
fig|714359.3.peg.2486   Bacillus thuringiensis BMB171     MNNKVLQIGQINFRGNVIDHGWFKTLTLGNGKPNIVAITILGEIVYWYKPTEVRSEESSQVQYKQKFKADTLQKSYQQLADSFGFTKRQVKEACDFLKERGLIKIEFRTILVNGTRCNNVMYVEPVPEMIQKISIMYWGNANPPTLKSNSPI−−TLESKSVLHSKAIPSYDKTEESLTLERKTNTEITTNITTK−−−−IN−−−−−−−−−−DDDATSSQKLIDEEFKTSYNFLLEKGIPLSEIAIQELGEFCDRFGNELVIHAVNKAI−−−DENVPK−−WRYIRSILSSWKKEKVKTLNDVAALDTRFEMSKK−−−−−−NN−−KRTGKGYSK−−−−−−−−−−RTEVVPDWLRKQEEQEPIQQPHQTQSDDLKDNKKRLDEILNKYKNT
fig|405531.7.peg.2455   Bacillus cereus G9842     MNTKVLQIGQINFRGNVIDHGWFKTLTLDNGKPNIVAITILGEIVYWYKPTEVSSEESSQVQYKQKFKADTLQKSYQQLADSFGFTKRQVKEACDFLKERELIKIEFRTILVNGTRCNNVMYVEPVPEMIQKISIMYWGNGNPPTLKSNSPV−−TLESKRVLHSKVIPSYDKTEESLTLERKTNTEITTNITTEITTNIN−−−−−−−−−−−DDATSSQKLIDQEFKISYNFLLEKGIPLSEIAIQELGEFCDRFGNELVIHAVNKAI−−−DENVPK−−WRYIRSILSSWEKEKVKTLNDVAALDTRFEMSKK−−−−−−NN−−KRTGKGYSK−−−−−−−−−−RTEVVPDWLRKQEEQEPIQQPHQTQSDDLENNKKRLDEILNKYKNT
fig|527019.3.peg.334   Bacillus thuringiensis IBL 200     MNNKVLQIGQINFRGNVIDHGWFKTLTLDNGKPNIVAITILGEIVYWYKPTEVRSEESSQVQYKQKFKADTLQKSYQQLADSFGFTKRQVKEACDFLKERGLIKIEFRTILVNGTRCNNVMYVEPVPEMIQKISIMYWGNGNPPTLKSNSPV−−TLESKRVLHSKAIPFYDKTEESLTLERKTNTEITTNITTGITTNVN−−−−−−−−−−DDDA−−SQKLIDQEFKISYNFLLKKGIPLSEIAIQELGEFCDRFGNELVIHAVNKAI−−−DENVPK−−WRYIRSILSSWEKEKVKTLNDVAALDTRFEMSKK−−−−−−NN−−KRTGKGYSK−−−−−−−−−−RTEVVPDWLRKQEEQEPIQQPQQTQSDDLEDNKKRLDEILNKYKNT
fig|526984.3.peg.2764   Bacillus cereus Rock3-29     MNNKVLQIGQINFRGNVIDHGWFKTLTLDNGKPNIVAITILGEFVYWYKPTEVRNEESSQVQYKQKFKADMLQKSYQQLADSFGFTKRQVKEACDFLKERGLIKIEFRTIVVNGTRCNNVMYVEPIPEIIQKISVMYWGNDTPPTLKRNSPI−−TSESKRVLHSKGTPSYDETEEALTLERKTNTEITTNITTEITTNIND−−−−−−−−−DDNTTSSQKLIDQEFKISYNFLLKQGIPLSEIAIQELGEFCDRFGNELITHAVNKAI−−−DENVPK−−WRYIRSILSSWEKAKVKTLNDVAALDNRFEMSKK−−−−−−NN−−KRTGKVYVK−−−−−−−−−−RTENVPDWLREQEEQEPIQQP−−−QS−−−DDNQKRFAEILNKYKNT
fig|526983.3.peg.1425   Bacillus cereus Rock3-28     MNNKVLQIGQINFRGNVIDHGWFKTLTLDNGKPNIVAITILGEFVYWYKPTEVRNEESSQVQYKQKFKADMLQKSYQQLADSFGFTKRQVKEACDFLKERGLIKIEFRTIVVNGTRCNNVMYVEPIPEIIQKISVMYWGNDTPPTLKRDSPI−−TSESKRVLHFKGTPSYDETEEALTLERKTNTEITTNITTEITTNIN−−−−−−−−−−DDNATSSQKLIDQEFKISYNFLLKQGIPLSEIAIQELGEFCDRFGNELITHAVNKAI−−−DENVPK−−WRYIRSILSSWEKEKVKTLNDVAAIDNRFEMSKN−−−−−−NN−−KRTGKVYVK−−−−−−−−−−RTENVPDWLWEQEEQEPIQQP−−−QSDDLDDNQKRFAEILNKYKNT
fig|315749.4.peg.2676   Bacillus cereus subsp. cytotoxis NVH 391-98     MSNVVSEIGGLNLKGNVVDHEWFNYITFSNGKPHIVAIMVLSEIVYWYRPTVIRDEITGKVTYKKKFKADKLQKNYQQLADTFGFSKLQVKRACDLLTDMLLIKIEFRTINVDGKVLNNVMFVEPVASEIKKISSMYQQ−−−−−−−IEIDPP−−YFEVKRDPTSKLPPSLLESKDPPYFEVRTNTENTTEITTN−−−−−−−−−−−−−−−−IDDDDNPHPLIDLQFKNSLEHLMKNSIPLSVIAEQELGEFCDLFGSELVNAAVDKAL−−−DENAPR−−WTYIRTILSNWQKNNVKTLADVIKLDEDYKNRRGGVGNAAHR−−KRTGRGYAASRNYEEENANRKRNMPSFIKR                                   
fig|315749.8.peg.2761   Bacillus cytotoxicus NVH 391-98     MSNVVSEIGGLNLKGNVVDHEWFNYITFSNGKPHIVAIMVLSEIVYWYRPTVIRDEITGKVTYKKKFKADKLQKNYQQLADTFGFSKLQVKRACDLLTDMLLIKIEFRTINVDGKVLNNVMFVEPVASEIKKISSMYQQ−−−−−−−IEIDPP−−YFEVKRDPTSKLPPSLLESKDPPYFEVRTNTENTTEITTN−−−−−−−−−−−−−−−−IDDDDNPHPLIDLQFKNSLEHLMKNSIPLSVIAEQELGEFCDLFGSELVNAAVDKAL−−−DENAPR−−WTYIRTILSNWQKNNVKTLADVIKLDEDYKNRRGGVGNAAHR−−KRTGRGYAASRNYEEENANRKRNMPSFIKR                                   
fig|527028.3.peg.3775   Bacillus thuringiensis serovar pulsiensis BGSC 4CC1     MSNIVTEIGGLNFKGNVVDHEWFNYITFSNGKPHIVAIMVLSEIVYWYRPTVIRDEIDGKVTYKKKFKADKLQKNYQQLADTFGFTKLQVKRACDLLTDMLLIKIEFRTINADGKILNNVMFVEPVPTEIKKISSMYQQ−−−−−−−IEEDPG−−YLEVNRVVTSKSRPSSLTSKESPNFKVKTNTEITTKITTE−−−−−−−−−−−−−−−−NVSSSIFSFYENNF−−−−−−−−−−GILNSFIAENISQWVNDTSEELVQAAMERAL−−−KQQKK−−WNYAEGILKQWVNNNVKTLKDVDALETEYQRNKG−−−−−−VK−−KRVG                                                             
fig|1053196.3.peg.6046   Bacillus cereus BMG1.7     MSNVVTEIGGLNFKGNVVDHEWFNYITFSNGKPHIVAIMVLSEIVYWYRPTVIRDEIDGKVTYKKKFKADKLQKNYQQLADTFGFTKLQVKRACDLLTDMLLVKIEFRTISADGKILNNVMFVEPVPTEIRKISSMYQE−−−−−−−IKEDPG−−YLEVNRVVTSKSRPSSLTSKESPNFKVKTNTEITTKSTTE−−−−−−−−−−−−−−−−NVSSSSIFSFYENNF−−−−−−−−−−GILNSFIAESISQWVNDTSEELVQAAMERAL−−−KQQKK−−WNYAEGILKQWVNKNIRTLADVNAAEIEFKNKG−−−−−−KKGAKRNGNTNEK                                                        
fig|527023.3.peg.5112   Bacillus thuringiensis serovar kurstaki str. T03a001     MSNVVTEIGGLNFKGNVVDHEWFNYITFSNGKPHIVAIMVLSEIVYWYRPTVIRDEIDGKVTYKKKFKADKLQKNYQQLADTFGFTKLQVKRACDLLTDMLLVKIEFRTISADGKILNNVMFVEPVPTEIRKISSMYQE−−−−−−−IKEDPG−−YLEVNRVVTSKSRPSSLTSKESPNFKVKTNTEITTKSTTE−−−−−−−−−−−−−−−−NVSSSSIFSFYENNF−−−−−−−−−−GILNSFIAESISQWVNDTSEELVQAAMERAL−−−KQQKK−−WNYAEGILKQWVNKNIRTLADVNAAEIEFKNKG−−−−−−KKGAKRNGNTNEK                                                        
fig|527022.3.peg.3319   Bacillus thuringiensis serovar monterrey BGSC 4AJ1     MANVVTEIGGLNFKGNVVDHEWFNYITFSNGKPHIVAIMVLSEIVYWYRPTVIRDEYTGKITYKKKFKSDKLQKSYQQLAETFGFSKLQVKRACDLLVDMNLIIIEFRTIIVNEITLNNVMFVEPKVSEIKSISSMYQQ−−−−−−−VEEDPV−−DFEVKRVVTSKSGTSSYKSNEAPDFKVKTNTEITTKNTTE−−−−−−−−−−−−−−−−NVSSSSIFSFYENNF−−−−−−−−−−GILNSFIAESISEWVNDTSEELVQAAMERAL−−−KQQKK−−WNYAEGILKQWVNHNVKTLKDVDALETEYQRNKG−−−−−−VK−−KRVG                                                             
fig|526968.3.peg.3807   Bacillus cereus R309803     MANVVTEIGGLNFKGNVVDHEWFNYITFSNGKPHIVAIMVLSEIVYWYRPTVIRDEYTGKVTYKKKFKSDKLQKSYQQLAETFGFSKIQVKRACDLLVDMNLIVIEFRTIIVNEITLNNVMFVEPKVNEIKSISSMYQQ−−−−−−−VEEDPV−−NFEVKRVVTSKSGTSSRESNEAPDFKVKTNTKITTKNTTE−−−−−−−−−−−−−−−−NVSSSSIFSFYENNF−−−−−−−−−−GILNSFIAESIAQWVNDTSEELVQAAMERAL−−−KQQKK−−WNYAEGILKQWVNKNIRTLEDVYASEAEF                                                                                
fig|1053238.3.peg.3532   Bacillus cereus VD154     MANVVTEIGGLNFKGNVVDHEWFNYITFSNGKPHIVAIMVLSEIVYWYRPTVIRDEYTGKVTYKKKFKSDKLQKSYQQLAETFGFSKLQVKRACDLLVDMNLIVIEFRTIIVNEIILNNVMFVEPKVSEIKSISSMYQQ−−−−−−−VEEDPV−−DFEVKRVVTSKSGTSSHESNEAPDFKVKTNTEITTKNTTE−−−−−−−−−−−−−−−−NVSSSSIFSFYENNF−−−−−−−−−−GILNSFIAESISQWVNDTSEELVQAAMERAL−−−KQQKK−−WNYAEGILKQWVNKNIRTLADVNAAEIEFKNKG−−−−−−KKGANRNGNTNEKTDGIP                                                   
fig|527027.3.peg.1242   Bacillus thuringiensis serovar pakistani str. T13001     MANVVTEIGGLNFKGNVVDHEWFNYITFSNGKPHIVAIMVLSEIVYWYRPTVIRDEYTGKVTYKKKFKSDKLQKSYQQLAETFGFSKLQVKRACDLLVDMNLIVIEFRTIIVNEIILNNVMFVEPKVSEIKSISSMYQQ−−−−−−−VEEDPV−−DFEVKRVVTSKSGTSSHESNEAPDFKVKTNTEITTKNTTE−−−−−−−−−−−−−−−−NVSSSSIFSFYENNF−−−−−−−−−−GILNSFIAESISQWVNDTSEELVQAAMERAL−−−KQQKK−−WNYAEGILKQWVNKNIRTLADVNAAEIEFKNKG−−−−−−KKGANRNGNTNEKTDGIP                                                   
fig|526975.3.peg.4898   Bacillus cereus BDRD-ST26     MNNIVLQIGQMNFRGNVIDHGWFKTLTLDNGKPNMVAISILGEVVYWYKPTEVRDEHSNNVRYKQKFKADTLQKSYQQFADSFGFTKRQVKDACDYLKDRRLVRIEFRTVFVNGTRCNNVMFIEPIPEEIQKISILYWE−−−−−−−−NGTPP−−TLERKRVLQPNVPPSYDKTEEPPTFKRKTNTKITTKNTTE−−−−−−−−−−−−−−−−NVSSSSIFSFYENNF−−−−−−−−−−GILNSFVAENISQWINDTNEELVQAAMERAL−−−KQQKK−−WNYAEGILKQWVNNNVKTLKDVDALETEYQRNKG−−−−−−VK−−KRVG                                                             
fig|718220.3.peg.1785   Bacillus cereus IS075     MNNIVLQIGQMNFRGNVIDHGWFKTLTLDNGKPNMVAISILGEVVYWYKPTEVRDEHSNNVRYKQKFKADTLQKSYQQFADSFGFTKRQVKDACDYLKDRRLVRIEFRTVFVNGTRCNNVMFIEPIPEEIQKISILYWE−−−−−−−−NGTPP−−TLERKRVLQPNVPPSYDKTEEPPTFKRKTNTKITTKNTTE−−−−−−−−−−−−−−−−NVSSSSIFSFYENNF−−−−−−−−−−GILNSFVAENISQWINDTNEELVQAAMERAL−−−KQQKK−−WNYAEGILKQWVNNNVKTLKDVDALETEYQRNKG−−−−−−VK−−KRVG                                                             
fig|486624.3.peg.2716   Bacillus anthracis str. A0488     MNNVVLQIGQMNFRGNVIDHGWFKTLTLDNGKPNMVAISILGEVVYWYKPTEVRDEHSNNVRYKQKFKADTLQKSYQQFADSFGFTKRQVKGACDYLKDRRLVHIEFRTIFVNGTRCNNVMFIEPIPEEIQKISILYWE−−−−−−−−NGTPP−−TLERKRVLQQNEPPSYDKKEEPPTFKRKTNTENTTKNTTE−−−−−−−−−−−−−−−−NVSSSSIFSFYENNF−−−−−−−−−−GILNSFIAENISQWVNDTSEELVQAAMERAL−−−KQQKK−−WNYAEGILKQWVNNNVKTLKDVDALETEYQRNKG−−−−−−VK−−KRVG                                                             
fig|1245029.3.peg.5003   Bacillus anthracis str. Carbosap     MNNVVLQIGQMNFRGNVIDHGWFKTLTLDNGKPNMVAISILGEVVYWYKPTEVRDEHSNNVRYKQKFKADTLQKSYQQFADSFGFTKRQVKDACDYLKDRRLVHIEFRTIFVNGTRCNNVMFIEPIPEEIQKISILYWE−−−−−−−−NGTPP−−TLERKRVLQQNEPPSYDKKEEPPTFKRKTNTENTTKNTTE−−−−−−−−−−−−−−−−NVSSSSIFSFYENNF−−−−−−−−−−GILNSFIAENISQWVNDTSEELVQAAMERAL−−−KQQKK−−WNYAEGILKQWVNNNVKTLKDVDALETEYQRNKG−−−−−−VK−−KRVG                                                             
fig|280354.4.peg.4797   Bacillus anthracis str. CNEVA-9066     MNNVVLQIGQMNFRGNVIDHGWFKTLTLDNGKPNMVAISILGEVVYWYKPTEVRDEHSNNVRYKQKFKADTLQKSYQQFADSFGFTKRQVKDACDYLKDRRLVHIEFRTIFVNGTRCNNVMFIEPIPEEIQKISILYWE−−−−−−−−NGTPP−−TLERKRVLQQNEPPSYDKKEEPPTFKRKTNTENTTKNTTE−−−−−−−−−−−−−−−−NVSSSSIFSFYENNF−−−−−−−−−−GILNSFIAENISQWVNDTSEELVQAAMERAL−−−KQQKK−−WNYAEGILKQWVNNNVKTLKDVDALETEYQRNKG−−−−−−VK−−KRVG                                                             
fig|198094.1.peg.408   Bacillus anthracis str. Ames                                                MVYWYKPTEVRDEHSNNVRYKQKFKADTLQKSYQQFADSFGFTKRQVKDACDYLKDRRLVHIEFRTIFVNGTRCNNVMFIEPIPEEIQKISILYWE−−−−−−−−NGTPP−−TLERKRVLQQNEPPSYDKKEEPPTFKRKTNTENTTKNTTE−−−−−−−−−−−−−−−−NVSSSSIFSFYENNF−−−−−−−−−−GILNSFIAENISQWVNDTSEELVQAAMERAL−−−KQQKK−−WNYAEGILKQWVNNNVKTLKDVDALETEYQRNKG−−−−−−VK−−KRVG                                                             
fig|261591.3.peg.5302   Bacillus anthracis str. Vollum                                                MVYWYKPTEVRDEHSNNVRYKQKFKADTLQKSYQQFADSFGFTKRQVKGACDYLKDRRLVHIEFRTIFVNGTRCNNVMFIEPIPEEIQKISILYWE−−−−−−−−NGTPP−−TLERKRVLQQNEPPSYDKKEEPPTFKRKTNTENTTKNTTE−−−−−−−−−−−−−−−−NVSSSSIFSFYENNF−−−−−−−−−−GILNSFIAENISQWVNDTSEELVQAAMERAL−−−KQQKK−−WNYAEGILKQWVNNNVKTLKDVDALETEYQRNKG−−−−−−VK−−KRVG                                                             
fig|280355.3.peg.4061   Bacillus anthracis str. A1055                                                MVYWYKPTEVRDEHSNNVRYKQKFKADTLQKSYQQFADSFGFTKRQVKDACDYLKDRRLVHIEFRTIFVNGTRCNNVMFIEPIPEEIQKISILYWE−−−−−−−−NGTPP−−TLERKRVLQQNELPSYDKKEEPPTFKRKTNTENTTKNTTE−−−−−−−−−−−−−−−−NVSSSSIFSFYENNF−−−−−−−−−−GILNSFIAENISQWVNDTSEELVQAAMERAL−−−KQQKK−−WNYAEGILKQWVNNNVKTLKDVDALETEYQRNKG−−−−−−VK−−KRVG                                                             
fig|280355.4.peg.4176   Bacillus anthracis str. A1055     MNNVVLQIGQMNFRGNVIDHGWFKTLTLDNGKPNMVAISILGEVVYWYKPTEVRDEHSNNVRYKQKFKADTLQKSYQQFADSFGFTKRQVKDACDYLKDRRLVHIEFRTIFVNGTRCNNVMFIEPIPEEIQKISILYWE−−−−−−−−NGTPP−−TLERKRVLQQNELPSYDKKEEPPTFKRKTNTENTTKNTTE−−−−−−−−−−−−−−−−NVSSSSIFSFYENNF−−−−−−−−−−GILNSFIAENISQWVNDTSEELVQAAMERAL−−−KQQKK−−WNYAEGILKQWVNNNVKTLKDVDALETEYQRNKG−−−−−−VK−−KRVG