(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00010043

fig|1248436.3.peg.3713   Bacillus anthracis str. 3166     MSNLLIHEEPLLVLPGLA−−−−−−SRIG−−LNEAIFLQQIHYWLNRSKH−−FY−−−−DERNWVYNSVAEWVKQFPFWSENTIR−−−−−RIVKNLEDEQLLVI−−−−−−−−GNYN−−−−RAKFDKTKWYSINYEK−−−−LRLL−−ESTNDVPNLG−−−−−−−−−−−RRSTQNGQMD−−−−−−−−−−−−VPNLG−−−−−−KPI−−−−PET−−−−−−−−−−NT−−−ETTSEI−−−−KEYIV−−−−−−−−−−−−−−−−−−−−E−−−−IVNYLNDVCGSSYRL−−−−−−−−−TSKKTQT−−−−−−−−−−−−LIKTRLVEGF−−−−−−−−TVDNFKTVIDTKAKEWL−−−−−RTEQAKYLRPETLFG−−−−−−TKFEGYLQQGKVEGKH−−−−GSSKGNRYSKDPFEEDDLPF
fig|315730.11.peg.4086   Bacillus weihenstephanensis KBAB4     MSNLLIHEEPLLVLPGLA−−−−−−SRIG−−LNEAIFLQQIHYWLNRSKH−−FY−−−−DERNWVYNSVAEWVKQFPFWSENTIR−−−−−RIVKNLEDEQLLVI−−−−−−−−GNYN−−−−RAKFDKTKWYSINYEK−−−−LRLL−−EPTNDVPNLG−−−−−−−−−−−RRSTQNGQMD−−−−−−−−−−−−VPNLG−−−−−−KPI−−−−PET−−−−−−−−−−NT−−−ETTSEI−−−−KEYIV−−−−−−−−−−−−−−−−−−−−E−−−−IVNYLNDVCGSSYRL−−−−−−−−−TSKKTQT−−−−−−−−−−−−LIKTRLVEGF−−−−−−−−TVDNFKTVIDTKAKEWL−−−−−RTEQAKYLRPETLFG−−−−−−TKFEGYLQQGKVEGKH−−−−GSSKGNRYSKDPFEEDDLPF
fig|1213182.3.peg.1818   Bacillus anthracis str. BF1     MSKLLIHEEPLLVLPGLA−−−−−−SRIG−−LNEAIFLQQIYYWLNRSKH−−FY−−−−DERNWVYNSVAEWVKQFPFWSENTIR−−−−−RIVKNLEDEQLLVI−−−−−−−−GNYN−−−−RAKFDKTKWYSINYEK−−−−LRLL−−ESTNDVPNLG−−−−−−−−−−−RRSTQNGQMD−−−−−−−−−−−−VPNLG−−−−−−KPI−−−−PET−−−−−−−−−−NT−−−ETTSEI−−−−KEYIV−−−−−−−−−−−−−−−−−−−−E−−−−IVNYLNDVCGSSYRL−−−−−−−−−TSKKTQT−−−−−−−−−−−−LIKTRLVEGF−−−−−−−−TVDNFKTVIDTKAKEWL−−−−−RTEQAKYLRPETLFG−−−−−−TKFEGYLQQGKVEGKH−−−−GSSKGNRYSKDPFEEDDLPF
fig|526982.3.peg.4862   Bacillus cereus Rock1-15     MSNLLIHEEPLLVLPGLA−−−−−−TKIG−−LNEAIFLQQIHYWLKRSKH−−FY−−−−DGRPWIYNSIPKWQEQFPFWGESTIK−−−−−RTIKNLENINVLVI−−−−−−−−GNYN−−−−KKKFDKTKWYSIDYTF−−−−LRQL−−ESTDDEVNLT−−−−−−−−−−−PRTGQVDPME−−−−−−−−−−−−EVNLN−−−−−−RPI−−−−PEN−−−−−−−−−−TQ−−−RVTTETT−−AKEYIV−−−−−−−−−−−−−−−−−−−−E−−−−IVNYLNDVCGSSYRS−−−−−−−−−TSKKTQS−−−−−−−−−−−−LIKTRLIEGF−−−−−−−−TVDDFKTVIDTKAKEWL−−−−−RTEQAKYLRPETLFG−−−−−−TKFEGYLQQGKVEGKH−−−−GSNKGNRYSKDPFEEDDLPF
fig|288681.12.peg.3648   Bacillus cereus E33L     MSNLLIHEEPLLVLPGLA−−−−−−TKIG−−LNEAIFLQQIHYWLRRSKH−−FY−−−−DGRPWIYNSVPKWQEQFPFWGESTIK−−−−−RTIKNLENINVLVI−−−−−−−−GNYN−−−−KKKFDKTKWYSIDYTF−−−−LRQL−−ESTDDEVNLT−−−−−−−−−−−PRTGQVDPME−−−−−−−−−−−−EVNLN−−−−−−RPI−−−−PEN−−−−−−−−−−TQ−−−RVTTETT−−AKEYIV−−−−−−−−−−−−−−−−−−−−E−−−−IVNYLNDVCGSSYRS−−−−−−−−−TSKKTQS−−−−−−−−−−−−LIKSRLIEGF−−−−−−−−TVDNFKTVIDTKAREWL−−−−−RTEQAKYLRPETLFG−−−−−−TKFEGYLQQGKVEGKH−−−−GSSKGNRYSKDPFEEDDLPF
fig|526998.3.peg.4567   Bacillus mycoides Rock1-4     MSNLLIHEEPLLVLPGLA−−−−−−KKIG−−LNEAIFLQQIHYWLRRSKH−−YY−−−−DGRPWIYNSIPKWQEQFPFWGESTIK−−−−−RTIKNLENINVLVI−−−−−−−−GNYN−−−−KKKFDKTKWYSIEYTF−−−−LRQL−−ESTDDEFNLT−−−−−−−−−−−PRAGQVDLME−−−−−−−−−−−−EVNLN−−−−−−RPI−−−−PEN−−−−−−−−−−TQ−−−RVTTETT−−AKEYIV−−−−−−−−−−−−−−−−−−−−E−−−−IVNYLNDVCGSSYRS−−−−−−−−−TSKKTQT−−−−−−−−−−−−LIKTRLVEGF−−−−−−−−TVDNFKAVIDIKAREWL−−−−−RTEQAKYLRPETLFG−−−−−−TKFESYLQQGKVEGKH−−−−GSNKGNRYSKDPFEEDDLPF
fig|526987.3.peg.5077   Bacillus cereus Rock4-2     MSSLLIQDEPLLVLPRLA−−−−−−SKIG−−LNEAIFLQQIHYWLKRSKH−−YY−−−−DDRYWVYNSITNWHKQFPFWNERTLK−−−−−RIVKNLEEFNLLIS−−−−−−−−GNYN−−−−KLKFDKTKWYSINYDR−−−−LVEL−−EIDNDCDKLS−−−−−−−−−−−QRKEHIVMME−−−−−−−−−−−−NDNMS−−−−−−QPI−−−−PET−−−−−−−−−−TQ−−−KINSENT−−TQKDIV−−−−−−−−−−−−−−−−−−−−E−−−−IINYLNSVCNTSYRI−−−−−−−−−STKKTQM−−−−−−−−−−−−LIKSRLQEGF−−−−−−−−NINEFKEVIETKAKEWL−−−−−YTEQAKYLRPETLFG−−−−−−TKFEGYLQQRKMVKSN−−−−GFNKGNRYSTKSFEENEIPF
fig|526988.3.peg.2848   Bacillus cereus Rock4-18     MSSLLIQDEPLLVLPRLA−−−−−−SKIG−−LNEAIFLQQIHYWLKRSKH−−YY−−−−DDRYWVYNSITNWHKQFPFWNERTLK−−−−−RIVKNLEEFNLLIS−−−−−−−−GNYN−−−−KLKFDKTKWYSINYNR−−−−LVEL−−EIDNDCDKLS−−−−−−−−−−−QRKEHIVMME−−−−−−−−−−−−NDNMS−−−−−−QPI−−−−PET−−−−−−−−−−TQ−−−KINTENT−−TQKDIV−−−−−−−−−−−−−−−−−−−−E−−−−IINYLNSVCNTSYRI−−−−−−−−−STKKTQM−−−−−−−−−−−−LIKSRLQEGF−−−−−−−−NINEFKEVIETKAKEWL−−−−−YTEQAKYLRPETLFG−−−−−−TKFEGYLQQRKMVKSN−−−−GFNKGNRYSTKSFEENELPF
fig|1286404.3.peg.5095   Bacillus thuringiensis serovar thuringiensis str. IS5056     MSKLIINEEPLLVLPSLA−−−−−−KSIG−−LNEAVFLQQIHYWLNRSNH−−FY−−−−DERRWIYNSAVEWSKQFPFWSEKTIR−−−−−RILKNLEETKILLT−−−−−−−−GNYN−−−−KMKFDKTKWYTIDYDK−−−−LRSL−−ETVNDVDNLT−−−−−−−−−−−RRSGKSDHVL−−−−−−−−−−−−PDNLT−−−−−−RPI−−−−PEN−−−−−−−−−−TQ−−−RLSTEIT−−−−EYIV−−−−−−−−−−−−−−−−−−−−E−−−−IVNYLNTTCNKSYRT−−−−−−−−−STKKTQT−−−−−−−−−−−−LIKARLAEGY−−−−−−−−KVEQFKKVIDIKKSHWF−−−−−GDAKWDEYLRPETLFG−−−−−−TKFESYLNSKPKTKQHSEMSAEERLEHFQKEAEEQDDLPF
fig|527019.3.peg.1079   Bacillus thuringiensis IBL 200     MSKLIINEEPLLVLPSLA−−−−−−KSIG−−LNEAVFLQQIHYWLNRSNH−−FY−−−−DERRWIYNSAVDWSKQFPFWSEKTIR−−−−−RILKNLEETKILLT−−−−−−−−GNYN−−−−KMKFDKTKWYTIDYDK−−−−LRSL−−ETVNDVDNLT−−−−−−−−−−−RRSGKSDHVL−−−−−−−−−−−−PDKLT−−−−−−RPI−−−−PEN−−−−−−−−−−TQ−−−RLSTEIT−−−−EYIV−−−−−−−−−−−−−−−−−−−−E−−−−IVNYLNTTCNKSYRT−−−−−−−−−STKKTQT−−−−−−−−−−−−LIKARLAEGY−−−−−−−−TVEQFKKVIDIKKSHWF−−−−−GDAKWDEYLRPETLFG−−−−−−TKFESYLNSKPKTKQHSEMSAEERLEHFQKEAEEQDDLPF
fig|653938.3.peg.685   Listeria monocytogenes 08-5578              DYPLQVLPTLA−−−−−−REIG−−LNEAIVLQQIHYWLNKKQ−−−−NL−−−HDGRYWTYRSIQKWQEENFSFWSLNTVK−−−−−RTFTSLREKKLLLT−−−−−−−−ANYN−−−−KKKFDKTVWYSIDYDA−−−−LEAM−−S−−−−−−−−−−−−−−−−−−−−QRLAQNEPTIS−−−LKR−−−−−ANALA−−−−−−QNE−−−−PDN−−−−−−−−−−TLDLPETPKENK−−−−−−−−−−−−−KNTVEELDDTSIFKN−−−−VIDFLNENAETNYRH−−−−−−−−−TTQVTQT−−−−−−−−−−−−LIRARLKDGF−−−−−−−−TFEDFKKVIIIKCKDWK−−−−−NDSAMSRYLRPGTLFG−−−−−−IKFEGYLNQKTVSGNQ                        
fig|396513.4.peg.480   Staphylococcus carnosus subsp. carnosus TM300     MSKLLIDDYPIQVLPKLA−−−−−−EKVG−−LNEAIILQQIHYWLNSSKH−−NY−−−−DGKRWIYNSYPNWAKQFPFWSERTIK−−−−−RAFGSLEKQDLLYV−−−−−−−−GNYN−−−−RAGFDRTKWYSINYEN−−−−LNNL−−VA−−−−−−−−−−−−−−−−−−−RPSGQNGTTSM−−−TNC−−−−−HDARG−−−−−−QNV−−−−TTN−−−−−−−−−−TRDYTEITTETT−−NNNILS−−−−−−−−−−PSSTAYPYRD−−−−VINYLNQQTDKHYKS−−−−−−−−−TTKKNQT−−−−−−−−−−−−VIRARTDEGF−−−−−−−−TLDDFIKVIDNKVSEW−−−−−−KDTDMEKYLRPETLFG−−−−−−TKFEGYLNQ                               
fig|279808.3.peg.2062   Staphylococcus haemolyticus JCSC1435     MNNLLIDDYPILVLPKLA−−−−−−TEIG−−LNEAIVLQQIHYWLKNSSH−−YH−−−−DNRKWIYNSYPEWQKQFPFWSERTIK−−−−−RTFSSLEKQDLLHV−−−−−−−−GNYN−−−−KAGFDRTKWYSVKYET−−−−LNQL−−VA−−−−−−−−−−−−−−−−−−−RPSGQNGPTIM−−−TKW−−−−−PDAIG−−−−−−QND−−−−PTN−−−−−−−−−−TRDYTEITTETT−−NNNILSG−−−−−−−−NPTSPSIPYKE−−−−IIDYLNEKAGKQFKH−−−−−−−−−NTGKSKR−−−−−−−−−−−−CIEARWNEDF−−−−−−−−RLDDFKKVIDIKTSEW−−−−−−LGTSQEKYLRPETLFG−−−−−−TKFEGYLNQQP                             
fig|314262.5.peg.692   Roseobacter sp. MED193                      PEIA−−−−−−GRVG−−LNAAVIFQNITFWIEKNQANRRNL−−−RDGRYWTYNSISAFGDLFPYLSEKQIR−−−−−TALEKLVSAELIIK−−−−−−−−GNFS−−−−DDRYDRTCWYALGNSI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−CPNGQIDPTERENDA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FAPEGKPSAPEGKSYKNRYKPYQKPDPSHAKAA−−−−−−−−−−−−VEEEASEKILSAYPE−−−−−DRIRGKAVCLS−−−−−−−−−−−−QIRQALADGV−−−−−−−−DAKDLEGAVRAYASES−−−−−−−−−−−EGFTRSKVCFSDNWFTSGRWLKYL                                 
fig|314262.3.peg.1091   Roseobacter sp. MED193                      PEIA−−−−−−GRVG−−LNAAVIFQNITFWIEKNQANRRNL−−−RDGRYWTYNSISAFGDLFPYLSEKQIR−−−−−TALEKLVSAELIIK−−−−−−−−GNFS−−−−DDRYDRTCWYALGNSI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−CPNGQIDPTERENDA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FAPEGKPSAPEGKSYKNRYKPYQKPDPSHAKAA−−−−−−−−−−−−VEEEASEKILSAYPE−−−−−DRIRGKAVCLS−−−−−−−−−−−−QIRQALADGV−−−−−−−−DAKDLEGAVRAYASES−−−−−−−−−−−EGFTRSKVCFSDNWFTSGRWLKYL                                 
fig|712961.3.peg.695   Lactobacillus salivarius CECT 5713                     EPNRAFNTEVAAALG−−IYQAILIQQIRYWQEKST−−−−HE−−−IDGRKWIYNTYQDWSKQLTFISERTIR−−−−−RELKKLAELKIVRV−−−−−−−−AKYN−−−−ISKFNHTKWYSLDEEK−−−−LQEY−−LDNKTPE−−−−−−−−−−−−−−CRNGQIGQVEC−−−PRE−−−−−DNGNGKSGQFRTGQ−−−−−−−−−−−−−−−−−VDHFKDNKVPKNTSLNNQQKI−−−−−−−−−−−−−−−−−−KE−−−−ILECFKEVTGQVFDK−−−−−−−−−−DKWGIK−−−−−−−−−−−−LIKERLAAGN−−−−−−−−DVEQCKSMIVLKAKQW−−−−−−KGTHVEKFIRPRTLFG−−−−−−DNFSKYYAECYAYHRENNYFVDNKEEN             
fig|525364.3.peg.925   Lactobacillus salivarius ATCC 11741                     EPNRAFNTEVAAALG−−IYQAILIQQIRYWQEKST−−−−HE−−−IDGRKWIYNTYQDWSKQLTFISERTIR−−−−−RELKKLAELKIVRV−−−−−−−−AKYN−−−−ISKFNHTKWYSLDGEK−−−−LQEY−−LDNKTPE−−−−−−−−−−−−−−CRNGQIGQVEC−−−PKE−−−−−DNGNGKSDQFRNGQ−−−−−−−−−−−−−−−−−VDHFKDNKVPKNTSLNNQQKI−−−−−−−−−−−−−−−−−−KE−−−−ILECFKEVTGQVFDK−−−−−−−−−−DKWGIK−−−−−−−−−−−−LIKERLAAGN−−−−−−−−DVEQCKSMIVLKAKQW−−−−−−KGTHVEKFVRPRTLFG−−−−−−DNFSKYYAECYAYHRENNYFVDDKEEN             
fig|331111.3.peg.4659   Escherichia coli E24377A     MSRLLINENPLQVLPTLA−−−−−−CTIG−−LNEAIVLQQIHYWLNSSQN−−FF−−−−ENRHWVYNSVTDWQEQFPFWSESTIK−−−−−RVLANLEKLNVVFT−−−−−−−−GNFN−−−−SDAWDKTKWYSINYAQ−−−−LCKI−−EETTF−−PVA−−−−−−−−−−−NRLGQVDPIEE−−−VNV−−−−−TQASG−−−−−−QVDPCARVKM−−−−−−−−−−TQSLTENTTESTTEIKDPPYP−−−−QKGEGEEIILADAQK−−−−ALNYYNEKVGTRCRD−−−−−−−−−VKPFVML−−−−−−−−−−−−LTATTTRAGY−−−−−−−−SVAEIQLVIRWVIATW−−−−−−−RR                                                           
fig|103690.1.peg.5877   Nostoc sp. PCC 7120       SKLITPESPLLVPPLLA−−−−−−VEIG−−LTEAMILQQIHYFCQISK−−−HIK−−−RDGRRWFWKTLKDWGETLPFLKPSAIR−−−−−RAIANLRDNFKLIDV−−−−−−−−CRHS−−−−EKTWYQANWFTVNVEN−−−−VQAL−−W−−−−−−−−−−−−−−−−−−−−NRICQNQQIDVSNLDISICSHTADHNK−−−−−−−−−−−−−−−−−−−−−−−−−−DFPLKDFTSQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QHSAVEFEK−−−−−−−−−SEEVKPE−−−−−−−−−−−−ILECKQEV                                                                                                
fig|240292.3.peg.5369   Anabaena variabilis ATCC 29413       SKLITPESPLLVPPLLA−−−−−−AEIG−−LTEAMILQQIHYFCQISK−−−HIK−−−RDGRRWFWKTLKDWGETLPFLKPSAIR−−−−−RAIANLRDNFKLIDV−−−−−−−−CRHS−−−−EKTWYQANWFTVNVEN−−−−VQAL−−W−−−−−−−−−−−−−−−−−−−−NRICQNQQIDVSKLLTSICSQPADHNK−−−−−−−−−−−−−−−−−−−−−−−−−−DFPLKDFTSQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QHSAVELEK−−−−−−−−−SEYEEAE−−−−−−−−−−−−NLECEQEEAGQ                                                                                            
fig|349966.5.peg.4332   Yersinia frederiksenii ATCC 33641      AKLLINEPPLQVLPSLA−−−−−−KEIG−−LNEAILVQQIHYWLCRSDH−−RH−−−−EGRKWFYKSAAEWADELGFWSDSTIK−−−−−RTLANLLEMKLISV−−−−−−−−GQLHKVLLSDPYNRTKWYSINYDQ−−−−LELL−−NST−−−−−−−−−−−−−−−−−−NASGQNDQL−−−−−−−−−−−−−−−GAG−−−−−−QNDKITSSQN−−−−−−−−−−DQMLQENTTKNTTKNKTPLTP−−−−QGETENTLADAER−−−−ALAYYNELTHTRCED−−−−−−−−−SSPFETL−−−−−−−−−−−−LTATKSRKAY−−−−−−−−ALADLKLVALWVVNTW−−−−−−−KPRNGKYAKPANICRV−−−−−NRFDGYLADARAWSESAG                      
fig|349966.3.peg.4169   Yersinia frederiksenii ATCC 33641      AKLLINEPPLQVLPSLA−−−−−−KEIG−−LNEAILVQQIHYWLCRSDH−−RH−−−−EGRKWFYKSAAEWADELGFWSDSTIK−−−−−RTLANLLEMKLISV−−−−−−−−GQLHKVLLSDPYNRTKWYSINYDQ−−−−LELL−−NST−−−−−−−−−−−−−−−−−−NASGQNDQL−−−−−−−−−−−−−−−GAG−−−−−−QNDKITSSQN−−−−−−−−−−DQMLQENTTKNTTKNKTPLTP−−−−QGETENTLADAER−−−−ALAYYNELTHTRCED−−−−−−−−−SSPFETL−−−−−−−−−−−−LTATKSRKAY−−−−−−−−ALADLKLVALWVVNTW−−−−−−−KPRNGKYAKPANICRV−−−−−NRFDGYLADARAWSESAG                      
fig|349747.9.peg.2651   Yersinia pseudotuberculosis IP 31758      TKLLINEPPLQVLPSLA−−−−−−KKIG−−LNEAILIQQIHYWLSRSNH−−QH−−−−DARKWFYKSAAEWADELGFWSDSTIR−−−−−RTLANLLEMRLISV−−−−−−−−RQLHKVLLNEPYNRTKWYSINYDQ−−−−LEQL−−NSA−−−−−−−−−−−−−−−−−−NASGQNDKL−−−−−−−−−−−−−−−GTG−−−−−−QNDQIPCGQN−−−−−−−−−−DQMFQENTTENTTEINTPLTP−−−−KGKDDVSILTNAKK−−−−ALEYYNELTHTRCED−−−−−−−−−PRPFETL−−−−−−−−−−−−LTPTKSRNAY−−−−−−−−TLEDLQLVTYWVINTW−−−−−−−KSRNGRYAKPANICRV−−−−−TRFDGYLADARAW                           
fig|349747.3.peg.298   Yersinia pseudotuberculosis IP 31758      TKLLINEPPLQVLPSLA−−−−−−KKIG−−LNEAILIQQIHYWLSRSNH−−QH−−−−DARKWFYKSAAEWADELGFWSDSTIR−−−−−RTLANLLEMRLISV−−−−−−−−RQLHKVLLNEPYNRTKWYSINYDQ−−−−LEQL−−NSA−−−−−−−−−−−−−−−−−−NASGQNDKL−−−−−−−−−−−−−−−GTG−−−−−−QNDQIPCGQN−−−−−−−−−−DQMFQENTTENTTEINTPLTP−−−−KGKDDVSILTNAKK−−−−ALEYYNELTHTRCED−−−−−−−−−PRPFETL−−−−−−−−−−−−LTPTKSRNAY−−−−−−−−TLEDLQLVTYWVINTW−−−−−−−KSRNGRYAKPANICRV−−−−−TRFDGYLADARAW                           
fig|500633.7.peg.1194   Clostridium hiranonis DSM 13275          LFNDPPVVFDPKLA−−−−−−IEIG−−LNEAIVLQQIHYWLVSNERSGNNY−−−YNGRYWTFNSIKKWRDDFFPWWSEPTVK−−−−−RTFKSLEDKGILIS−−−−−−−−GNFN−−−−KKGYDKTKWYTIDYQA−−−−LYRN−−RCN−−−−−−−−−−−−−−−−−−NSLGQNDPIDKVKMTQSIRSNWTNGVG−−−−−−QND−−−−PTN−−−−−−−−−−TIDNTEITKEIT−−−−−−−−−−−−−−−P−−PPGVEVSHQK−−−−EVDLLKGFLGKSYSE−−−−−−−−−−−EYAIR−−−−−−−−−−−−IINLLKDKGK−−−−−−−−DISYLREKIILTESKNL−−−−−KSKEGYLYKAIESDFKETSQTGTKSNGFQNFESTVSKYTKEELEEK                
fig|500633.7.peg.1863   Clostridium hiranonis DSM 13275     MREFLMDEHPMIVERSLA−−−−−−RIIG−−VNEAIVIQQIHYWLVKNKENNINF−−−KEGRYWTFNSMQKWHDDVFDFWSESTLR−−−−−RIFTPLEKKGLLIV−−−−−−−−GNFN−−−−KMGFDRTKWYSIDYDK−−−−LNEI−−−−−−−−−−−−−−−−−−−−−−−−−−−ADEQMKNINLTKCSCSDVKDEFNQV−−−−−−−−−−−−−−−−−−−−−−−−EQSNTNNYTNNTKC−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ITQPLPNGIGVC−−−−−−−−−−−−KVKKEDE−−−−−−−−−−−−MLKEFLENEY−−−−−−−−TEE                                                                                 
fig|638301.3.peg.1751   Granulicatella adiacens ATCC 49175     MSSLLINEPPLQVLPSLA−−−−−−KEVG−−LNESIMLQQMHYWLLKSTH−−EF−−−−NQEYWFYKTLDEWQLEFPFWSTMTIR−−−−−RILGNLEKNKLVKV−−−−−−−−GNFN−−−−KKKFDKTKWYTINYER−−−−VN−−−−−−−−−−−−−−−−−−−−−−−−−RRCVQNEQTYC−−−SDC−−−−−TDGTV−−−−−−QNE−−−−QTY−−−−−−−−−−TRDYQESTTENN−−−−−−−−−−−−−−−VSEEKPPKVVWTDETNHIIDYLNKRTGKKYSV−−−−−−−−−KTKKTAQ−−−−−−−−−−−−LVHKLLDNGF−−−−−−−−TVEDFERVIDIKCKQWL−−−−−NNEKMNQYLRPRTLFS−−−−−−EKFEDYLNEAPARPKQQGASGQS                 
fig|491915.4.peg.2085   Anoxybacillus flavithermus WK1     K−−−WLVDDDPLFVLPTVA−−−−−−VKLG−−LNESIFLQQLHYWLEKSTH−−TY−−−−DGYTWVYNTYEGWKKQFPFWSESTIR−−−−−RTIVRLEKKGIVVS−−−−−−−−RY−−−−−−RSKLDKTKWYRIDYHV−−−−LANV−−MNG−−−−−−−−−−−−−−−−−−EEERQNDETNAQHEQTTMQHDVSHAST−−−−−CQDA−−−−RRN−−−−−−−−−−MNRQTNITTDHTLQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NIIYFYEQNG                                                                                                                                         
fig|10228.3.peg.10888   Trichoplax adhaerens     KLE−−−−−−−−−−−−−−−−−−−−−−−−KVFG−−TRKANFINKLKYWLSKCGRN−−IN−−−GISGKWIYNPTHEWANQLNCST−−STIK−−−−−RLIKSLEEQGIILS−−−−−−−−KKVN−−−−AKRYNQTKWYSLNFNL−−−−LNNM−−LTSQDIKDNTVKNKWT−−−−−NRLVQNEPIIIS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NNRNNYTNTSSKKFKNNYSDS−−−−−−−−−−−−−−−−−−KEEEINFSNVLKERTAQKTKL−−−−−−−−−TTNET                                                                                                                      
fig|525309.3.peg.185   Lactobacillus antri DSM 16041     MSKLLIDERPLQCQPSLA−−−−−−MLLGSADEAIVFQQIHYWLKRTN−−−−−−NVQEDGHNWVYNSMTDWLKQFPWIKTRARLT−−−−−RYFDDLEKRGLIIT−−−−−−−−GNFN−−−−KAKFDKTKWYRIDYDA−−−−LQKF−−E−−−−−−−−−−−−−−−−−−−−QRLYQNDTTSA−−−SKQ−−−−−DNGVS−−−−−−−−−−−−−−−−−−−−−−−−−−QNDATSASKQSNPMSQNGAT−−−−−−−−−−−−−−−−−−−−−−−−−YTNRLPETTTRDYQE−−−−−−−−−NTAESTS−−−−−−−−−−−−−−−EDATDGQ−−−−−−−−QVED                                                                                
fig|525364.3.peg.361   Lactobacillus salivarius ATCC 11741     MSKLITNEEPVMVISPKLA−−−−−−VLLGDADKAIILQQIDYWLDHSNN−−IR−−−−DGHKWVYNSVADWKRHFPWISTSTIT−−−−−RKLKSLEDQGLLIT−−−−−−−−GNYN−−−−KRKFDKTKWYRIDYDE−−−−FKKI−−E−−−−−−−−−−−−−−−−−−−−KAFSQNDQTIM−−−SFW−−−−−VNGVS−−−−−−QND−−−−KTN−−−−−−−−−−TRDYTENNTDTY−−−−−−−−−−−−−−−−−−−NSNEFDYNE−−−−FIEWFNKLADKDLKN−−−−−−−−−−TEINRQ−−−−−−−−−−−−YIKDLLNDGY−−−−−−−−TKDDIVNVIEYKVNEWK−−−−−NSEKMNMYLRFSTLLSP−−−−−NNFERYLQDAKEFLPSEPQEKRKRKVPLKEKE        
fig|644651.3.peg.1737   Erwinia pyrifoliae DSM 12163     S−−−LLFNFRPLVVSPQLA−−−−−−ERIG−−LNEAIVLQQINYWLNDVEARYEH−−−−AGRRWVYNTYEEWQKQFPFWSIPTIK−−−−−RTLVSLEKLGVVIA−−−−−−−−EKLQ−−−−KSQCNHTKYYTVNYQS−−−−EYLI−−DRIKLTQSSSSDCSVPDGIKLTPSIEPDCAFL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TKST−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YIDYSNTTTDIKDLP−−−−−−−−−SPKKTVS                                                                                                                    
fig|584.1.peg.1445   Proteus mirabilis HI4320     MKSLIIKSRPQIVIPELA−−−−−−VKIG−−LHEALVLQQLHYWITETKSGIEH−−−−DGRRWIYNTLSNWQLQFPYLSVSTLK−−−−−RAFAQLRISGLIEV−−−−−−−−KQLN−−−−KHLHDRTNFYSINYQH−−−−KILQ−−IEEDEKRSLTEGNY−−−−−−−ANKTTIKPFDEPKSKQW−−−−−−TGVTNLSQSSSNR−−−−ALL−−−−−−−−−−TESTTKITTESNNKRSRSVCS−−−−−−FSSPERPEIE−−−−−−−−IIRYFNKVTHSHYRE−−−−−−−−−−CQTTLG−−−−−−−−−−−−YIRARLADGF−−−−−−−−HFEELILIIDYLTAKWL−−−−−NDNKMQDYLRPKTLFHK−−−−−NNCTEYLDKAKKWHLKGRPAYRN                 
fig|520999.6.peg.682   Providencia alcalifaciens DSM 30120     MSCLLLLKTRPQIVIPELA−−−−−−VRLG−−LSEALLLQQVQYWLSETASGIEY−−−−KGRRWIYNTIEEWREQFPYLSESTIK−−−−−RAFTNLKKLGVLSI−−−−−−−−DQIN−−−−KHNHDRTNYYSINYEH−−−−TLLS−−DEVKLTSSSRSPKA−−−−−−−IRTGQNDLIDK−−−RKM−−−KRSERVKMTSSNGSNW−−−−SDL−−−−−−−−−−TESTTENTTEITTESNSSCQA−−−−−−HAEPDDAK−−−−−−−−MVLDHFNKVTNSSYQG−−−−−−−−−−KKTTMG−−−−−−−−−−−−YIKARLAEGY−−−−−−−−TVDELNQVSDYLTAKWL−−−−−NDPEYAHNLRPLTVFGE−−−−−EKFESYCQCSKKWHQQ                        
fig|399742.10.peg.2766   Enterobacter sp. 638     S−−−LLMPSRPIVINPDLA−−−−−−YSIG−−LNEAIALQQINYWLKETTSGLER−−−−DGVRWIYNTNEQWLEQFPFWSESTLK−−−−−RTFTRLKNLGVLKI−−−−−−−−EQLN−−−−KSQRDMTNYYTINYES−−−−ELL−−−DEVKVTKSKGSNCT−−−−−−−LPSGQNDLMEK−−−VKV−−−NRSNGSKRTAVIRSKW−−−−PDV−−−−−−−−−−−−−LTENTTESTTENKTPICP−−−−−−VASQPDPEVLITDNAILVLTHLNQVSGSRYQK−−−−−−−−−−SKTSLE−−−−−−−−−−−−NIRGRLRDGY−−−−−−−−SVDDLKLVIDLKHEHWS−−−−−GNDDQYQYMRPETLFGP−−−−−KKFESYLQSASRWDSKGRPK                    
fig|696869.3.peg.3020   Salmonella enterica subsp. enterica serovar Enteritidis str. 436     MSSLIQLLDRPIAYNPAFAKLKAGKVKAG−−PVAAVFLSQLVYWHNRMD−−−−−−−−−−−−GGWMYKTQADIASE−−−−−−−−TALT−−−−−RDEQETARKRLVAL−−−−−−−−GVLEEA−−RRGVPATMHYRINTAR−−−−LEALLLETAKPVKKGAQEKTRLRDFQNVETPQSGLVQP−−−RKPDCGDAANKNVETPQTSTGQ−−−−PNEQACGDPTIFPTGDYTETTQEITQESKTPFCP−−−−−−VAEQPDPEVTLTDQAIEVLTHLNQVSGSRYQK−−−−−−−−−−SKTSLE−−−−−−−−−−−−NIRARLREGY−−−−−−−−SVADLQLVIDLKHEHWH−−−−−ENDEQYQYMRPETLFGP−−−−−KKFESYLQSATRWDQKGRPKRADWGAKKR           
fig|439851.8.peg.2297   Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853     MSSLIQLLDRPIAYNPAFAKLKAGKVKAG−−PVAAVFLSQLVYWHNRMD−−−−−−−−−−−−GGWMYKTQADIASE−−−−−−−−TALT−−−−−RDEQETARKRLVAL−−−−−−−−GVLEEA−−RRGVPATMHYRINTER−−−−LEALLLETAKLVKKGAQEKTRLRDFQNVETPQSGLVQP−−−RKPDCGNAANKNVETPQTSTGQ−−−−PNEQACGDPTIFPTGDYTETTQEITQESKTPFCP−−−−−−VAEQPDPEVTLTDQAIEVLTHLNQVSGSRYQK−−−−−−−−−−SKTSLE−−−−−−−−−−−−NIRARLREGY−−−−−−−−SVADLQLVIDLKHEHWH−−−−−ENDEQYQYMRPETLFGP−−−−−KKFESYLQSATRWDQKGRPKRADWGAKKR           
fig|637910.3.peg.2533   Citrobacter rodentium ICC168     FS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NDEGVSWPSIETIARQIGAGS−−STVR−−−−−TAIAKLEAEGWLTR−−−−−−−−TARR−−−−QGNRNASNVYRLNVRK−−−−LQAAAFSHLPDSDPSKSDASKSDPSKIEAS−−−−−−−−−−KSDKNGGFHPSESG−−−−−−−−−−−−−−−−−−−−−−−−−−GDPSVKSTTDPSDKKTSCPVA−−−−−−−−SQPAPAVEITDQAKQVLTFLNQKTGSRYQV−−−−−−−−−−GKTSLE−−−−−−−−−−−−NIRARLGEGF−−−−−−−−TIYELTLVVEYMTEKWG−−−−−QDFKMSEYLRPTTLFHP−−−−−TKFPGYLQAANKWHKAGRPERKNG                
fig|592316.3.peg.2357   Pantoea sp. At-9b     FS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SDEGLCWPSIATIARQIGAGP−−STVR−−−−−TSLRKLESEGWLTT−−−−−−−−TPRR−−−−KGNRNNSNMYQLNVKK−−−−LREAAALHLSESDASESDTSKSDASKSGASVSDASKSGAPESDKNTGFHPPESG−−−−−−−−−−−−−−−−−−−−−−−−−−DDPSVNSTTDPSDKNTSCQVA−−−−−−−−SQPDRDVVITDLAKQVLTHLNQITGSKFQV−−−−−−−−−−SRSSLE−−−−−−−−−−−−NIRARLAEGY−−−−−−−−EPDELKLVVDYKNEHW−−−−−−RNTEQEQYLRPATLFIP−−−−−KNFAGYLQSATKWDKS                        
fig|526976.3.peg.1106   Bacillus cereus BDRD-ST196     E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DCIQ−−−−−KELKTIKDLSLVKLVLDRTKNEALVNKISIFAGFDDTSTIRGQKEK−−−−EK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EKEKENNTTSSS−−−−−−−−−−−−−−−GESEQPVAIPYKE−−−−ILDYLNEKAKKKYNH−−−−−−−−−KSEGHRK−−−−−−−−−−−−FIRARWNEDY−−−−−−−−TVDDFKTVIDNKVPQWLGKFDKDGKPLEQYLRPSTLFAQ−−−−−KHFDNYLNETVKGENSNASSKKHKNNEF            
fig|387344.15.peg.1094   Lactobacillus brevis ATCC 367     TK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MTVQ−−−−−NWLKSLERENYI−−−−−−−−−−−−−−−−−−−−−−SREVTYKKDTKE−−−−IE−−−−−−−−−−−−−−−−−−−−−−−−−HRLIRIEMTPT−−−−−−−−−−−−−−−−−−−−−KKNL−−−−GTP−−−−−−−−−−TQKNFRDNTTSINKNHS−−−−−−−−−−GAEPKEDSIHYKK−−−−IINFLNEKAGRDFKD−−−−−−−−−−VEGNRK−−−−−−−−−−−−LIRARIHDGY−−−−−−−−SEHDFALVIDFKCKQWL−−−−−NDDKMEKYLRPGTLFGSS−−−−KKFDQYLDEAKQNRKQQANTTEPQG               
fig|675817.3.peg.3624   Photobacterium damselae subsp. damselae CIP 102761     LS−−−−−−−−−−−−−−IPRLF−−−−−VRMCSGSYNHAAVLAQLVFWSNKSS−−−−−−−−−−RTDGWFYKSQVELGGELELSR−−DQVK−−−−−RSVKYLTTNFGNAIH−−−−−−−−TKLK−−−−KANGVPTTHYFIDIKE−−−−LLSL−−ASKEIKEDPKPSGEVV−−−−−KLSGQDSPMPGMGEP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TQSITDPNHIRSTDLKDSLSS−−−KHDKASTKSTNLEIAKT−−−−VIAFLNEATGSKFQC−−−−−−−−−−CKSNLN−−−−−−−−−−−−YINGRISDGY−−−−−−−−TLEDLCQVIAHKKIEWG−−−−−SDAKMSQYLRPCTLFQP−−−−−GKFAGYLQSAKVANLHPG                      
fig|675817.3.peg.1012   Photobacterium damselae subsp. damselae CIP 102761                                      LNQAAVLSQLVFW−−−−−−SGCAS−−−SKNDGWFYKRHEQLAEELCLSV−−DQIR−−−−−YTLKKLKTRLGESLG−−−−−−−−TTRK−−−−KAEGVPTIFYRFDEEK−−−−LMDL−−IFPE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DNSDSVNLPNGNGEITESIRGS−−−−HRNLGFGNL−−−−PESIYRLNTDPIKQINNPIVPCEEH−−−−−−−−−−−−−−−−−−−−QLDILNDQNLEPVEP−−−−−−−−−PTKKTRAKRKPKTTLPEDFCLTEAMQAWY−−−−−−−−SVQGFSLNIQAATNQW                                                                    
fig|347495.3.peg.5396   Bacillus cereus F837/76               QENIVVVPKLF−−−−−−VKLTGDLTTAILLNQIVFYSDKSK−−−−−−−−−−RKDGFFYKTYKEWEEEICLTE−−RQVR−−−−−YSTKKLVASGYVET−−−−−−−−−ALK−−−−KANGAPTVHYKLDFDK−−−−LLDSILTNCQNGN−−−−−−−−−−−−−−LHIVGMEPDKM−−−−−−−−−−−−−−−−−−−−−SESL−−−−−−−−−−−−−−−−−TEITTETTTKITTLKDNMSSD−−−−−−QKERSKDYIPYED−−−−IVSYLNEQAGKSFKH−−−−−−−−−KTAKTRS−−−−−−−−−−−−LIKARFKDGF−−−−−−−−TIDDFKQVIDIKTAQWL−−−−−TDQNMNQYLRPETLFG−−−−−−TKFEGYLNEKGAKKHVGNSNAKGSKIPGFKGELPF     
fig|412694.7.peg.26   Bacillus thuringiensis str. Al Hakam               QENIVVVPKLF−−−−−−VKLTGDLTTAILLNQIVFYSDKSK−−−−−−−−−−RKDGFFYKTYKEWEEEICLTE−−RQVR−−−−−YSTKKLVASGYVET−−−−−−−−−ALK−−−−KANGAPTVHYKLDFDK−−−−LLDSILTNCQNGN−−−−−−−−−−−−−−LHIVGMEPDKM−−−−−−−−−−−−−−−−−−−−−SESL−−−−−−−−−−−−−−−−−TEITTETTTKITTLKDNMSSD−−−−−−QKERSKDYIPYED−−−−IVSYLNEQAGKSFKH−−−−−−−−−KTAKTRS−−−−−−−−−−−−LIKARFKDGF−−−−−−−−TIDDFKQVIDIKTAQWL−−−−−TDQNMNQYLRPETLFG−−−−−−TKFEGYLNEKGAKKHVGNSNAKGSKIPGFKGELPF     
fig|527000.3.peg.931   Bacillus pseudomycoides DSM 12442                                      LIAGILLGQIVYWYMPNEQGKSKLRVKKNGEFWLAKGREDWRNEIRITP−−KQYD−−−−−RAIKILIDKGFVEV−−−−−−−−KKF−−−−−KFNGAPTNHIKLNTSE−−−−VTER−−VKWILTFGEIPN−−−−−−−−−SPLSEMELIET−−−−−−−−−−−−−−−−−−−−−VNSL−−−−−−−−−−−−−−−−−TEITTETTTKSTTLEDNMSSD−−−−−−QKERSKDCIPYED−−−−IVSYLNEKAGKSYKY−−−−−−−−−KTAKTKD−−−−−−−−−−−−LIKARFNQGF−−−−−−−−TIEDFKKVIDIKASHWL−−−−−TDEEYNQYLRPSTLFG−−−−−−TKFEEYLNQQPKKGASSNASSGKDSSFISKYDFTKG    
fig|525375.3.peg.1914   Staphylococcus epidermidis M23864:W2(grey)     ISSIITQFSGQNNIIPIPAIY−−−−−−LKITEDYPTAALLNQLIYWSDRTH−−−−−−−−−−RKDGYFYKSYKEWEDEIYLSK−−YQVM−−−−−RSIKKLKSMGIVET−−−−−−−−−ALK−−−−KANGAPTVHYKVDSKV−−−−TSQWIVKFLNNGK−−−−−−−−−−−−−−STYLTMDSKET−−−−−−−−−−−−−−−−−−−−−QKSL−−−−−−−−−−−−−−−−−TEITTEITTEIT−−NNNILSP−−−−−−−−−−SSTAYPYKD−−−−VIDYLNQQTGKNYKS−−−−−−−−−TTKKNQT−−−−−−−−−−−−VIRSRTDEGF−−−−−−−−SLDDFKRVIDNKVAEW−−−−−−KGTNMEKYLRPETLFG−−−−−−TKFEGYLNQ                               
fig|458233.11.peg.306   Macrococcus caseolyticus JCSC5402                                         AVFLSQLTFWADKGK−−−−−−−−−−NREGWIYKTQEQWFNETGIKK−−FKIA−−−−−QITKELESRGIIET−−−−−−−−−KVM−−−−KVNGNPIKHYRLLYDNYLKEVEEVLENKQMNIDILKTEKRKTENRKTISENQNKEVVKTKKGNS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KIGISSITEDTLTEITNTEKT−−−−−−−−−TELSSNRFIDTIGLVAISYINKLTNRSFRV−−−−−−−−−NDQSYIK−−−−−−−−−−−−LISDLINEDY−−−−−−−−NIIDLIEVVEKKYYEWR−−−−−NDRKFNKLIRPETLFKY−−−−−EYFKKYVVEDIHNNIEVTPK                    
fig|452948.4.peg.1103   Staphylococcus aureus 930918-3                                         AVFLSQLTFWADKGK−−−−−−−−−−NREGWIYKTQEQWFNETGIKK−−FKIA−−−−−QITKELESRGIIET−−−−−−−−−KVM−−−−KVNGNPIKHYRLLYDNYLKEVEEVLENKQMNIDILKTEKRKTENRKTISENQNKEVVKTKKGNS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KIGISSITEDTLTEITNTEKT−−−−−−−−−TELSSNRFIDTIGLVAISYINKLTNRSFRV−−−−−−−−−NDQSYIK−−−−−−−−−−−−LISDLINEDY−−−−−−−−NIIDLIEVVEKKYYEWR−−−−−NDRKFNKLIRPETLFKY−−−−−EYFKKYVVEDIHNNIEVTPK                    
fig|1053238.3.peg.4771   Bacillus cereus VD154                                      LETGLFLSQLVYWSDRTT−−−−−−−−−−REDGYFYKTDSEWHEEIRISK−−YGVR−−−−−KARKKLGEMSVLKT−−−−−−−−−YVK−−−−KANGVPTVHYKLDKNR−−−−FFEIIISFLRNRKKESSKSKDGNCEN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ELSLTDITADTTTNIDDDVD−−−−−−−−−−−−−−−−−−−−−−−−−KHPLIDEKFQKSYQY−−−−−−−−−LLQNNIP−−−−−−−−−−−−LSETALQDLGEFCDVLGSEMVLEAVDRAIDQNAKRWKY                                                                  
fig|527027.3.peg.3746   Bacillus thuringiensis serovar pakistani str. T13001                                      LETGLFLSQLVYWSDRTT−−−−−−−−−−REDGYFYKTDSEWHEEIRISK−−YGVR−−−−−KARKKLGEMSVLKT−−−−−−−−−YVK−−−−KANGVPTVHYKLDKNR−−−−FFEIIISFLRNRKKESSKSKDGNCEN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ELSLTDITADTTTNIDDDVD−−−−−−−−−−−−−−−−−−−−−−−−−KHPLIDEKFQKSYQY−−−−−−−−−LLQNNIP−−−−−−−−−−−−LSETALQDLGEFCDVLGSEMVLEAVDRAIDQNAKRWKY                                                                  
fig|88888881.3.peg.2157   Vibrio cholerae NRT36s                     LDRPIAFHRIFVELGLGITGALFLSQSLYWSRRTN−−−−−−−−−−−ESGWFYKTQEEWEEETGLSR−−REQD−−−−−SARKRLKSLGIIEE−−−−−−−−−−−−−−−KKQGVPCRVFYKVNGEK−−−−LLVL−−LSKRSDQKSENPVCSKQTIQFGGKRQTSLNES−−−ANLVCTNPPSSDGGISQTKTEN−−−−−−−−−−−−−−−−−THRLPETTTKTLSVIEQCFEHFWKIFPT−−−−−−−−−−−KKAKKQAFDKFKAIVKRRSES−−−−−−−−−PEEFTTMLCA−−−−−−−−−DVHARLQNGQF−−−−−−−−GFDKLHATTYLNQERWN−−−−−DDHEIN−−−RPVT                                                 
fig|404974.3.peg.1108   Vibrio cholerae AM-19226                                    IGVTGALLLSQSLYWSKRTN−−−−−−−−−−NTEGWFYKSTDDWKDETGMTR−−TEIE−−−−−TARKKLRNLGVLEE−−−−−−−−−−−−−−−KKVGVPCRLHYRINSAN−−−−LIAR−−L−−−−−−−−−−−−−−−−−−−−−−−QQTSLQDS−−−CKQGCGNPASRAAETLQTITEN−−−−−−−−−−−−−−−−−THRLPETTTKTLSVIEQCFEHFWKIFPT−−−−−−−−−−−KKAKKQAFDKFKAIVKRRSES−−−−−−−−−PEEFTTMLCA−−−−−−−−−DVHARLQNGQF−−−−−−−−GFDKLHATTYLNQERWN−−−−−DDHEIN−−−RPVT                                                 
fig|536229.4.peg.3059   Bacillus pumilus ATCC 7061                                                                        YISICNWEKHQNLDALEKIREQNRLRKQKQRKKQSLP−−−−−−−−−−−−−−−−−−QPKNDMSRDVTINVTP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SHATDIDKELDKDKELKDILSG−−NPTDNPKTQESEIPFKL−−−−IVDLLNKVTGKSFRH−−−−−−−−−SSAATQR−−−−−−−−−−−−LIKARWNDGF−−−−−−−−RFEDFKTVILTKTNQWL−−−−−KDDKMNKYLQPTTLFG−−−−−−TKFEGYLNEGAGVIKRAEHQISGSGTLKRKNDLPF     
fig|703612.3.peg.1128   Bacillus subtilis subsp. spizizenii ATCC 6633                                                                  EVDENKFISIANWEKHQNVEGMDRVRKLNAERNRKYRERKKLLQLTAP−−−−−−−−−−−−−EKNNDVSVTSH−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DGTDIDKELDKEKELKDILSGKPDGASTSKKANDEIPYKL−−−−IIDLLNKKAGTRYRH−−−−−−−−−TTDKTRK−−−−−−−−−−−−LIKKLWKDGF−−−−−−−−RFEDFKHVILVKTEEWL−−−−−NDPAMNKFLRPETLFG−−−−−−TKFESYLNQKGGLSRGGNHKGAGNRSQGRNISEDDIPY  
fig|585155.3.peg.2445   Staphylococcus aureus subsp. aureus H19                                                      EQH−−ST−−−−D−−−−−−−−−−−−−−−−−−−−GLSGLK−−−−−SGIKELEEIGYIQR−−−−−−−−SRKR−−−−DKSGRLNGYEYLVYEQ−−−−PHHI−−−−−−−−−−−−−−−−−−−−−−−−RFSNVGKTVN−−−GKT−−−−−NNGKT−−−−−−VNG−−−−KSH−−−−−−−−−−TTNNNSTNNE−−−−−GSILSG−−−−−−−−NPTVSSIPYKE−−−−IIEYLNKKAGKHFKH−−−−−−−−−NTAKTKD−−−−−−−−−−−−FIKARWNQDF−−−−−−−−RLEDFKKVIDIKTAEWL−−−−−NTDSDKYLRPETLFG−−−−−−SKFEGYLNQK                              
fig|762051.3.peg.1867   Leuconostoc kimchii IMSNU11154     ELEQLQIN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ESGQYEHRNLVTYTERP−−−−−−−RDVD−−−−−ETLTQV−−−−−−−−−−−−−−−−−−−−−−−−−RLGKDRLGKVRIDKDS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KDILSG−−−−−−−−SDEPDHVPYKE−−−−IVDYLNKKTGNKYRN−−−−−−−−−SGSKTKS−−−−−−−−−−−−LIKTRFNEGF−−−−−−−−SLDDFKAVIDVKSSQWL−−−−−NDQKMNKFLRPETLFS−−−−−−NKFESYLNENNVKPNNTDMRNMTQEE              
fig|596326.3.peg.2589   Lactobacillus jensenii 208-1     GR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DALR−−−−−AGLKELEEKGYLKR−−−−−−−−−−YRKRNDKGQVVDSEWILSDVPM−−−−−−−−−−−−−−−−−−−−FDKPMLNEPMLEKPTQVNQTLQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NKYLTKKDNTKERYIYSPAEP−−−−DNSTKKIDKSKQVKA−−−−IVQFLNEKTGSHYRA−−−−−−−−−SSAKTKK−−−−−−−−−−−−LIHARLKEGF−−−−−−−−TVDDFERVIVKKCKDWK−−−−−NDSKMSKYLRPETLFG−−−−−−TKFEGYLNE                               
fig|575607.3.peg.1529   Lactobacillus jensenii SJ-7A-US     GR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DALR−−−−−AGLKELEEKGYLKR−−−−−−−−−−YRKRNDKGQVVDSEWILSDVPM−−−−−−−−−−−−−−−−−−−−FDKPMLNEPMLEKPTQVNRTLQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NKYLTKKDNTKERYIYSPAEP−−−−DNSTKKIDKSKQVKA−−−−IVQFLNEKTGSHYRA−−−−−−−−−SSAKTKK−−−−−−−−−−−−LIHARLKEGF−−−−−−−−TVDDFEKVIVKKCKDWK−−−−−NDSKMAKYLRPETLFG−−−−−−TKFEGYLNEIDHALYANNHVVESWSNWEAN          
fig|575597.3.peg.1181   Lactobacillus crispatus MV-3A-US                                                                       FFMSNKKIAERLDVSA−−RTVN−−−−−EYLGILESKKLIERTKIISQENGAIVGRQIRAGVDLVKRASLGWGN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TLHGGSETHFTPLVKPT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SHKYNSNNRTTNRTVEDTYSS−−−−−−−−ADAEPPIPYKE−−−−IIDYLNKKTNQHLRY−−−−−−−−−QTKAYQK−−−−−−−−−−−−LIRQRFEEGA−−−−−−−−TLEDFKKAIDNQAYAW−−−−−−QGTKFWKYMRPSTLFRA−−−−−SKFDSYVNANDLNQAKQPSNGGYGGEPNISDIPDDDLPF 
fig|883092.3.peg.1726   Lactobacillus crispatus FB077-07                                                                       FFMSNKKIAERLDVSA−−RTVN−−−−−EYLGILESKKLIERTKIISQENGAIVGRQIRAGVDLVKRASLGWGN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TLHGGSETHFTPLVKPT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SHKYNSNNRTTNRTVEDTYSS−−−−−−−−ADAEPPIPYKE−−−−IIDYLNKKTNQHLRY−−−−−−−−−QTKAYQK−−−−−−−−−−−−LIRQRFEEGA−−−−−−−−TLEDFKKAIDNQAYAW−−−−−−QGTKFWKYMRPSTLFRA−−−−−SKFDSYVNANDLNQAKQPSNGGYGGEPNISDIPDDDLPF 
fig|575596.3.peg.2087   Lactobacillus crispatus MV-1A-US                                                                                          RTVN−−−−−RYLDLLEKKKLIKRENIKSNENGAIIGRTIRAGNDLMTYMSIGWRH−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DSHGGTDTDVTIPMTPR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−STKYNSNNRTSNRTVEDTYSS−−−−−−−−AGAEQPIPYKE−−−−IIDYLNSKTRKHLDY−−−−−−−−−RTKSYQR−−−−−−−−−−−−LIRGRWNDNVRKDKTPEQKLADFKKVIDNKAFDWQ−−−−−GDAKMWNYMKPSTLFAP−−−−−SHFDEYLNQ                               
fig|411468.9.peg.1015   Clostridium scindens ATCC 35704     WSK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KKVR−−−−−GFLELLVSVNMIEK−−−−−−−−−−−−−−−−IGNRQGTVINVVNYGK−−−−YQDLGTENEPKGDHEGTERR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PRRVHNQERKNDKNDKNSIDN−−MPSGTSAERNPEYPYKE−−−−IVDYLNQKAGTSYRS−−−−−−−−−TSKDTRK−−−−−−−−−−−−HIQARVNDGY−−−−−−−−TIEDFKAVIDKKVQEWGAEPKPGEKDMRPYIRPSTLFG−−−−−−TKFENYLQAPSAKQTRRANNGFN                 
fig|451755.5.peg.489   Clostridium perfringens E str. JGS1987                                                           SQI−−−IDGERYIWVNQTNLILEHIPIIGHRTSLL−−−−−RRLSNLEEKGIIVR−−−−−−−−KLSHE−−−KLNKKDNQFKKGNFCF−−−−IKLT−−SKLDYLM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EYDLVAKCNNPCSKMRQTLVAKCNNKDSIIKDNNNIY−−SQ−−−−VIDYLNSKAGKSFKY−−−−−−−−−TTKKTQD−−−−−−−−−−−−LIKARLADGF−−−−−−−−KKEEFFRVIDNKVKEW−−−−−−QGTEYEKYLRPETLFG−−−−−−NKFEGYLNQGVNKKSYEERKENSSKDSFD           
fig|451754.5.peg.2652   Clostridium perfringens B str. ATCC 3626                                                             I−−−IDGERYIWVNQSNLILDQIPIIGHRTSLL−−−−−RRLSNLEEKGIIIR−−−−−−−−KLSHE−−−KLNKKDKQFKKGNFCF−−−−IKLT−−SKLDYLM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EYDLVAKCNNPCSKIQQPLVAKCDNKDSPIKDSNNIY−−SQ−−−−VIDYLNSKAGKSFKY−−−−−−−−−TTKKTQD−−−−−−−−−−−−LIKARLADGF−−−−−−−−KKEEFFKVIDNKVKEW−−−−−−QGTEYEKYLRPETLFG−−−−−−NKFEGYLNQGVNKKSYEERKENSSKDSFD           
fig|195103.9.peg.1545   Clostridium perfringens ATCC 13124                                                             I−−−IDGERFIWIDQGYLLEQIPIIGTQRSLK−−−−−RRLKKFDDLKIIER−−−−−−−−KVLF−−−−CKDGIRGKFSYIN−−−−−−−−−VT−−SKLDNLT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EYIPWDKMSQGLGQSVPRVRTIYPNKDSSIRDINNIIYSR−−−−VIEYLNSKTGKSYKA−−−−−−−−−TTRKTQS−−−−−−−−−−−−LIKARLDEGF−−−−−−−−NEEEFFKVIDNKVSEW−−−−−−KGTEYEKYLRPETLFG−−−−−−NKFEGYLNQ                               
fig|445334.5.peg.1329   Clostridium perfringens C str. JGS1495                                                                                                    ILKELEKQGYIKL−−−−−−−−ISKG−−−−KPPKTPSKYRMIYAES−−−−LKNTEPLKEPIKEPLKEPFEGIE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NKGIKQCCEPLREPLKEPLKE−−−PPSKDISKDKSNIYVE−−−−IIDYLNKKANTRYRA−−−−−−−−−NTKDTRL−−−−−−−−−−−−LIKKRLDDGF−−−−−−−−LLEDFMMVIDNKVLDW−−−−−−KDTEYEKYIRPKTLFS−−−−−−EKFERYLNEKVITKPKEEPIERGYAN              
fig|526218.4.peg.4259   Sebaldella termitidis ATCC 33386                                                                 HAEDKYYWISYSKILQDLPFIFRSESTVK−−−−−RSLNRLIEKKIIKK−−−−−−−−−YLG−−−−SKNGARATYFAIGENY−−−−IALL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KADTRIKDEIPA−−−−−−AKEEKKRPAKFEKEHIEIIDHLNTVTKSAFKS−−−−−−−−−DTVASKQ−−−−−−−−−−−−LMNKLLESGF−−−−−−−−TVEDIKLVIEFKAKEW−−−−−−EGTDREQYLRPKTLFKM−−−−−DYFPGYLKMARK                            
fig|416269.5.peg.480   Actinobacillus pleuropneumoniae L20                                                                                   FTGAGKTQVI−−−−−EACKKLVDLGLLVK−−−−−−−−−−−−−−−−TIGKRNVSVYAANLFT−−−−−−−−−−−−−−−−NRTGSETEQVQKVNITGSETEQVTGS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ETEHTKNNIKNTIQNNTPLNP−−−−−PVGETQGDSVA−−−−−−−−VLDYLNDRLAELGKAIEQPLPKFKPVPNTLK−−−−−−−−−−−−IIKARLAES−−−−−−−−−−SRAECETVVDYLVAKWG−−−−−RDGKMREYLSPKTIFRA−−−−−SNFADYLPKSTAW                           
fig|637911.3.peg.813   Actinobacillus minor NM305                                           LINQASSWAKAVV−−−−−−−−−IDGVTYYWMSFGKVCEELPAVFSKEDTVY−−−−−RQYKVLKEKGIIEH−−−−−−−−FKMD−−−−GKDYVRLTEKGCEWNK−−−−FEPI−−RGSEKNPSIGNQSEQTRKKIRESSEKNPTDN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NNNNKYNQDNNTPLNP−−−−−PVGETHTDSVA−−−−−−−−VLDHLNQRLADLSQVLGMALPKFRAKGNALK−−−−−−−−−−−−LVTARLKDS−−−−−−−−−−SLAECLQVIDYLVAKWG−−−−−RDDAFREYLAPKTIFRA−−−−−SNFEDYLPKSTAW                           
fig|272629.3.peg.6   Mannheimia haemolytica PHL213                                                                       YWMSFSKVCEELPAVFSKEDTVY−−−−−RQYKVLKEKGIIDH−−−−−−−−FKMD−−−−GKDYVRLTEKGCEWNK−−−−FEPI−−RESEKNPSIGNNSEQTRKNFRESSEKNPTDN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NTNYKNNNDHTTPLNP−−−−−PAGEPAPAEV−−−−−−−−−VLNYLNSALVTLAVQLGERKPVGYSLKPWAK−−−−−−−−−−−−NITARIRES−−−−−−−−−−SVADCCQVVDYLVAKWG−−−−−RDEKMREYLCPKTIFRQ−−−−−SNFADYFPKSTAWANN                        
fig|669261.3.peg.2452   Mannheimia haemolytica serotype A2 str. OVINE                                                                       YWMSFSKVCEELPAVFSKEDTVY−−−−−RQYKVLKEKGIIDH−−−−−−−−FKMD−−−−GKDYVRLTEKGCEWNK−−−−FEPI−−RESEKNPSVGNQSDQARKNFRESSEKNPTDN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NTNYKNNNDHTTPLNP−−−−−PTGEPAPAEV−−−−−−−−−VLNYLNSALATLAAQLGERKPVGYSLKPWVK−−−−−−−−−−−−NIAARIRES−−−−−−−−−−SVADCCQVVDYLVAKWG−−−−−RDEKMREYLCPKTIFRQ−−−−−SNFADYLPKSKAW