(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00010147

fig|526974.3.peg.4275   Bacillus cereus BDRD-ST24     MGIIRV−−KKDSNYSVINNTGLKDERL−−−SWKAKGILAYAL−−TLPDDWTF−−−−−−−HISELARHAKD−−−−−GEDSLRTGF−−−−−−−−−KELKELGYVKRYPVRDGNTKK−−−−−−−−−−−−−IARWDTEIYET−−−−−−PQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RDMPQ−−−−−−−−−−−MENPDV−−−−−−−−−−−−−−−−−−−−VKPYE−−−−−−−−−−−−−−−−−−−−−−−−−−−ENQKL−−−−−−−−−−LNTNR−−−−−−LNTNKR−−−−−−NNNDYDDMDK−−−−−−−−−−−−−−−−−−−−−−−−−−−LESRVFINERVKVSCNFIKGMGIP−−−LSEIAIAE−−−−−LGSFCN−−−−−−−−−LFSGELI−−−−QHAINKAVDEN−−−−−−APRW−−−−−−−−−−−NYIKAILRNWKEQEVKTLVDV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AILDRRFEMSKKKKYNGT 
fig|226900.1.peg.3541   Bacillus cereus ATCC 14579     MGIIRV−−KKDSNYSVINNTGLKDERL−−−SWKAKGILAYAL−−TLPDDWTF−−−−−−−HISELARHAKD−−−−−GEDSLRTGF−−−−−−−−−KELKELGYVKRYPVRDGNTKK−−−−−−−−−−−−−IARWDTEIYET−−−−−−PQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RDMPQ−−−−−−−−−−−MENQDV−−−−−−−−−−−−−−−−−−−−VKPYE−−−−−−−−−−−−−−−−−−−−−−−−−−−ENQKL−−−−−−−−−−LNTNR−−−−−−LNTNKR−−−−−−NNNDYDDMDQ−−−−−−−−−−−−−−−−−−−−−−−−−−−LESRVFINERVKVSCNFIKGMGIP−−−LSEIAIAE−−−−−LGSFCN−−−−−−−−−LFSGELI−−−−QHAINKAVDEN−−−−−−APRW−−−−−−−−−−−NYIKAILRNWKEQEVKTLVDV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AILDRRFEMSKKKKYNGT 
fig|526978.3.peg.3592   Bacillus cereus BDRD-Cer4     MGIIRV−−KKDSNYSVINNTGLKDERL−−−SWKAKGILAYAL−−TLPDDWTF−−−−−−−HISELARHAKD−−−−−GEDSLRTGF−−−−−−−−−KELKELGYVKRYPVRDGNTKK−−−−−−−−−−−−−IARWDTEIYET−−−−−−PQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RDMPQ−−−−−−−−−−−MENQDV−−−−−−−−−−−−−−−−−−−−VKPYE−−−−−−−−−−−−−−−−−−−−−−−−−−−ENQKL−−−−−−−−−−LNTNR−−−−−−LNTNKR−−−−−−NNNDYDDMDK−−−−−−−−−−−−−−−−−−−−−−−−−−−LESRVFINERVKVSCNFIKGMGIP−−−LSEIAIAE−−−−−LGSFCN−−−−−−−−−LFSGELI−−−−QHAINKAVDEN−−−−−−APRW−−−−−−−−−−−NYIKAILRNWKEQEVKTLVDV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AILDRRFEMSKKKKYNGT 
fig|1053243.3.peg.2819   Bacillus cereus VD196     MGIIRV−−KKDSNYSVINNTGLKDERL−−−SWKAKGILAYAL−−TLPDDWTF−−−−−−−HISELARHAKD−−−−−GEDSLRTGF−−−−−−−−−KELKELGYVKRYPVRDGNTKK−−−−−−−−−−−−−ITRWDTEIYET−−−−−−PQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RDMPQ−−−−−−−−−−−MENQDV−−−−−−−−−−−−−−−−−−−−VKPYE−−−−−−−−−−−−−−−−−−−−−−−−−−−ENQKL−−−−−−−−−−LNTNR−−−−−−LNTNKR−−−−−−NNNDYDDMDK−−−−−−−−−−−−−−−−−−−−−−−−−−−LESRVFINERVKVSCNFIKGMGIP−−−LSEIAIAE−−−−−LGSFCN−−−−−−−−−LFSGELI−−−−QHAINKAVDEN−−−−−−APRW−−−−−−−−−−−NYIKAILRNWKEKEVKTLVDV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AILDRRFEMSKKKKYNGT 
fig|526991.3.peg.1230   Bacillus cereus AH676     MGIIRV−−KKDSNYSVINNTGLKDERL−−−SWKAKGILAYAL−−TLPDDWTF−−−−−−−HISELARHAKD−−−−−GEDSLRTGF−−−−−−−−−KELKELGYVKRYPVRDGNTKK−−−−−−−−−−−−−ITRWDTEIYET−−−−−−PQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RDMPQ−−−−−−−−−−−MENQDV−−−−−−−−−−−−−−−−−−−−VKPYE−−−−−−−−−−−−−−−−−−−−−−−−−−−ENQKL−−−−−−−−−−LNTNR−−−−−−LNTNKR−−−−−−NNNDYDDMDK−−−−−−−−−−−−−−−−−−−−−−−−−−−LESRVFINERVKVSCNFIKGMGIP−−−LSEIAIAE−−−−−LGSFCN−−−−−−−−−LFSGELI−−−−QHAINKAVDEN−−−−−−APRW−−−−−−−−−−−NYIKAILRNWKEQEVKTLVDV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AILDRRFEMSKKKKYNGT 
fig|1053238.3.peg.1654   Bacillus cereus VD154     MGIIRV−−KKDSNYSVINNTGLKDERL−−−SWKAKGILAYAL−−TLPDDWTF−−−−−−−HISELARHAKD−−−−−GEDSLRTGF−−−−−−−−−KELKELGYVKRYPVRDGNTKK−−−−−−−−−−−−−ITRWDTEIYET−−−−−−PQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RNMPQ−−−−−−−−−−−MENQDV−−−−−−−−−−−−−−−−−−−−VKPYE−−−−−−−−−−−−−−−−−−−−−−−−−−−ENQKL−−−−−−−−−−LNTNR−−−−−−LNTNKR−−−−−−NNNDYDDMDK−−−−−−−−−−−−−−−−−−−−−−−−−−−LESRVFINERVKVSCNFIKGMGIP−−−LSEIAIAE−−−−−LGSFCN−−−−−−−−−LFSGELI−−−−QHAINKAVDEN−−−−−−APRW−−−−−−−−−−−NYIKAILRNWKEQEVKTLVDV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AILDKRFEMSKKKKYNGT 
fig|527019.3.peg.4894   Bacillus thuringiensis IBL 200     MGIIRV−−KKDSNYSVINNTGLKDERL−−−SWKAKGILAYAL−−TLPDDWTF−−−−−−−HISELARHAKD−−−−−GEDSLRTGF−−−−−−−−−KELKELGYVKRYPVRDGNTKK−−−−−−−−−−−−−ITRWDTEIYET−−−−−−PQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RNMPQ−−−−−−−−−−−VENQDV−−−−−−−−−−−−−−−−−−−−VKPYE−−−−−−−−−−−−−−−−−−−−−−−−−−−ENQKL−−−−−−−−−−LNTNR−−−−−−LTTNKR−−−−−−NTNDYDDMDK−−−−−−−−−−−−−−−−−−−−−−−−−−−LESRVFINERVKVSCNFIKGRGIP−−−LSEIAIAE−−−−−LGSFCN−−−−−−−−−LFSDELI−−−−QHAINKAVDEN−−−−−−APRW−−−−−−−−−−−NYIKAILRNWKEQEVKTLVDV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AILDRRFEMSKKKKYNGT 
fig|1053220.3.peg.1315   Bacillus cereus MSX-A1     MGIIRV−−KKDSNYSVINNTGLKDERL−−−SWKAKGILAYAL−−TLPDDWTF−−−−−−−HISELARHAKD−−−−−GEDSLRTGF−−−−−−−−−KELKELGYVKRYPVRDGNTKK−−−−−−−−−−−−−ITRWDTEIYET−−−−−−PQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RNMPQ−−−−−−−−−−−VENQDV−−−−−−−−−−−−−−−−−−−−VKPYE−−−−−−−−−−−−−−−−−−−−−−−−−−−ENQAL−−−−−−−−−−LNTNR−−−−−−ITTNKRNTNIQNTNHYDDIDK−−−−−−−−−−−−−−−−−−−−−−−−−−−LDSCVSSNEKVKVSCNFIKGTGIP−−−LSEIAIAE−−−−−LGDFCN−−−−−−−−−LFSDELI−−−−QHAINKAVDEN−−−−−−APRW−−−−−−−−−−−NYIKAILRNWKEQEVKTLVDV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AILDRRFEMSKKKKYNGI 
fig|527030.3.peg.5076   Bacillus thuringiensis serovar huazhongensis BGSC 4BD1     MGIIRV−−KKDSNYSVINNTGLKDERL−−−SWKAKGILAYAL−−TLPDDWTF−−−−−−−HISELARHAKD−−−−−GEDSLRTGF−−−−−−−−−KELKELGYVKRYPVRDGNTKK−−−−−−−−−−−−−ITKWDTEIYET−−−−−−PQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RNMPQ−−−−−−−−−−−VENQDV−−−−−−−−−−−−−−−−−−−−VKPYV−−−−−−−−−−−−−−−−−−−−−−−−−−−ENQKL−−−−−−−−−−LNTNR−−−−−−LTTNKRNTNIQNTNHYDDMDK−−−−−−−−−−−−−−−−−−−−−−−−−−−LESRVFINERVKVSCNFIKGMGIP−−−LSEIAIAE−−−−−LGDFCN−−−−−−−−−LFSDELI−−−−QHAINKAVDEN−−−−−−APRW−−−−−−−−−−−NYIKAILRNWKEQEVKTLVDV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AILDRCFEMSKKKKYKGT 
fig|526969.3.peg.3470   Bacillus cereus m1550     MGIIRV−−KKDSNYSVINNTGLKDERL−−−SWKAKGILAYAL−−TLPDDWTF−−−−−−−HISELARHAKD−−−−−GEDSLRTGF−−−−−−−−−KELKELGYVKRYPVRDGNTKK−−−−−−−−−−−−−ITRWDTEIYET−−−−−−PQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RNMPQ−−−−−−−−−−−VENQDV−−−−−−−−−−−−−−−−−−−−VKPYE−−−−−−−−−−−−−−−−−−−−−−−−−−−ENQKL−−−−−−−−−−LNTNR−−−−−−LTTNKRNTNIQNTNHYDDMDK−−−−−−−−−−−−−−−−−−−−−−−−−−−LESRVFINERVKVSCNFIKGMGIP−−−LSEIAIAE−−−−−LGDFCN−−−−−−−−−LFSDGLI−−−−QHAINKAVDEN−−−−−−APRW−−−−−−−−−−−NYIKAILRNWKEQEVKTLVDV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ATLDRRFEMSKKKKYNGT 
fig|526980.3.peg.4657   Bacillus cereus ATCC 10876     MGIIRV−−KKDSNYSVINNTGLKDERL−−−SWKAKGILAYAL−−TLPDDWTF−−−−−−−HISELARHAKD−−−−−GEDSLRTGF−−−−−−−−−KELKELGYVKRYPVRDGNTQK−−−−−−−−−−−−−ITRWDTEIYET−−−−−−PQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RNMPQ−−−−−−−−−−−VENQDV−−−−−−−−−−−−−−−−−−−−VKLYV−−−−−−−−−−−−−−−−−−−−−−−−−−−ENQTL−−−−−−−−−−LNTNR−−−−−−LITNKRNTNIQNTNHYDDMDK−−−−−−−−−−−−−−−−−−−−−−−−−−−LDSRVFINERVKVSCNFIKGMGIP−−−LSEIAIAE−−−−−LGDFCN−−−−−−−−−LFSDELI−−−−QHAINKAVDEN−−−−−−APRW−−−−−−−−−−−NYIKAILRNWKEQEVKTLVDV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ATLDRRFEMSKKKKYNET 
fig|526983.3.peg.2747   Bacillus cereus Rock3-28     MGIIRV−−KKDNNYSVINNTGLEDKRL−−−SWKAKGILAYTL−−TLPDDWTF−−−−−−−HISELAQHAKD−−−−−GEDSLRTGF−−−−−−−−−KELKELGYVKRYPVRDENTKK−−−−−−−−−−−−−IKRWDTEIYET−−−−−−PQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KRIPQ−−−−−−−−−−−VEKQDV−−−−−−−−−−−−−−−−−−−−GKPYE−−−−−−−−−−−−−−−−−−−−−−−−−−−ENPTL−−−−−−−−−−LNINK−−−−−−−−−−−LNTKIQNTN−−HDDKDK−−−−−−−−−−−−−−−−−−−−−−−−−−−LESHILFGGEFKKNYSFLKERGIP−−−LSENAFTE−−−−−LGDFCD−−−−−−−−−LFSSELI−−−−QYATNKAIDEN−−−−−−APRW−−−−−−−−−−−NYVKAILSNWKEQKVKTFADV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TALDRRFKMSKNKKFNES 
fig|526984.3.peg.3980   Bacillus cereus Rock3-29     MGIIRV−−KKDSNYSVINNTGLKDKRL−−−SWKAKGILAYTL−−TLPDDWTF−−−−−−−HISELAQHAKD−−−−−GEDSLRTGF−−−−−−−−−KELKELGYVKRYPVRDEHTKK−−−−−−−−−−−−−IKRWDTEIYET−−−−−−PQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KRIPQ−−−−−−−−−−−VEKQDV−−−−−−−−−−−−−−−−−−−−GKPYE−−−−−−−−−−−−−−−−−−−−−−−−−−−ENPTL−−−−−−−−−−LNINK−−−−−−−−−−−LNTKIQNTN−−HDDKDK−−−−−−−−−−−−−−−−−−−−−−−−−−−LESHILFGREFKKNYNFLKERGIP−−−LSEIAFTE−−−−−LGDFCD−−−−−−−−−LFSSELI−−−−QYATNKAIDEN−−−−−−APRW−−−−−−−−−−−NYVKAILSNWKEQKVKTFADV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TALDRRFKMSKNKKFNES 
fig|527023.3.peg.3293   Bacillus thuringiensis serovar kurstaki str. T03a001     MGIFRV−−KKDTNYSVIHNTPLRDENL−−−SWRAKGLLAYML−−SLPDDWTF−−−−−−−HATELSQHAKD−−−−−SEKTTTSTL−−−−−−−−−KELKKAGYLKRYPIQNSETGK−−−−−−−−−−−−−ISHWETIVYEL−−−−−−PT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ID−−−−−−−−−−−−−−TKNHRV−−−−−−−−−−−−−−−−−−−−DKPPSGETTEWKSHPMDEPHDGETTEWTNHPMEKCRL−−−−−−−−−−LNTNS−−−−−−−−−−LLSTNNIQNTNYYHDDNKE                                                                                                                                                                                                     
fig|527019.3.peg.975   Bacillus thuringiensis IBL 200     MGIFRV−−KKDTNYSVIHNTPLRDENL−−−SWRAKGLLAYML−−SLPDDWTF−−−−−−−HATELSQHAKD−−−−−SEKTTTSTL−−−−−−−−−KELKKAGYLKRYPIQNSETGK−−−−−−−−−−−−−ISHWETIVYEL−−−−−−PT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ID−−−−−−−−−−−−−−TKNHRV−−−−−−−−−−−−−−−−−−−−DKPPSGETTEWKSHPMDEPHDGETTEWTNHPMEKCRL−−−−−−−−−−LNTNS−−−−−−−−−−LLSTNNIQNTNNYHDDKKE−−−−−−−−−−−−−−−−−−−−−−−−−−−SKSHVLVDEEFKVGYNFLKGEGIP−−−LSEIAITE−−−−−LGEFCD−−−−−−−−−SFGSELI−−−−KHAAHKAIDEN−−−−−−KPKW−−−−−−−−−−−NYIKAILKSWEKQKVKTLDDV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AALDRRFEMSKNKRLNGS 
fig|526991.3.peg.4055   Bacillus cereus AH676     MGIVRV−−EKNKNYSVVNNTGLRDERL−−−SWKAKGILAYIL−−TLPDDWVF−−−−−−−YREELATHAKD−−−−−GLDSLRSGM−−−−−−−−−KELKEYGYLQRLPIRNDNNK−−−−−−−−−−−−−IVSWETIIHEV−−−−−−PQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VFPLADFPP−−−−−−−−−−−VEEPPV−−−−−−−−−−−−−−−−−−−−EKPPVG−−−−−−−−−−−−−−−−−−−−−−NPPVENPEL−−−−−−−−−−LNTNI−−−−−−PSTNKLNTNIPNTNHHHDDKDE−−−−−−−−−−−−−−−−−−−−−−−−−−−SKLHVLVDEEFKTSYNFLREKGIP−−−LSEIAITE−−−−−LGEFCD−−−−−−−−−LFGRELI−−−−LHATNKAIDEN−−−−−−APKW−−−−−−−−−−−NYIKAILKNWQKQKVKTLDDV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AALDRRFEMSKNRNFNKS 
fig|527030.3.peg.1520   Bacillus thuringiensis serovar huazhongensis BGSC 4BD1     MGIFRV−−KKDNNYSVINNTGLKDKRL−−−SWKAKGILAYIL−−TLPDDWVF−−−−−−−YREELSQHAKD−−−−−GINSLRAGM−−−−−−−−−QELKEYGYIRRFPVRDEKNK−−−−−−−−−−−−−IVRWETIIYEI−−−−−−PV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DDYPP−−−−−−−−−−−VENPPA−−−−−−−−−−−−−−−−−−−−GKPVAG−−−−−−−−−−−−−−−−−−−−−−NLPVDNHKL−−−−−−−−−−LNTNI−−−−−−QSTKELNTNIQNINHIHDNKQS−−−−−−−−−−−−−−−−−−−−−−−−−−−LLSKKLTNEDFKISHQFLMKNRIS−−−LSEIAIIE−−−−−LGAFCE−−−−−−−−−SLGSELI−−−−GEAVNRSIDEN−−−−−−VPKW−−−−−−−−−−−RYVRGILKNWEAKKVKTLKDV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AMLDAQFDLGKNKKQFGS 
fig|526967.3.peg.4806   Bacillus cereus 172560W     MGIFRV−−KKDNNYSVINNTGLKDKRL−−−SWKAKGILAYIL−−TLPDDWVF−−−−−−−YREELSQHAKD−−−−−GINSLRAGM−−−−−−−−−QELKEYGYIRRFPVRDEKNK−−−−−−−−−−−−−IVRWETIIYEI−−−−−−PV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DDYPP−−−−−−−−−−−VENPPA−−−−−−−−−−−−−−−−−−−−GKPVAG−−−−−−−−−−−−−−−−−−−−−−NLPVDNHKL−−−−−−−−−−LNNNI−−−−−−QSTKELNTDIQNINHIHDNKQS−−−−−−−−−−−−−−−−−−−−−−−−−−−LLSKKLTNEDFKISHQFLMKNRIS−−−LSEIAIIE−−−−−LGAFCE−−−−−−−−−SLGSELV−−−−GEAVNRSIDEN−−−−−−VPKW−−−−−−−−−−−RYVRGILKNWEAKKVKTLKDV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AMLDAQFDLGKNKKQFG  
fig|526980.3.peg.4649   Bacillus cereus ATCC 10876     MGIFRV−−KKDNNYSVINNTGLKDKRL−−−SWKAKGILAYIL−−TLPDDWVF−−−−−−−YREELSQHAKD−−−−−GINSLRAGM−−−−−−−−−QELKEYGYIKRFPVRDEKNK−−−−−−−−−−−−−IVRWETIIYEI−−−−−−PG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DDYPP−−−−−−−−−−−VENPPA−−−−−−−−−−−−−−−−−−−−GKPVAG−−−−−−−−−−−−−−−−−−−−−−NLPVDNHKL−−−−−−−−−−LNTNI−−−−−−QSTKELNTDIQNINHIHDNKQS−−−−−−−−−−−−−−−−−−−−−−−−−−−LLSKKLTNEDFKISHQFLMKNRIS−−−LSEIAIIE−−−−−LGAFCE−−−−−−−−−SLGSELI−−−−GEAVNRSIDEN−−−−−−VPKW−−−−−−−−−−−RYVRGILKNWEAKKVKTLKDV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AMLDAQFDLGKNKKQFGS 
fig|1286404.3.peg.6212   Bacillus thuringiensis serovar thuringiensis str. IS5056     MGIFRV−−KKDNNYSVINNTGLKDKRL−−−SWKAKGILAYIL−−TLPDDWVF−−−−−−−YREELSKHAKD−−−−−GINSLRAGM−−−−−−−−−QELKEYGYIKRFPVRDEKNK−−−−−−−−−−−−−IVRWETIIYEI−−−−−−PV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DDYPP−−−−−−−−−−−VENPPA−−−−−−−−−−−−−−−−−−−−GKPVAG−−−−−−−−−−−−−−−−−−−−−−NLPVENHKL−−−−−−−−−−LNINI−−−−−−QSTKELNTDIQNINHRHDNKQK−−−−−−−−−−−−−−−−−−−−−−−−−−−LISQRLINDDFKISHQFLMKNRIS−−−LSEIAIRE−−−−−LGVFCE−−−−−−−−−SLGSELI−−−−GEAVNRSIDEN−−−−−−VPKW−−−−−−−−−−−RYVRGILKKWETKKVKTLKDV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AMLDAQFDLGKNKKQFGS 
fig|527031.3.peg.1724   Bacillus thuringiensis serovar berliner ATCC 10792     MGIFRV−−KKDNNYSVINNTGLKDKRL−−−SWKAKGILAYIL−−TLPDDWVF−−−−−−−YREELSKHAKD−−−−−GINSLRAGM−−−−−−−−−QELKEYGYIKRFPVRDEKNK−−−−−−−−−−−−−IVRWETIIYEI−−−−−−PV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DDYPP−−−−−−−−−−−VENPPA−−−−−−−−−−−−−−−−−−−−GKPVAG−−−−−−−−−−−−−−−−−−−−−−NLPVENHKL−−−−−−−−−−LNINI−−−−−−QSTKELNTDIQNINHRHDNKQK−−−−−−−−−−−−−−−−−−−−−−−−−−−LISQRLINDDFKISHQFLMKNRIS−−−LSEIAIRE−−−−−LGVFCE−−−−−−−−−SLGSELI−−−−GEAVNRSIDEN−−−−−−VPKW−−−−−−−−−−−RYVRGILKKWETKKVKTLKDV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AMLDAQFDLGKNKKQFGS 
fig|526972.3.peg.516   Bacillus cereus AH621     MGIFRV−−KKDNNYSVINNTGLKDQRL−−−SWKAKGILAYIL−−TLPDDWVF−−−−−−−YREELSQHAKD−−−−−GINSLRAGM−−−−−−−−−QELKEYGYIKRFPIRDEKNK−−−−−−−−−−−−−IIRWETIIYEI−−−−−−PV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DDFPP−−−−−−−−−−−VENPPA−−−−−−−−−−−−−−−−−−−−GNPVDG−−−−−−−−−−−−−−−−−−−−−−NLLVENRKL−−−−−−−−−−LNTDI−−−−−−QSTKELNTDIQNTDHHDNQDK−−−−−−−−−−−−−−−−−−−−−−−−−−−SLSQRLINEDFKISHKFLLKNGIS−−−LSEVAITE−−−−−LGEFCE−−−−−−−−−ALGSELI−−−−LEAVNRSIDEN−−−−−−VPKW−−−−−−−−−−−RYVRGILKNWETQKVKTLNDV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AVLDVQFDLGKNKKQFGS 
fig|527028.3.peg.1271   Bacillus thuringiensis serovar pulsiensis BGSC 4CC1     MGIFRV−−KKDNNYSVINNTGLKDKRL−−−SWKAKGILAYIL−−TLPDDWVF−−−−−−−YREELSQHAKD−−−−−GINSLRAGM−−−−−−−−−KELKEYGYIKRFPIKDAKNK−−−−−−−−−−−−−IVRWETIIYEI−−−−−−PL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DDFPP−−−−−−−−−−−VENPPV−−−−−−−−−−−−−−−−−−−−DNPAAG−−−−−−−−−−−−−−−−−−−−−−NLPVETPKL−−−−−−−−−−LNTDI−−−−−−PNTKELNNDIPNTNYHHNNQDK−−−−−−−−−−−−−−−−−−−−−−−−−−−SLSQRLMDEDFKIAYSYLLKNGIS−−−LSKTAIAE−−−−−LGEFCG−−−−−−−−−ALGIELV−−−−LEAVNRSIDEN−−−−−−VPKW−−−−−−−−−−−RYVRGILKNWEIKRVKTLNEI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AKLDAQFELRKNKKQ    
fig|527022.3.peg.2415   Bacillus thuringiensis serovar monterrey BGSC 4AJ1     MGIFRV−−KKDNNYSVINNTGLKDKRL−−−SWKAKGILAYIL−−TLPDDWVF−−−−−−−YREELSQHAKD−−−−−GINSLRAGM−−−−−−−−−KELKEYGYIKRFPIKDAKNK−−−−−−−−−−−−−IVRWETIIYEI−−−−−−PL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DDFPP−−−−−−−−−−−VENPPV−−−−−−−−−−−−−−−−−−−−DNPAAG−−−−−−−−−−−−−−−−−−−−−−NLPVEIPKL−−−−−−−−−−LNTDI−−−−−−QNTKELNNDIPNTNYHHNNQDK−−−−−−−−−−−−−−−−−−−−−−−−−−−SLSQRLMDEDFKIAYSYLLKNGIS−−−LSKTAIAE−−−−−LGEFCG−−−−−−−−−ALGIELV−−−−LEAVNRSIDEN−−−−−−VPKW−−−−−−−−−−−RYVRGILKNWEIKRVKTLNEI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AKLDAQFELRKNKKQ    
fig|527028.3.peg.4922   Bacillus thuringiensis serovar pulsiensis BGSC 4CC1     MGIFRV−−KKDNNYSVINNTGLKDKRL−−−SWKAKGILAYIL−−TLPDDWVF−−−−−−−YREELSQHAKD−−−−−GINSLRAGM−−−−−−−−−QELKEYGYIKRFPIKDVKNK−−−−−−−−−−−−−IVKWETIIYEI−−−−−−PL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EDFPP−−−−−−−−−−−VENPPV−−−−−−−−−−−−−−−−−−−−DNPVAG−−−−−−−−−−−−−−−−−−−−−−NLTVENRKL−−−−−−−−−−LNTDI−−−−−−QSTKELNTDIPNTNYHHDNQDK−−−−−−−−−−−−−−−−−−−−−−−−−−−SLSQRLMDEDFKIAYSYLLKNGIS−−−LSKIAIAE−−−−−LGEFCG−−−−−−−−−VLGSELI−−−−LEAVNRSLDEN−−−−−−VPKW−−−−−−−−−−−RYVRGILKKWETKKVKTRNDV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AVLDEQFDLSKNKKQSGS 
fig|527029.3.peg.133   Bacillus thuringiensis serovar pondicheriensis BGSC 4BA1     MGIFRV−−KKDNNYSVINNTGLKDKRL−−−SWKAKGILAYIL−−TLPDDWVF−−−−−−−YREELSQHAKD−−−−−GINSLRAGM−−−−−−−−−QELKEYGYIKRFPIKDVKNK−−−−−−−−−−−−−IVRWETIIYEI−−−−−−PL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EDFPP−−−−−−−−−−−VENPPV−−−−−−−−−−−−−−−−−−−−DNPVAG−−−−−−−−−−−−−−−−−−−−−−NLTVENRKLLNTDIQSTKELNTDI−−−−−−QSTKELNTDIPNTNYHHDNQDK−−−−−−−−−−−−−−−−−−−−−−−−−−−SLSQRLMDEDFKIAYSYLLKNGIS−−−LSKIAIAE−−−−−LGEFCG−−−−−−−−−VLGSELI−−−−LEAVNRSLDEN−−−−−−VPKW−−−−−−−−−−−RYVRGILKKWETKKVKTRNDV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AVLDEQFDLSKNKKQSGS 
fig|451707.4.peg.1171   Bacillus cereus NVH0597-99     MGIFRV−−KKDNNYSVINNTGLKDKRL−−−SWKAKGILAYIL−−TLPDDWVF−−−−−−−YREELSQHAKD−−−−−GINSLRAGM−−−−−−−−−QELKEYGYIKRFPIKDVKNK−−−−−−−−−−−−−IVRWETIIYEI−−−−−−PL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EDFPP−−−−−−−−−−−VENPPV−−−−−−−−−−−−−−−−−−−−DNPVAG−−−−−−−−−−−−−−−−−−−−−−NLTVENRKL−−−−−−−−−−LNTDI−−−−−−QSTKELNTDIPNTNYHHDNQDK−−−−−−−−−−−−−−−−−−−−−−−−−−−SLSQRLMDEDFKIAYSYLLKNGIS−−−LSKIAIAE−−−−−LGEFCG−−−−−−−−−VLGSELI−−−−LEAVNRSLDEN−−−−−−VPKW−−−−−−−−−−−RYVRGILKKWETKKVKTRNDV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AVLDEQFDLSKNKKQSGS 
fig|526970.3.peg.4854   Bacillus cereus BGSC 6E1     MGIFRV−−KKDNNYSVINNTGLKDKRL−−−SWKAKGILAYIL−−TLPDDWVF−−−−−−−YREELSQHAKD−−−−−GINSLRAGM−−−−−−−−−QELKEYGYIKRFPIKDVKNK−−−−−−−−−−−−−IVRWETIIYEI−−−−−−PL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EDFPP−−−−−−−−−−−VENPPV−−−−−−−−−−−−−−−−−−−−DNPVAG−−−−−−−−−−−−−−−−−−−−−−NLTVENRKL−−−−−−−−−−LNTDI−−−−−−QSTKELNTDIPNTNYHHDNQDK−−−−−−−−−−−−−−−−−−−−−−−−−−−SLSQRLMDEDFKIAYSYLLKNGIS−−−LSKIAIAE−−−−−LGEFCG−−−−−−−−−VLGSELI−−−−LEAVNRSLDEN−−−−−−VPKW−−−−−−−−−−−RYVRGILKKWETKKVKTRNDV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AVLDEQFDLSKNKKQSGS 
fig|526989.3.peg.2902   Bacillus cereus F65185     MATFRV−−SKDKNYTTINNTGLKDKRL−−−TWKAKGILAYIL−−SLPDDWVF−−−−−−−YMEEVAEHAKD−−−−−KLDSLKSGM−−−−−−−−−KELKEYGYVKRYPVKDEKGK−−−−−−−−−−−−−IVRWETIIYEV−−−−−−PQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AENPL−−−−−−−−−−−VGNPQM−−−−−−−−−−−−−−−−−−−−ENPLVD−−−−−−−−−−−−−−−−−−−−−−KPQVENPPL−−−−−−−−−−LSTKE−−−−−−−−−−−LSTEIPSTNLTNDDVDK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−HPLIDEEFQKSYNYLLQNNIP−−−LSETAMQD−−−−−LGEFSD−−−−−−−−−VLGSQII−−−−MEAVDRAVDQN−−−−−−AKRW−−−−−−−−−−−KYISGILFNWQKSNVKTLADV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IKLDEDYKNQRGGVENAT 
fig|405533.4.peg.4147   Bacillus cereus AH1134     MGIFRV−−KKDTNYSVIHNTPLRDENL−−−SWRAKGLLAYML−−SLPDDWTF−−−−−−−HATELSQHAKD−−−−−GKETTANTL−−−−−−−−−KELKKAGYLKRYPVQDPATGK−−−−−−−−−−−−−ISHWETTVYEV−−−−−−PT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IE−−−−−−−−−−−−−−GENHPL−−−−−−−−−−−−−−−−−−−−EKPSSGKTTDWKTMRME−−−−−−−−−−−NQSMEKLPL−−−−−−−−−−LNTND−−−−−−−−−−LLSTDIPSTKLTNDDVDK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−HSLIDEEFQKSYNYLLQNNIP−−−LSETAMQD−−−−−LGEFSD−−−−−−−−−VLGSQII−−−−MEAVDRAVDQN−−−−−−AKRW−−−−−−−−−−−KYISGILFNWQKSNVKTLADV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IKLDEDYKNQRGGVENAT 
fig|527029.3.peg.316   Bacillus thuringiensis serovar pondicheriensis BGSC 4BA1     MATFRV−−SKDKNYTTINNTGLKDERL−−−TWKAKGILAYIL−−SLPDDWVF−−−−−−−YMEEVATHAKD−−−−−KLDSLKSGM−−−−−−−−−KELKEHGYVKRFPVKDEKGK−−−−−−−−−−−−−IIRWETIIYEV−−−−−−PQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GEYPL−−−−−−−−−−−VENPPV−−−−−−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−−KPPVENPLL−−−−−−−−−−LNTKE−−−−−−LITNQQNINLQSSSS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NNVFSFYENNFGI−−−LNPFVADS−−−−−ITQWAN−−−−−−−−−DTGEELV−−−−QAAMERALKQQ−−−−−−−KKW−−−−−−−−−−−NYAEGILKQWANKNIKTLSDV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EALEAEYQRNKGAKNNAE 
fig|526970.3.peg.1364   Bacillus cereus BGSC 6E1                                                                SLTTLTEKVGC−−−−−GRKKIIECI−−−−−−−−−KSLEEKGYIQKVNRKDDQGN−−−−−−−−−−−−−NLSNIYYVLPT−−−−−−PS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VSQKL−−VVSEGNQGSVPEKLGVVSEGNTNNTNLNNTNLTKSSSK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NPFSFYENNIGM−−−LNPFMADS−−−−−IEQWIK−−−−−−−−−DTSEELV−−−−IAAMERALKQQ−−−−−−−KKW−−−−−−−−−−−KYAEGILKHWANNNVKTLQDV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EASEAEYKNRNKGAKQNDP 
fig|526975.3.peg.1113   Bacillus cereus BDRD-ST26                                                                SLTTLTEKVGC−−−−−GRKKIIECI−−−−−−−−−KSLEEKGYIQKVNRKDDQGN−−−−−−−−−−−−−NLSNIYYVLPT−−−−−−PS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VSQKL−−VVSEGNHGSVSQKLGVVSEGNTNNTNLNNTNLTKSNSNK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NPFSFYESNIGI−−−LNPFMADS−−−−−IEQWIK−−−−−−−−−DTSEELV−−−−IAAMERALKKQ−−−−−−−AKW−−−−−−−−−−−NYAEGILKQWSNKNIKNLNDV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EALESEYQRNKGANKRVG 
fig|526999.3.peg.2200   Bacillus mycoides Rock3-17                                                                SLTTLTEKVGC−−−−−GRKKIVQCI−−−−−−−−−KSLEEKGYIQKVNRKDEQGN−−−−−−−−−−−−−NLSNIYYVLPT−−−−−−PS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VSQKL−−VVSEGNQGSVPEKPGVVSEGNTNNTNLNNTNLTISSSSK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NPFSFYENNIGQ−−−LNSFMADN−−−−−IDQWIQ−−−−−−−−−DTSEELV−−−−IAAMERALKQQ−−−−−−−KKW−−−−−−−−−−−NYAEGILKQWANNNMKTLSDV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EALEAEYQRKKGAKSNAE 
fig|526971.3.peg.1028   Bacillus cereus MM3                                                                SLTTLTEKVGC−−−−−GRKKIVQCI−−−−−−−−−KSLEEKGYIQKVNRKDNQGN−−−−−−−−−−−−−NLSNIYYVLPT−−−−−−PS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VSQKL−−VVSEGNQGSVPEKQGVVSEGNCNNTNLNNTNLTISSSSK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NPFSFYESNIGV−−−LNPFMADG−−−−−IDQWIK−−−−−−−−−DTSEELV−−−−VAAMERALKQQ−−−−−−−KKW−−−−−−−−−−−NYAEGILKQWANKNIKTLSDV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EALEVEYQRNKGAKNNAE 
fig|526984.3.peg.155   Bacillus cereus Rock3-29              RRRGFFMIDNEIVDDARL−−−THKEMAVYMVLCRHLNQETGSCFP−−−−−SLSTIGKKVGM−−−−−SKNTIIKSL−−−−−−−−−NLLIECGYVFKEKRNGEDGG−−−−−−−−−−−−−HASNIYYVNDI−−−−−−ST−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LVQPVNKVVQEVNKGGSGDEQALVHQVNPNNTNLNNTNLTISSSSK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NPFSFYESNIGV−−−LNPFMADG−−−−−IDQWIK−−−−−−−−−DTSEELV−−−−IAAMERALKQQ−−−−−−−KKW−−−−−−−−−−−NYAEGILKQWANKNIKTLDDV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EALETEYQRNKGAKNNAE 
fig|269801.5.peg.5182   Bacillus cereus G9241              RRRGFFMIDNEIVDDARL−−−THKEMAIYMVLCRHLNQETGSCFP−−−−−SLSTIGKKVGM−−−−−SKNTIIKSL−−−−−−−−−NLLIECGYVFKEKRNGEDGG−−−−−−−−−−−−−HASNVYYINDI−−−−−−ST−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LVQPVNKVVQEMNKGGSGDEQALVHQVNPNNTNLNNTNLTISSSSK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NPFSFYESNIGV−−−LNPFMADG−−−−−IDQWIK−−−−−−−−−DTSEELV−−−−IAAMERALKQQ−−−−−−−KKW−−−−−−−−−−−NYAEGILKQWVNKNIKTLDDV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EALEAEYQRNKGAKNNAE 
fig|269801.1.peg.5079   Bacillus cereus G9241              RRRGFFMIDNEIVDDARL−−−THKEMAIYMVLCRHLNQETGSCFP−−−−−SLSTIGKKVGM−−−−−SKNTIIKSL−−−−−−−−−NLLIECGYVFKEKRNGEDGG−−−−−−−−−−−−−HASNVYYINDI−−−−−−ST−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LVQPVNKVVQEMNKGGSGDEQALVHQVNPNNTNLNNTNLTISSSSK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NPFSFYESNIGV−−−LNPFMADG−−−−−IDQWIK−−−−−−−−−DTSEELV−−−−IAAMERALKQQ−−−−−−−KKW−−−−−−−−−−−NYAEGILKQWVNKNIKTLDDV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EALEAEYQRNKGAKNNAE 
fig|526975.3.peg.667   Bacillus cereus BDRD-ST26                                                                                      KAGM−−−−−−−−−KELKECGYVKRFPIKGEDGK−−−−−−−−−−−−−ISKWETIIYEV−−−−−−PQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VEKPL−−−−−−−−−−−VENQLV−−−−−−−−−−−−−−−−−−−−EKPSVE−−−−−−−−−−−−−−−−−−−−−−NLPVENQPL−−−−−−−−−−LNTKE−−−−−−LSTNKQNTNIQSSSS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFSFYENNFGI−−−LNSFIAEN−−−−−ISQWVN−−−−−−−−−DTSEELV−−−−QAAMERALKQQ−−−−−−−KKW−−−−−−−−−−−NYAEGILKQWVNNNVKTLKDV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DALETEYQRNKGVKKRVG 
fig|527029.3.peg.2480   Bacillus thuringiensis serovar pondicheriensis BGSC 4BA1     MATFRV−−NKDKNYTTINNTGLKDKRL−−−SWKAKGILAYIL−−TLPDDWVF−−−−−−−YREELSRHAKD−−−−−GLDSLRAGM−−−−−−−−−KELKEYGYLKRFPVRDDNNK−−−−−−−−−−−−−IIKWETIIYEV−−−−−−PQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NDPV−−−−−−−−−−−EEKPPVEIPPEEKPPEEKPPEEKPPEEKPPVE−−−−−−−−−−−−−−−−−−−−−−KPPVENPEL−−−−−−−−−−LSTKE−−−−−−LNTKELSTDIQSSSS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFSFYENNFGI−−−LNSFIAEN−−−−−ISQWVN−−−−−−−−−DTSEELV−−−−QAAMERALKQQ−−−−−−−KKW−−−−−−−−−−−NYAEGILKQWINNNVKTLKDV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DALETEYQRKKGVKKRVG 
fig|1213182.3.peg.2511   Bacillus anthracis str. BF1     MATFRV−−NKDKNYTTINNTGLKDKRL−−−SWKAKGILAYIL−−TLPDDWFF−−−−−−−YREELSRHAKD−−−−−GLDSLRAGM−−−−−−−−−KELKEYGYLKRFPVRDDNNK−−−−−−−−−−−−−IIKWETIIYEV−−−−−−PQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NDPV−−−−−−−−−−−A−−−−−−−−−−−−−−−−−−−−−−−−−EKPPVE−−−−−−−−−−−−−−−−−−−−−−KPPVENPEL−−−−−−−−−−LSTKE−−−−−−LNTKELSTDIQSSSS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFSFYENNFGI−−−LNSFIAEN−−−−−ISQWVN−−−−−−−−−DTSEELV−−−−QAAMERALKQQ−−−−−−−KKW−−−−−−−−−−−NYAEGILKQWVNNNVKTLKDV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DALETEYQRNKGVKKRVG 
fig|260799.1.peg.3787   Bacillus anthracis str. Sterne     MATFRV−−NKDKNYTTINNTGLKDKRL−−−SWKAKGILAYIL−−TLPDDWFF−−−−−−−YREELSRHAKD−−−−−GLDSLRAGM−−−−−−−−−KELKEYGYLKRFPVRDDNNK−−−−−−−−−−−−−IIKWETIIYEV−−−−−−PQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NDPV−−−−−−−−−−−A−−−−−−−−−−−−−−−−−−−−−−−−−EKPPVE−−−−−−−−−−−−−−−−−−−−−−KPPVENPEL−−−−−−−−−−LSTKE−−−−−−LNTKELSTDIQSSSS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFSFYENNFGI−−−LNSFIAEN−−−−−ISQWVN−−−−−−−−−DTSEELV−−−−QAAMERALKQQ−−−−−−−KKW−−−−−−−−−−−NYAEGILKQWVNNNVKTLKDV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DALETEYQRNKGVKKRVG 
fig|280355.4.peg.672   Bacillus anthracis str. A1055     MATFRV−−NKDKNYTTINNTGLKDKRL−−−SWKAKGILAYIL−−TLPDDWVF−−−−−−−YREELSRHAKD−−−−−GLDSLRAGM−−−−−−−−−KELKEYGYLKRFPVRDDNNK−−−−−−−−−−−−−IIKWETIIYEV−−−−−−PQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NDPV−−−−−−−−−−−AEKPPVEIPPE−−−−−−−−−−−−−−−EKPPVE−−−−−−−−−−−−−−−−−−−−−−KPPVENPEL−−−−−−−−−−LSTKE−−−−−−LNTKELSTDIQSSSS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFSFYENNFGI−−−LNSFIAEN−−−−−ISQWVN−−−−−−−−−DTSEELV−−−−QAAMERALKQQ−−−−−−−KKW−−−−−−−−−−−NYAEGILKQWVNNNVKTLKDV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DALETEYQRNKGVKKRVG 
fig|527032.3.peg.1384   Bacillus thuringiensis serovar andalousiensis BGSC 4AW1     MATFRV−−NKDKNYTTINNTGLKDKRL−−−SWKAKGILAYIL−−TLPDDWVF−−−−−−−YREELSRHAKD−−−−−GLDSLRAGM−−−−−−−−−KELKEYGYLKRFPVRDDNNK−−−−−−−−−−−−−IIKWETIIYEV−−−−−−PQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NDPV−−−−−−−−−−−AEKPPVEIPPE−−−−−−−−−−−−−−−EKPPEE−−−−−−−−−−−−−−−−−−−−−−KPPVENPEL−−−−−−−−−−LSTKE−−−−−−LNTKEPSTDIQSSSS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFSFYENNFGI−−−LNSFIAEN−−−−−ISQWVN−−−−−−−−−DTSEELV−−−−QAAMERALKQQ−−−−−−−KKW−−−−−−−−−−−NYAEGILKQWVNNNVKTLKDV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DALETEYQRNKGVKKRVG 
fig|527024.3.peg.5182   Bacillus thuringiensis serovar tochigiensis BGSC 4Y1     VATFRV−−NKSKNYTTINNTGLRDERL−−−SWKAKGILAYIL−−SLPDDWVF−−−−−−−YMEEISTHAKD−−−−−GIDSLRVGM−−−−−−−−−KELKKYGYVRRFPVKNEKGK−−−−−−−−−−−−−ITNWETIIYEV−−−−−−PQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VENPH−−−−−−−−−−−MEKPQV−−−−−−−−−−−−−−−−−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−−VPFVENPTL−−−−−−−−−−LSTKE−−−−−−LSTNKQNTNIQSSSS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFSFYENNFGI−−−LNSFIAEN−−−−−ISQWVN−−−−−−−−−DTSEELV−−−−HAAMERALKQQ−−−−−−−KKW−−−−−−−−−−−NYAEGILKQWVNNNVKTLKDV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DALETEYQRNKGVKKRVG 
fig|1286404.3.peg.2623   Bacillus thuringiensis serovar thuringiensis str. IS5056     MATFRV−−SKSKNYTTINNTGLRDERL−−−SWKAKGILAYIL−−SLPDDWVF−−−−−−−YMEEISTHAKD−−−−−GIDSLRVGM−−−−−−−−−KELKKFGYVRRFPVKNEKGK−−−−−−−−−−−−−ITNWETIIYEV−−−−−−PQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VENPH−−−−−−−−−−−MENPQV−−−−−−−−−−−−−−−−−−−−EKSQME−−−−−−−−−−−−−−−−−−−−−−VPFMENPTL−−−−−−−−−−LSTKE−−−−−−LSTNKQNTNIKSSIS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFSFYENNFGI−−−LNSFIAEN−−−−−ISQWIN−−−−−−−−−NMNEELV−−−−QAAMERALKQQ−−−−−−−KKW−−−−−−−−−−−NYAEGILKQWINNNVKTLKDV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DALETEYQRTKGVKKRVG 
fig|527031.3.peg.4248   Bacillus thuringiensis serovar berliner ATCC 10792     MATFRV−−SKSKNYTTINNTGLRDERL−−−SWKAKGILAYIL−−SLPDDWVF−−−−−−−YMEEISTHAKD−−−−−GIDSLRVGM−−−−−−−−−KELKKFGYVRRFPVKNEKGK−−−−−−−−−−−−−ITNWETIIYEV−−−−−−PQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VENPH−−−−−−−−−−−MENPQV−−−−−−−−−−−−−−−−−−−−EKSQME−−−−−−−−−−−−−−−−−−−−−−VPFMENPTL−−−−−−−−−−LSTKE−−−−−−LSTNKQNTNIKSSIS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFSFYENNFGI−−−LNSFIAEN−−−−−ISQWIN−−−−−−−−−NMNEELV−−−−QAAMERALKQQ−−−−−−−KKW−−−−−−−−−−−NYAEGILKQWINNNVKTLKDV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DALETEYQRTKGVKKRVG 
fig|526979.3.peg.2920   Bacillus cereus 95/8201     MATFRV−−NKSKNYTTINNTGLRDERL−−−SWKAKGILAYIL−−SLPDDWVF−−−−−−−YMEEISTHAKD−−−−−GIDSLRVGM−−−−−−−−−KELKKYGYVRRFPVKNEKGK−−−−−−−−−−−−−ITNWETIIYEV−−−−−−PQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VENPH−−−−−−−−−−−MEKPQV−−−−−−−−−−−−−−−−−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−−VPFLENPTL−−−−−−−−−−LSTKE−−−−−−LNTNKQNTNIQSSSS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFSFYENNFGI−−−LNTFIAES−−−−−ISQWVN−−−−−−−−−DTSEELV−−−−QAAMERALKQQ−−−−−−−KKW−−−−−−−−−−−NYAEGILKQWVNNNVKTLKDV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DALETEYQRNKGVKKRVG 
fig|526977.3.peg.2183   Bacillus cereus ATCC 4342     MATFRV−−NKSKNYTTINNTGLRDERL−−−SWKAKGILAYIL−−SLPDDWVF−−−−−−−YMEEISTHAKD−−−−−GIDSLRVGM−−−−−−−−−KELKKYGYVRRFPVKNEKGK−−−−−−−−−−−−−IANWETIIYEV−−−−−−PQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VENPQ−−−−−−−−−−−MEKPQV−−−−−−−−−−−−−−−−−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−−VPQVENPTL−−−−−−−−−−LSTKE−−−−−−LSTNKQNTNIQSSIS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFSFYENNFGI−−−LNSFIAES−−−−−ISQWVN−−−−−−−−−DTSEELV−−−−QAAMERALKQQ−−−−−−−KKW−−−−−−−−−−−NYAEGILKQWVNKNIRTLTDV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NAAEIEF             
fig|526988.3.peg.2862   Bacillus cereus Rock4-18     MATFRV−−HKSKNYTTINNTGLRDERL−−−SWKAKGILAYIL−−SLPDDWVF−−−−−−−YMEEISTHAKD−−−−−GIDSLRVGV−−−−−−−−−KELKKFGYVRRFPVKNEKGK−−−−−−−−−−−−−ITNWETIIYEV−−−−−−PQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VENPH−−−−−−−−−−−MEKPQV−−−−−−−−−−−−−−−−−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−−VPFMENPIL−−−−−−−−−−LSTKE−−−−−−LSTNKQNTDIQSSSS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFSFYENNFGI−−−LNSFIAES−−−−−ISQWVN−−−−−−−−−DSSEELV−−−−QAAMQRALKQQ−−−−−−−KKW−−−−−−−−−−−NYAEGILKQWVNKNIRTLADV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NAAEIEF             
fig|526990.3.peg.4583   Bacillus cereus AH603     MATFRV−−NKSKNYTTINNTGLRDERL−−−SWKAKGILAYIL−−SLPDDWVF−−−−−−−YMEEISTHAKD−−−−−GIDSLRVGM−−−−−−−−−KELKKFGYVRRFPVKNEKGK−−−−−−−−−−−−−ITNWETIIYEV−−−−−−PQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VENPH−−−−−−−−−−−MKNPQV−−−−−−−−−−−−−−−−−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−−VPFIENPTL−−−−−−−−−−LSTKE−−−−−−LSTNKQNTNIQSSSS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFSFYENNFGI−−−LNSFIAES−−−−−ISQWVN−−−−−−−−−DTSEELV−−−−QAAMERALKQQ−−−−−−−KKW−−−−−−−−−−−NYAEGILKQWVNKNILTLVDV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NAAEIEF−−KNKDKKERKT 
fig|226900.1.peg.2433   Bacillus cereus ATCC 14579     MATFRV−−SKSKNYTTINNTGLRDERL−−−SWKAKGILAYIL−−SLPDDWVF−−−−−−−YMEEISTHAKD−−−−−GIDSLRVGM−−−−−−−−−KELKKFGYVRRFPVKNEKGK−−−−−−−−−−−−−ITNWETIIYEV−−−−−−PQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VENPD−−−−−−−−−−−MENPQV−−−−−−−−−−−−−−−−−−−−EKSQME−−−−−−−−−−−−−−−−−−−−−−VPFMENPKL−−−−−−−−−−LNTKE−−−−−−LSTNKQNTNIQSSSS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFSFYENNFGI−−−LNSFIAES−−−−−ISQWVN−−−−−−−−−DTSEKLV−−−−QAAMERALKQQ−−−−−−−KKW−−−−−−−−−−−NYAEGILKQWVNKNIRTLADV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NAAEIEF−−KNKGEK−−−G 
fig|526978.3.peg.2531   Bacillus cereus BDRD-Cer4     MATFRV−−SKSKNYTTINNTGLRDERL−−−SWKAKGILAYIL−−SLPDDWVF−−−−−−−YMEEISTHAKD−−−−−GIDSLRVGM−−−−−−−−−KELKKFGYVRRFPVKNEKGK−−−−−−−−−−−−−ITNWETIIYEV−−−−−−PQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VENPD−−−−−−−−−−−MENPQV−−−−−−−−−−−−−−−−−−−−EKSQME−−−−−−−−−−−−−−−−−−−−−−VPFMENPKL−−−−−−−−−−LNTKE−−−−−−LSTNKQNTNIQSSSS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFSFYENNFGI−−−LNSFIAES−−−−−ISQWVN−−−−−−−−−DTSEKLV−−−−QAAMERALKQQ−−−−−−−KKW−−−−−−−−−−−NYAEGILKQWVNKNIRTLADV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NAAEIEF−−KNKGEK−−−G 
fig|405532.4.peg.2377   Bacillus cereus B4264     MATFRV−−SKSKNYTTINNTGLRDERL−−−SWKAKGILAYIL−−SLPDDWVF−−−−−−−YMEEISTHAKD−−−−−GIDSLRVGM−−−−−−−−−KELKKFGYVRRFPVKNEKGK−−−−−−−−−−−−−ITNWETIIYEV−−−−−−PQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VENPD−−−−−−−−−−−MENPQV−−−−−−−−−−−−−−−−−−−−EKSQME−−−−−−−−−−−−−−−−−−−−−−VPFMENPKL−−−−−−−−−−LSTKE−−−−−−LSTNKQNTNIQSSGS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFSFYENNFGI−−−LNSFIAES−−−−−ISQWVD−−−−−−−−−DTSEELV−−−−QAAMERALKQQ−−−−−−−KKW−−−−−−−−−−−NYAEGILKHWVNKNIRNLADV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NAAEIEF−−KNKGKK−−−G 
fig|272622.10.peg.2306   Lactococcus lactis subsp. cremoris SK11       IKRK−−KAANNFTILSNEFLRDENL−−−SLKAKGLLAYIL−−SLPDDWKI−−−−−−−YFEEIEKHHRD−−−−−GKASLRSAW−−−−−−−−−KELESNGYARTLRKTDPETK−−−−−−−−−−−−−AVKEWYKEVSDF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KKPDSD−−−−−−−−−−−−−−−−−−−−−−FPDVGNQQL−−−−−−−−−−LNTNI−−−−−QNTEKQNTDNKKTTTLSDENSG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LS−−−−QKLSDIYQENFGMASSLIIEN−−−−−IKYDLE−−−−−−−−−DFGFDLV−−−−KEAMTRAA                                                                                                
fig|388400.4.peg.3057   Bacillus sp. B14905       INRV−−EKDKNYTVVDNGYIFDVRL−−−SLKAKGLLTMML−−SRPDDWMF−−−−−−−YMDELQTHSAD−−−−−GEKSLRAGF−−−−−−−−−KELQEHGYVKKFPVYEN−−−RK−−−−−−−−−−−−−ITKWVTVVYEV−−−−−−SQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TLEPP−−−−−−−−−−−VLAQKV−−−−−−−−−−−−−−−−−−EVQNVDVG−−−−−−−−−−−−−−−−−−−−−−FVDVQKEGL−−−−−−−−−−LSTDI−−−−−NQVLNKQSIDVPI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−INKLSTDE−−−−−IKT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKLSTKKD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RQTTSFKDSF
fig|428125.8.peg.1041   Clostridium leptum DSM 753       IFRV−−HKNKNYTTMCNIHFDDRRL−−−SLKAVGLHSFIL−−SKPDDWKI−−−−−−−IIQNIIHSHTD−−−−−GRESVYSGI−−−−−−−−−RELVKFGYWVKYPVRKN−−−GK−−−−−−−−−−−−−ISYYQTDIYEE−−−−−−PQPEGQRCVKVEYLLDLCCVTYDSGKTEYFNFDGTPAQGISKEEMMKSLHTGKPKAEEKQ−−−−−−−−−−−VENLLP−−−−−−−−−−−−−−−−−−−−GNPYSE−−−−−−−−−−−−−−−−−−−−−−NHHAEKQQL−−−−−−−−−−LNTDI−−−−−−−−−−−PNTDLLNTEQTVVSDKE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDEMKKKIK−−−FDN−−LLQQ−−−−−−−−−−−GADPSVLKAILEVITETC                                                      
fig|583346.6.peg.26   Clostridium kluyveri NBRC 12016     MATIRV−−QKNENYSTINNTGLNDCNL−−−SFKAKGILAYLL−−SKPDNWKC−−−−−−−QVSDLIKKSKD−−−−−GRDSVYAGL−−−−−−−−−RELRENGYMIKRPVKNEKNI−−−−−−−−−−−−−ITEWEEVLYET−−−−−−PQ−−−−−−−−−−−−−−−−−−−−−−−−−LEAKEVFKEQKIKNEIAALKRAKTIKSKKINPL−−−−−−−−−−−PENPYM−−−−−−−−−−−−−−−−−−−−EESTSG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ISVSGKPVNIISTNLPSTDLVVVVNS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LIKEFEENICD−−−LKKTTKPK−−−−−FIKYCQ−−−−−−−−−EYSKEYI−−−−MTILEVCAESG−−−−−−IKSF−−−−−−−−−−−AGFRTVIETHIKNKNDTPEKI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RAAVEKYR−−QDKKNKQKVP
fig|411469.3.peg.354   Eubacterium hallii DSM 3353     MAVLKN−−KTQKNFTIISNNVLRDKEL−−−SMKDRGVLCTIC−−SLPDEWKF−−−−−−−SISGLSAIVPD−−−−−GVDAIRKSI−−−−−−−−−FNLESLGYVVRKKTRGKDGK−−−−−−−−−−−−−YVSEIEVFTEKRNVIDLPP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−REIRH−−−−−−−GESITDNSTW−−−−−−−−−−−−−−−−−−−−−KNQYG−−−−−−−−−−−−−−−−−−−−−−NAIAEKTLQ−−−−−−−−−−YNKDN−−−−−−−KSKEIKTDNIKSIHLSGKSEVE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EDVEREIDIYKYKE                                                                                                                                                       
fig|246199.4.peg.2611   Ruminococcus albus 8     MSKLIK−−RLSGDFTIISNKVFRNKKL−−−GVTDRGTLCTLL−−SLPDNWNF−−−−−−−SIRGLAAILPD−−−−−GVTKIENSL−−−−−−−−−NRLEYDHHYLKRVRVFEN−−−GR−−−−−−−−−−−−−IIDWDYIISDE−−−−−−PM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DADEDEDGGNVENVENSSASAPRDTDIQDAELLDT−−−−−−−−−−−−−−−−−−−−ENPYLE−−−−−−−−−−−−−−−−−−−−−−KRHLENPDAYKE−−−−−−−LNNQESKNKILCDKESTNQSASVQETDSVETVENL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDGVIEGYSTDTKR−−−−−−−−IKSIIKEHIEYEDYLQWIR−−−−−−−−−LFGKDMT−−−−TAEIKQLVDKLAK                                                                                           
fig|246199.4.peg.1467   Ruminococcus albus 8         RV−−NKTDNFTIVSSLLLRSKEI−−−SLKSLGLLLRVL−−SFPDDWDY−−−−−−−SVAGLVFICKE−−−−−GKTAIDSAL−−−−−−−−−KELKNIGYLVVTKLYANLTASK−−−−−−−−−−−−−GIEYVYDFFEN−−−−−−PI−−−−−−−−−−−−−−−−−−−−−−−−SEDEADKHREKVKAEAKAKVSGAELSTEMLKTADFSAPQEGEKQGVENLYL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DDLPLEVLPTENRPQYNTKEQNKENKILCDEGS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IN−−−−−−−−−−−−−−−−−−−−QSAVSGTK−−−−−AERFVE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NSAPRLMDGYITDKEKIKNII−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KENIEYDEYVEWIELFGSD
fig|411467.6.peg.2357   Bacteroides capillosus ATCC 29799     VAVYRV−−NKNRGYTVMANFHLRDKSL−−−SLKAVGLLSKML−−SFNDGWKF−−−−−−−STKGLSAICKE−−−−−GPDAILSAL−−−−−−−−−RELEKHGYLVRHRQRDGKGR−−−−−−−−−−−−−MSSTIFEIYEE−−−−−−PQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ESTPEREMPH−−−−−−−−−−−TENPCV−−−−−−−−−−−−−−−−−−−−EKPDVD−−−−−−−−−−−−−−−−−−−−−−NPRGDKSAQ−−−−−−−−−−INTDQ−−−−−VITQERNTLSKNYQSIN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LDGMDRMD−−−−−ER−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SE−−−YEE−−IIKE−−−−−−−−−−−NL                                                                      
fig|411483.3.peg.2155   Faecalibacterium prausnitzii A2-165     VAVYRV−−NKNRGYTVMANFHLRDKSL−−−SLKAVGLLSKML−−SFNDGWKF−−−−−−−STKGLSAICKE−−−−−GPDAILSAL−−−−−−−−−RELEKHGYLVRHRQRDGKGR−−−−−−−−−−−−−MSSTIFEIYEE−−−−−−PQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ESTPEREMPH−−−−−−−−−−−TENPCV−−−−−−−−−−−−−−−−−−−−EKPDVD−−−−−−−−−−−−−−−−−−−−−−NPRGDKSAQ−−−−−−−−−−INTDQ−−−−−VITQERNTLSKNYQSIN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LD                                                                                                                                             
fig|500632.7.peg.689   Clostridium nexile DSM 1787     MAVYRV−−NKNRGYTVMANYHLRDKTL−−−SLKAVGLLSKML−−SFNDGWQF−−−−−−−STKGLSAICKE−−−−−GPDAVLAAL−−−−−−−−−RELEDHGYLIRHRQRDAKGR−−−−−−−−−−−−−MSNTVFEIYEQ−−−−−−PQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PVSPHRENPD−−−−−−−−−−−VDNPDM−−−−−−−−−−−−−−−−−−−−ENPHLE−−−−−−−−−−−−−−−−−−−−−−NPHGENPAQ−−−−−−−−−−LNTNQ−−−−−VITNERNNSLNNYQSIN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LD                                                                                                                                             
fig|411461.4.peg.2937   Dorea formicigenerans ATCC 27755     MAVFRI−−ERTRDYTVMSNHHLRNANL−−−SLKAKGLLSMML−−SLPEDWNY−−−−−−−TTRGLAKICKE−−−−−GVDAIGAAL−−−−−−−−−RELEAAGYIVRHKLRDSQGR−−−−−−−−−−−−−ISDTEYVIYEQ−−−−−−PQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LRKPD−−−−−−−−−−−TDSPDT−−−−−−−−−−−−−−−−−−−−ENPYMD−−−−−−−−−−−−−−−−−−−−−−KPDTEKPAE−−−−−−−−−−LNIEK−−−−−SNTQKQNIYGSSTDSIP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FRDCAADC−−−−−−−−−−−−−−−−−−−−−LPEWKGRDAMSLTEIES−−−−YRE−−LIQE−−−−−−−−−−−NIGYEYLCQQYETYREDLDEI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VELIVETVCAKRKTTR   
fig|411486.3.peg.2240   Clostridium sp. M62/1     MAVFRI−−ERTRDYTVMSNHHLRNANL−−−SLKAKGLLSMML−−SLPEDWNY−−−−−−−TTRGLAKICKE−−−−−GVDAIGAAL−−−−−−−−−RELEAAGYIVRHKLRDRQGR−−−−−−−−−−−−−ISDTEYVIYEQ−−−−−−PQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LRKPD−−−−−−−−−−−TDSPDT−−−−−−−−−−−−−−−−−−−−ENPYMD−−−−−−−−−−−−−−−−−−−−−−KPDTEKPAE−−−−−−−−−−LNIEK−−−−−SNTQKQNIYGSSTDSIP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FRDCAADC−−−−−−−−−−−−−−−−−−−−−LPERKGRDAMSLTEIES−−−−YRE−−LIQE−−−−−−−−−−−NIGYEYLCQQYETYREDLDEI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VELIVETVCAKRKTTR   
fig|622312.4.peg.2171   Roseburia inulinivorans DSM 16841     MAVFRI−−ERTRDYTVMSNHHLRNANL−−−SLKAKGLLSMML−−SLPEDWNY−−−−−−−TTRGLAKICKE−−−−−GVDAIGAAL−−−−−−−−−RELEAAGYIVRHKLRDRQGR−−−−−−−−−−−−−ISDTEYVIYEQ−−−−−−PQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LRKPD−−−−−−−−−−−TDSPDT−−−−−−−−−−−−−−−−−−−−ENPYMD−−−−−−−−−−−−−−−−−−−−−−KPDTEKPAE−−−−−−−−−−LNIEK−−−−−SNTQKQNIYGSSTDSIP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FRDCAADC−−−−−−−−−−−−−−−−−−−−−LPERKGRDAMSLTEIES−−−−YRE−−LIQE−−−−−−−−−−−NIGYEYLCQQYETYREDLDEI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VELIVETVCAKRKTTR   
fig|428127.7.peg.432   Eubacterium dolichum DSM 3991     MAVFRI−−ERTRDYTVMSNHHLRNANL−−−SLKAKGLLSMML−−SLPEDWNY−−−−−−−TTRGLAKICKE−−−−−GVDAIGAAL−−−−−−−−−RELEAAGYIVRHKLRDRQGR−−−−−−−−−−−−−ISDTEYVIYEQ−−−−−−PQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LRKPD−−−−−−−−−−−TDSPDT−−−−−−−−−−−−−−−−−−−−ENPDMD−−−−−−−−−−−−−−−−−−−−−−KPDTEKPAE−−−−−−−−−−LNIEK−−−−−SNTQKQNIYGSSTDSIP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FRDCAADC−−−−−−−−−−−−−−−−−−−−−LPERKGRDAMSLTEIES−−−−YRE−−LIQE−−−−−−−−−−−NIGYEYLCQQYETYREDLDEI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VELIVETVCAKRKTTR   
fig|663278.3.peg.1771   Ethanoligenens harbinense YUAN-3     MAVFRV−−ERTRDYTVMSNHHLKNRAL−−−SLKAKGLLSMML−−SLPDDWDY−−−−−−−TTRGLASICRE−−−−−GVDAIGKTL−−−−−−−−−KELENAGYMERRQLRGKDGR−−−−−−−−−−−−−ITDTEYTIYEQ−−−−−−PR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KPPGTPLPDTDSPD−−−−−−−−−−−TEKPYL−−−−−−−−−−−−−−−−−−−−DNPDME−−−−−−−−−−−−−−−−−−−−−−KPDTENPAQ−−−−−−−−−−LNTKG−−−−−TNIPKKLNTYGANTHLSNPADRK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PEAVAPADAMDATDSYRE−−−−−−−−IIKE−−−−−−−−−−−NIS                                                                     
fig|411463.4.peg.1075   Eubacterium ventriosum ATCC 27560     MAVFRV−−EKTKDFTIMSNHHLRNTEL−−−SLKAKGLLSLML−−SLPEDWDY−−−−−−−TTKGLAHICKD−−−−−GVDSITTAL−−−−−−−−−KELERHGYLTRQRLRYDNGQ−−−−−−−−−−−−−LGDIEYTIHEQ−−−−−−PV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ST−−−−−−−−−−ENTGLSPKRENPR−−−−−−−−−−−QVKPEQ−−−−−−−−−−−−−−−−−−−−AKPKQA−−−−−−−−−−−−−−−−−−−−−−EPEQENPAQ−−−−−−−−−−LNTNP−−−−−LKTKKSKKDKSITYPSI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YPAE−−−−−−−−−−−−−−−−−−−−−−−−−−PEAANRTDGMDRIELIEA−−−YRE−−IIKE−−−−−−−−−−−NIEYDLLVLR−−YGRERLDEA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LELMLE−−−−VILSKRPYIR
fig|478749.5.peg.1312   Bryantella formatexigens DSM 14469                       NHHLRNTEL−−−SLKAKGLLSLML−−SLPEDWDY−−−−−−−TTKGLAHICKD−−−−−GVDSITTAL−−−−−−−−−KELERHGYLTRQRLRYENGQ−−−−−−−−−−−−−LGDIEYTIHEK−−−−−−PV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NA−−−−−−−−−−EKQTFPPKRENPR−−−−−−−−−−−QVNPGQ−−−−−−−−−−−−−−−−−−−−AKPEQV−−−−−−−−−−−−−−−−−−−−−−EPGQENPAQ−−−−−−−−−−LNTNP−−−−−QRTKKSKTDISRTHQSI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YPAE−−−−−−−−−−−−−−−−−−−−−−−−−−PEAAGRPDGMDRIGLIDA−−−YSK−−IIKE−−−−−−−−−−−NIEYDCMVSR−−YGKERLDET−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VELMLE              
fig|411486.3.peg.1517   Clostridium sp. M62/1     MAVFRV−−ERTKGFTVMSNYHLNDKTI−−−SLKAKGLLSQML−−SLPDSWDF−−−−−−−TLRGLASINKE−−−−−SLDAIRTAV−−−−−−−−−LELEKHGYITRRQLRNSSGK−−−−−−−−−−−−−LAKIEYTIYEQ−−−−−−PQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QPSPLSPRLENPNTAPSPHLGKPCLENPNT−−−−−−−−−−−−−−−−−−−−VNPNTE−−−−−−−−−−−−−−−−−−−−−−KPNTDIPTQ−−−−−−−−−−LNTKQ−−−−−QNTEKSITDISNT                                                                                                                                                                                                              
fig|518636.5.peg.2001   Clostridium asparagiforme DSM 15981                                             ML−−SLPDDWDY−−−−−−−TLSGLSVINRE−−−−−SKDAIRSAL−−−−−−−−−NELEAAGYIRRRQTTDASGK−−−−−−−−−−−−−FSSNEYIIYER−−−−−−PE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EPEPS−−−−−−−−−−−SENPTT−−−−−−−−−−−−−−−−−−−−EKPMTE−−−−−−−−−−−−−−−−−−−−−−KPSSGNPTQ−−−−−−−−−−LNTKK−−−−−SITKKSITDLSSTDSFP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FPSGETAA−−−−−−−−−−−−−−−−−−−−GPPEANRRETDTDQMEL−−−−−−YRD−−LIKE−−−−−−−−−−−NISYEILRQDMPYDCDRLDEI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VELMVE              
fig|411461.4.peg.1938   Dorea formicigenerans ATCC 27755     MAVFRV−−ERNKGYTVMSNHHLRNKEL−−−SLKAKGLLSQML−−SLPEDWDY−−−−−−−TLKGLSLINRE−−−−−KIDAIREAI−−−−−−−−−KELERAGYIVRSRERDEKGR−−−−−−−−−−−−−LRGADYVIFEQ−−−−−−PQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PPTPDLPTLENPT−−−−−−−−−−−LDNPTQ−−−−−−−−−−−−−−−−−−−−EKPTLE−−−−−−−−−−−−−−−−−−−−−−KPTLENPTQ−−−−−−−−−−LNKDIQRTDLPKKEKSNTDLSSTHS                                                                                                                                                                                                            
fig|411486.3.peg.2078   Clostridium sp. M62/1     MAVFRV−−ERNKGYTVMSNHHLRNKEL−−−SLKAKGLLSQML−−SLPEDWDY−−−−−−−TLKGLSLINRE−−−−−KIDAIREAI−−−−−−−−−KELERAGYIVRSRERDEKGR−−−−−−−−−−−−−LRGADYVIFEQ−−−−−−PQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PPTPDLPTLENPT−−−−−−−−−−−LDNPTQ−−−−−−−−−−−−−−−−−−−−EKPTLE−−−−−−−−−−−−−−−−−−−−−−KPTLENPTQ−−−−−−−−−−LNKDIQRTDLPKKEKSNTDLSSTHS                                                                                                                                                                                                            
fig|500632.7.peg.2479   Clostridium nexile DSM 1787     MAVFRV−−ERNKGYTVMSNHHLRNKEL−−−SLKAKGLLSQML−−SLPEDWDY−−−−−−−TLKGLSLINRE−−−−−KIDAIREAI−−−−−−−−−KELERAGYIVRSRERDEKGR−−−−−−−−−−−−−LRGADYVIFEQ−−−−−−PQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PPTPDLPTLENPT−−−−−−−−−−−LDNPTQ−−−−−−−−−−−−−−−−−−−−EKPTLE−−−−−−−−−−−−−−−−−−−−−−KPTLENPTQ−−−−−−−−−−LNKDIQRTDLPKKEKSNTDLSSTHS                                                                                                                                                                                                            
fig|552396.3.peg.487   Erysipelotrichaceae bacterium 5_2_54FAA     MAVFRV−−ERNKGYTVMSNHHLRNKEL−−−SLKAKGLLSQML−−SLPEDWDY−−−−−−−TLKGLSLINRE−−−−−KIDAIREAI−−−−−−−−−KELERAGYIVRSRERDEKGR−−−−−−−−−−−−−LRGADYVIFEQ−−−−−−PQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PPTPDLPTLENPT−−−−−−−−−−−LDNPTQ−−−−−−−−−−−−−−−−−−−−EKPTLE−−−−−−−−−−−−−−−−−−−−−−KPTLENPTQ−−−−−−−−−−LNKDIQRTDLPKKEKIITDEQSTHS                                                                                                                                                                                                            
fig|622312.4.peg.966   Roseburia inulinivorans DSM 16841     MAVFRV−−ERNKGYTVMSNHHLRNKEL−−−SLKAKGLLSQML−−SLPEDWDY−−−−−−−TLKGLSLINRE−−−−−KIDAIREAI−−−−−−−−−KELERAGYIVRSRERDEKGR−−−−−−−−−−−−−LRGADYVIFEQ−−−−−−PQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PPTPDLPTLENPT−−−−−−−−−−−LDNPMQ−−−−−−−−−−−−−−−−−−−−EKPTLE−−−−−−−−−−−−−−−−−−−−−−KPTLENPTQ−−−−−−−−−−LNKDIQRTDLPKKEKSNTDLSSTHS                                                                                                                                                                                                            
fig|691161.5.peg.4463   Clostridium difficile 6534     MAVFRV−−ERNKGYTVMSNHHLRNKEL−−−SLKAKGLLSQML−−SLPEDWDY−−−−−−−TLKGLSLINRE−−−−−KIDAIREAI−−−−−−−−−KELERAGYIVRSRERDEKGR−−−−−−−−−−−−−LRGADYVIFEQ−−−−−−PQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PPTPDLPTLENPT−−−−−−−−−−−LDNPMQ−−−−−−−−−−−−−−−−−−−−EKPTLE−−−−−−−−−−−−−−−−−−−−−−KPTLENPTQ−−−−−−−−−−LNKDIQRTDLPKKEKSNTDLSSTHS                                                                                                                                                                                                            
fig|525259.3.peg.407   Clostridium difficile NAP08     MAVFRV−−ERNKGYTVMSNHHLRNKEL−−−SLKAKGLLSQML−−SLPEDWDY−−−−−−−TLAGLSFINRE−−−−−KIDAIREAV−−−−−−−−−KELERAGYIVRSRERDEKGR−−−−−−−−−−−−−LRGADYVIFEQ−−−−−−PQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TPPVSDLPTLENPT−−−−−−−−−−−LDNPTL−−−−−−−−−−−−−−−−−−−−EKPTQK−−−−−−−−−−−−−−−−−−−−−−KPTLENPTQ−−−−−−−−−−LNKDIQKTNLPKKEKSNIDLSSTDSIP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IHSL                                                                                                                                           
fig|518636.5.peg.1627   Clostridium asparagiforme DSM 15981     MAVFRV−−ERNTGYTVMSNHHLRNKEL−−−TLKAKGLLSQML−−SLPEDWDY−−−−−−−TLAGLSHINRE−−−−−KIDAIREAV−−−−−−−−−KELEKAGYIVRSRERDEKGR−−−−−−−−−−−−−LRGADYVIYEQ−−−−−−PQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PREPEAATSGGQPPILDLPTLENPT−−−−−−−−−−−LDNPTL−−−−−−−−−−−−−−−−−−−−EKPTQE−−−−−−−−−−−−−−−−−−−−−−KPTLENPTQ−−−−−−−−−−LNKDI−−−−−SSKEQSITDLSSTHSIP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FHSLN                                                                                                                                          
fig|500632.7.peg.674   Clostridium nexile DSM 1787                     MSNHHLRNKEL−−−SLKAKGLLSQML−−SLPEDWDY−−−−−−−TLAGLSLINRE−−−−−KIDAIREAV−−−−−−−−−RELENAGYIQRSRERDEKGR−−−−−−−−−−−−−LRGTTYVIYEQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PPKLDLPTLEKPT−−−−−−−−−−−−−−−−L−−−−−−−−−−−−−−−−−−−−EKPMLE−−−−−−−−−−−−−−−−−−−−−−KPTLENPTQ−−−−−−−−−−LNKEIQKTNLPKKEKLNTDVLSTHSIP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FHSLNPSP−−−−−LEDAA−−−−−−−−−−QPPERKRKETTDAYSV−−−−−−YEE                                                                                         
fig|428125.8.peg.969   Clostridium leptum DSM 753     MAVFRV−−ERNTGYTVMSNHHLRNKEL−−−SLKAKGLLSQML−−SLPEDWDY−−−−−−−TLAGLSYINRE−−−−−KIDAIREAV−−−−−−−−−RELERAGYIQRSRERDEKGR−−−−−−−−−−−−−LRGTDYIIYEQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PPNLDLPTLENPT−−−−−−−−−−−LGNPTL−−−−−−−−−−−−−−−−−−−−ENPTQE−−−−−−−−−−−−−−−−−−−−−−KPTLENPMQ−−−−−−−−−−LNKDIQKTDLPKKEKSNTDLSSNHS                                                                                                                                                                                                            
fig|545696.5.peg.2609   Holdemania filiformis DSM 12042     MAVFRV−−EKNRGYTVMSNHHLRNKDL−−−SLKAKGLLSQML−−SLPEDWDF−−−−−−−TLKGLSLINRE−−−−−QIDAIRAAV−−−−−−−−−KELEQAGYIVRSRERDSQGR−−−−−−−−−−−−−LRGADYIIYEQ−−−−−−PQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PVPDSPT−−−−−−−−−−−LENPTL−−−−−−−−−−−−−−−−−−−−DNPTQE−−−−−−−−−−−−−−−−−−−−−−KPTQEKPTQ−−−−−−−−−−LNKDR−−−−−SSKEKSITDGSNTDSIP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ILSPPSP−−−−−LGEEAA−−−−−−−−−APP                                                                                                                
fig|476272.5.peg.1000   Blautia hydrogenotrophica DSM 10507     MAVFRV−−EKNRGYTVMSNHHLRNKDL−−−SLKAKGLLSQML−−SLPEDWDF−−−−−