(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00009953

fig|585543.3.peg.2950   Bacteroides sp. D20     INACGLQCPGPIMQVKKAMDSIAVGE−−−−RVEIVATDAGFARDASAWCDTTGNKLIEKH−−−−DEKGRYTVVIE−−−−−KGAPACTSA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SNV−−SAARGRGK−−−−−−−−−−−−−−−−−−−−−TLILFSDDLDKALAT−−FVLANGAAATGQKVTIFFTFWGLNVLKKVQKPSVQKDFFGKMFGMMLP−−SSSLKLKLSQMNMFGMGSRMMRFLMKRKGVDSLESLRSQALAQGVE−−−FIACQM−−−−−−−−−SMDMMGIQHEELLDEVTIGGVATYMERADK           
fig|411479.10.peg.3746   Bacteroides uniformis ATCC 8492     INACGLQCPGPIMQVKKAMDSIAVGE−−−−RVEIVATDAGFARDASAWCDTTGNKLIEKH−−−−DEKGRYTVVIE−−−−−KGAPACTSA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SNV−−SAAGGRGK−−−−−−−−−−−−−−−−−−−−−TLILFSDDLDKALAT−−FVLANGAAATGQKVTIFFTFWGLNVLKKVQKPSVQKDFFGKMFGMMLP−−SSSLKLKLSQMNMFGMGSRMMRFLMKRKGVDSLESLRSQALAQGVE−−−FIACQM−−−−−−−−−SMDMMGIQHEELLDEVTIGGVATYMERADK           
fig|537012.5.peg.483   Bacteroides cellulosilyticus DSM 14838     INACGLQCPGPIMQVKKAMDTLEPGE−−−−QVEIVATDAGFARDASAWCDTTGNRLVGSH−−−−EDKGRYTVVIE−−−−−KSNSNMVCP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SSTGTVAAGRGK−−−−−−−−−−−−−−−−−−−−−TLILFSDDLDKALAT−−FVLANGAAATGQKVTVFFTFWGLNVLKKVQKPKVKKDIFGRMFGMMLP−−SSSLKLKLSQMNMFGMGSRMMRFLMKRKGVDSLESLRSQALAQGVE−−−FIACQM−−−−−−−−−SMDMMGICREELLDEVTIGGVATYMERADK           
fig|449673.7.peg.833   Bacteroides stercoris ATCC 43183     VNACGLQCPGPIMQVKKAMDSIAPGE−−−−RVEIVATDAGFARDASAWCATTGNKLIEKK−−−−EEKGRYTVLLE−−−−−KGDEACACP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SSL−−PAAGGRGK−−−−−−−−−−−−−−−−−−−−−TLILFSDDLDKALAT−−FVLANGAAATGQKVSIFFTFWGLNVLKKIQKPRTEKDIFGKMFGMMLP−−SSSLRLKLSKMNMMGLGSRMMRFLMKRKGIDSLESLRSQALAQGVE−−−FIACQM−−−−−−−−−SMDMMGIRREELLDEVTIGGVATYMERADK           
fig|431947.6.peg.281   Porphyromonas gingivalis ATCC 33277     VDACGMSCPGPILKLKQSIDQIAVGE−−−−QLCILATDPGFARDAQAWCDTTGHNLIRQE−−−−TIKGQYKVTIE−−−−−KTACKEEGT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−CV−−−SETPSKGK−−−−−−−−−−−−−−−−−−−−−TFILFSDDLDKALAT−−FVLANGAAAMGQPVTIFFTFWGLNAIKKPHAVKAKKDIWGKMFGMMLP−−KNSKGLGLSKMNMFGLGAKMMRMVMKEKHVDSLESMRKQALENGVE−−−FIACQM−−−−−−−−−SMDVMGINREELLDEVSIGGVATYMNRAE            
fig|242619.8.peg.162   Porphyromonas gingivalis W83     VDACGMSCPGPILKLKQSIDQIAVGE−−−−QLCILATDPGFARDAQAWCDTTGHNLIRQE−−−−TIKGKYKVTIE−−−−−KTACKEEGT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−CV−−−NETPSKGK−−−−−−−−−−−−−−−−−−−−−TFILFSDDLDKALAT−−FVLANGAAAMGQPVTIFFTFWGLNAIKKPHAVKAKKDIWGKMFGMMLP−−KNSKGLGLSKMNMFGLGAKMMRMVMKEKHVDSLESMRKQALENGVE−−−FIACQM−−−−−−−−−SMDVMGINREELLDEVSIGGVATYMNRAE            
fig|242619.1.peg.154   Porphyromonas gingivalis W83     VDACGMSCPGPILKLKQSIDQIAVGE−−−−QLCILATDPGFARDAQAWCDTTGHNLIRQE−−−−TIKGKYKVTIE−−−−−KTACKEEGT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−CV−−−NETPSKGK−−−−−−−−−−−−−−−−−−−−−TFILFSDDLDKALAT−−FVLANGAAAMGQPVTIFFTFWGLNAIKKPHAVKAKKDIWGKMFGMMLP−−KNSKGLGLSKMNMFGLGAKMMRMVMKEKHVDSLESMRKQALENGVE−−−FIACQM−−−−−−−−−SMDVMGINREELLDEVSIGGVATYMNRAE            
fig|483215.6.peg.3354   Bacteroides finegoldii DSM 17565     VDACGLQCPGPILKMKKTMDGLASGE−−−−RVEITATDPGFPRDAAAWCSSTGNQLISKE−−−−ASGGKSVVIIE−−−−−KGEPKACNI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−−TSCEDKGK−−−−−−−−−−−−−−−−−−−−−TFIMFSDDLDKALAT−−FVLANGAAATGQKVTIFFTFWGLNVIKKLHKPETEKDIFGKMFGMMLP−−SSSKKLKLSKMSMGGIGGKMMRYIMNKKGIDSLESLRQQALENGVE−−−FIACQM−−−−−−−−−SMDVMGVKQEELLDEVTIGGVATYMERADN           
fig|411901.7.peg.329   Bacteroides caccae ATCC 43185     VDACGLQCPGPILKMKKTMDMLASGE−−−−RVEITATDPGFPRDAAAWCNSTGNQLVSKE−−−−SSGGKSVIVIE−−−−−KGEPKSCNI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−−TSCDSKGK−−−−−−−−−−−−−−−−−−−−−TFIMFSDDLDKALAT−−FVLANGAAATGQKVTIFFTFWGLNVIKKLHKPKTEKDIFGKMFGMMLP−−SSSGKLKLSKMSMGGIGGKMMRYIMNKKGIDSLESLRQQALENGVE−−−FIACQM−−−−−−−−−SMDVMGVKQEELLDEVTVGGVATYMERADN           
fig|470145.6.peg.3609   Bacteroides coprocola DSM 17136     VDACGIQCPGPIMKLKKSMETLNPGE−−−−RLEIHATDAGFPRDAKAWCKSTGNHFLEKS−−−−SANGTYRVLIE−−−−−KASSCEKAI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−K−−−−EITTEEGK−−−−−−−−−−−−−−−−−−−−−TFILFSDDLDKTLAT−−FVLANGAAATGKKVTIFFTFWGLNAIKKVHKPQVKKDIFGKMFGMMLP−−SNSLKLKLSKMNMGGIGTRMMRYIMQRKGIDSLESLRQQAIDNGVE−−−FIACQM−−−−−−−−−SMDVMGVKKE                               
fig|484018.6.peg.2636   Bacteroides plebeius DSM 17135     VDACGIQCPGPILRLKKGMEELKAGE−−−−QMEIHATDAGFPRDAESWCRTTGNRFLSSK−−−−SEGGIYKVVVE−−−−−KATPCAIEA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SR−−−QDVGEKGK−−−−−−−−−−−−−−−−−−−−−TFILFSDDLDKTLAT−−FVLANGAAATGKKVTIFFTFWGLNAIKKERKPSVQKDIFGKMFGMMLP−−SSSRKLKLSKMNMGGIGTKMMRYIMNRKGIDSLESLRQQAIDNGVE−−−FIACQM−−−−−−−−−SMDVMGVKKEELLDNVTIGGVATYMDRAE            
fig|537006.5.peg.2366   Parabacteroides johnsonii DSM 18315     VDACGLMCPGPVMQLKKNYETLKTGE−−−−QLQITATDQAFGKDVASWCKVTGAELVALE−−−−NKNGVVAATIR−−−−−KQEKTAPHA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−S−−−−VQNNADNK−−−−−−−−−−−−−−−−−−−−−TLIVFSDDLDKALAS−−FVIANGAASTGKKVTMFFTFWGLNVIKKQQKPAVSKDIFGKMFGWMLP−−AHSGKLKLSKMNMGGAGSWMMRLIMKQKRIDSLESLIQQAVDNGVE−−−MIACTM−−−−−−−−−SMDVMGVQKEELMDNVTLGGVASYLERAE            
fig|999421.3.peg.3328   Parabacteroides merdae CL09T00C40     VDACGLMCPGPVMQLKKNYEALKIGE−−−−QLQITATDQAFGKDVTSWCKMTGAELVALE−−−−NKNGVVAATIR−−−−−KQEKTASCE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−I−−−−SRNNADNK−−−−−−−−−−−−−−−−−−−−−TLIVFSDDLDKALAS−−FVIANGAASTGKKVTMFFTFWGLNVIKKQHKPTVTKDIFGKMFGWMLP−−THSGKLKLSKMNMGGAGSWMMRLIMKRKRIDSLESLIQQAIDNGVE−−−MIACTM−−−−−−−−−SMDVMGVQKEELMDNVTLGGVASYLERAE            
fig|525376.3.peg.2061   Staphylococcus epidermidis W23144         NLQCPGPIVNISKEMKNIAIGD−−−−QIEVVVTDHGFLNDIKSWVKQTGHTLVRLN−−−−DSGNEIRAIIQ−−−−−KEENKNIEV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−THTKNGT−−−−−−−−−−−−−−−−−−−−−TIVLFSGELDKAVAA−−MIIANGAKAAGRDVTIFCTFWGLNALKKNQSQRIKKKGIAKLFDFMLP−−NSPIKMPISKMNMFGVGNLMMRYVMKKKNVDDLPSLINQAVEQGVK−−−LIACTM−−−−−−−−−SMDVMGITKEELR                            
fig|1155132.3.peg.1839   Staphylococcus epidermidis NIH04003         NLQCPGPIVNISKEMKNIAIGD−−−−QIEVVVTDHGFLNDIKSWVKQTGHTLVRLN−−−−DSGNEIRAIIQ−−−−−KEENKNIEV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−THTKNGT−−−−−−−−−−−−−−−−−−−−−TIVLFNGELDKAVAA−−MIIANGAKAAGRDVTIFCTFWGLNALKKTQSQRIKKKGIAKLFDFMLP−−NSPIKMPISKMNMFGVGNLMMRYVMKKKNVDDLPSLINQAVEQGVK−−−LIACTM−−−−−−−−−SMDVMGITKEELR                            
fig|176280.10.peg.121   Staphylococcus epidermidis ATCC 12228         NLQCPGPIVNISKEIKNIAIGD−−−−QIEVVVTDHGFLNDIKSWVKQTGHTLVRLN−−−−DSGNEIRAIIQ−−−−−KEENKNIEV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−THTKNGT−−−−−−−−−−−−−−−−−−−−−TIVLFSGELDKAVAA−−MIIANGAKAAGRDVTIFCTFWGLNALKKIQSQRIKKKGIAKLFDFMLP−−NSPIKMPISKMNMFGVGNLMMRYVMKKKNVDDLPSLINQAVEQGVK−−−LIACTM−−−−−−−−−SMDVMGISKEELR                            
fig|176280.1.peg.130   Staphylococcus epidermidis ATCC 12228         NLQCPGPIVNISKEIKNIAIGD−−−−QIEVVVTDHGFLNDIKSWVKQTGHTLVRLN−−−−DSGNEIRAIIQ−−−−−KEENKNIEV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−THTKNGT−−−−−−−−−−−−−−−−−−−−−TIVLFSGELDKAVAA−−MIIANGAKAAGRDVTIFCTFWGLNALKKIQSQRIKKKGIAKLFDFMLP−−NSPIKMPISKMNMFGVGNLMMRYVMKKKNVDDLPSLINQAVEQGVK−−−LIACTM−−−−−−−−−SMDVMGISKEELR                            
fig|176279.3.peg.2211   Staphylococcus epidermidis RP62A         NLQCPGPIVNISKEIKNIAIGD−−−−QIEVVVTDHGFLNDIKSWVKQTGHTLVRLN−−−−DSGNEIRAIIQ−−−−−KEENKNIEV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−THTKNGT−−−−−−−−−−−−−−−−−−−−−TIVLFSGELDKAVAA−−MIIANGAKAAGRDVTIFCTFWGLNALKKIQSQRIKKKGIAKLFDFMLP−−NSPIKMPISKMNMFGVGNLMMRYVMKKKNVDDLPSLINQAVEQGVK−−−LIACTM−−−−−−−−−SMDVMGISKEELR                            
fig|360911.3.peg.2028   Exiguobacterium sp. AT1b     LDTCGLQCPGPILEVNKKVAELGEGE−−−−TLRVLASDPGFFADIEAWAKKTGNKLVSKQ−−−−FVNGRVEAILQ−−−−−KGQGPAVPQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−A−−−−GAPAGDGA−−−−−−−−−−−−−−−−−−−−−SMVVFSGDLDRALAS−−LIIAQGAAAMGKDVTMFFTFWGLNVIRKPDAPEVKKQGLEKMFGMMMP−−GHAGELPLSNMNFGGVGQKMMKKVMSDKNVPSVEEMIKSAQEAGVK−−−MVACTM−−−−−−−−−SMDVMGIKEE                               
fig|663278.3.peg.2220   Ethanoligenens harbinense YUAN-3     VDACGLSCPGPILEVNKALKEACDGE−−−−VLAVKATDPAFFSDIQGFCKRTGNLLIDSH−−−−FDGRQFCATLQ−−−−−KHSAAPACE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−A−−−−PADSGNDK−−−−−−−−−−−−−−−−−−−−−SIIVFSGDLDKAIAA−−FIIANGAAAMGRKVHMFFTFWGLNILRKPEKTSVRKDFISSMFGRMMP−−RGSRRLGLSKLNMGGMGPKLIRSVMQNKNISSLEDLMKEAIKNGVE−−−ITACTM−−−−−−−−−SMDVMGIKQE                               
fig|575609.3.peg.1464   Peptoniphilus sp. oral taxon 386 str. F0131     LDVCGLSCPGPIVKVSKKMEDMNIGE−−−−ILSVKATDPGFIRDIDSWCKNTGNTLISRN−−−−EYKGNYFASIQ−−−−−KGEKVETCS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VNTCKEK−−−−−−−−−−−−−−−−−−−−−TMIVFDGDLDKAIAA−−FIIATGSAAMGNKVNMFFTFWGLNILRKDEKVDVQKDIIGKMFSMMMP−−RGAKKLGLSKMNFLGIGSKMMRGVMAKKGISSLEELIIEAKKAGVK−−−MTACQM−−−−−−−−−SMDVMGITKEELIDGVEIGGVATML                
fig|592010.4.peg.1653   Abiotrophia defectiva ATCC 49176     LDVSGLCCPGPIVEVSKRLEKLNVGD−−−−TLKVTATDPGFYSDISCWTDNTGNELVEKK−−−−SEGGKFFATIR−−−−−KSGGVVTTE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SCACSEQGKKKEK−−−−−−−−−−−−−−−−−−−−−TMIVFDGDLDKAIAS−−FIIANGAAAMGNKVNMFFTFWGLNVLRKNEKVSVKKDFISKMFGLMMP−−RGSKKLKLSKMNMMGMGSKMIRMVMKKQNVYSLEELINQAKSAGVK−−−MIACQM−−−−−−−−−SMDVMGIKEEELIDGVEVGGVATML                
fig|324057.4.peg.4857   Paenibacillus sp. JDR-2     LDACGLCCPGPLIQVKQRMDGLQAEE−−−−VLKVTATDPGFYEDIKAWAGMTSNKVEKLT−−−KQQDGTIEAFLR−−−−−KGKPALAAN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PIHPVAQGGDKS−−−−−−−−−−−−−−−−−−−−−TMIVFSGDLDKAIAS−−FIIANGAASSGKKVTMFFTFWGLNVIRRPEKVPVTKNIIGRMFGMMMP−−RGSRKLSLSKMNMMGMGAKMIRGVMSSNNVSSLEELIETAIAQGVE−−−VVACQM−−−−−−−−−SMDLMGIKQE                               
fig|313627.6.peg.1230   Bacillus sp. NRRL B-14911     LDAKGLACPMPIVKTKKMITGMNAGE−−−−VLEVLATDKGSKADLKAWAESAGHQYLGTV−−−−EEEGVLKHYLR−−−−−KASGEEVQE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KKH−−−−−−−−−−−−−−−−−−−−−PHVVSNEDLEKLVGEDGDII−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VLDVRESA−−−−−−EFAFHHIPGAVSIP−−−−−−−−−−−LGELEERAGELDVEAPVYVVCRTGSRSDLAARMLDAKGF                                   
fig|608538.3.peg.111   Hydrogenobacter thermophilus TK-6     LDLSGLMCPLPVVMTSEQMKRLKDGE−−−−VLTVISTDPGFELDIKNWCAQTGNELLSVK−−−−RNGNQVVVEIK−−−−−KKPFSVEPS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LWYWIKFH−−−−−−−−−−−−−−−−−ALGVKLHL−−−−−−−−−−−−−−−−−−−−−−−−RHILMQLN−−PLI−−KKPDHFITFTAIS−−−−−−−−−−EGTRAEKFLKGKAKLIPVPDEIDPRCGV−−−−−−−−−VLAVAGYQKAK−−−−−−−−−−−−−−−GIYEELLKKGF     
fig|431947.6.peg.1783   Porphyromonas gingivalis ATCC 33277     VDTRGKLCPLPLILLKKAVDGTPVGE−−−−EISVMTDNETAKCNLRDYIGELGAVAIESE−−−−−EGDYTTLTFR−−−−−VSTHIEEAA−−−−−−−−−−−−−−−−−−−PTSC−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PAEHPHTVAQGD−−−−−−−−−−−−−−−−−−−−−YLIVAKSN−−−−−−−−−−RMGTGNDELGSILM−−−−−−−−−−−−−−−−−−−−−−−−−RAFVNAIG−−ELD−−RLPSHIILYNTGVLLAV−−−−−EGTDTAETLAELNKKYGIP−−−IIVCGT−−−−−−−−−CADYYEVKDK−−−−−LRIGTISNMYRIMQLQVATRHIIYP 
fig|1125722.3.peg.794   Porphyromonas gingivalis W50     VDTRGKLCPLPLILLKKAVDGTPVGE−−−−EISVMTDNETAKCNLRDYIGELGAVAIESE−−−−−EGDYTTLTFR−−−−−VSTHIEEAA−−−−−−−−−−−−−−−−−−−PTSC−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PAEHPHTVAQGD−−−−−−−−−−−−−−−−−−−−−YLIVAKSN−−−−−−−−−−RMSTGNDELGSILM−−−−−−−−−−−−−−−−−−−−−−−−−RAFVNAIG−−ELD−−RLPSHIILYNTGVLLAV−−−−−EGTDTAETLAELNKKHGIP−−−IIVCGT−−−−−−−−−CADYYEVKDK−−−−−LRIGTISNMYRIMQLQVATRHIIYP 
fig|242619.1.peg.1614   Porphyromonas gingivalis W83     VDTRGKLCPLPLILLKKAVDGTPVGE−−−−EISVMTDNETAKCNLRDYIGELGAVAIESE−−−−−EGDYTTLTFR−−−−−VSTHIEEAA−−−−−−−−−−−−−−−−−−−PTSC−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PAEHPHTVAQGD−−−−−−−−−−−−−−−−−−−−−YLIVAKSN−−−−−−−−−−RMSTGNDELGSILM−−−−−−−−−−−−−−−−−−−−−−−−−RAFVNAIG−−ELD−−RLPSHIILYNTGVLLAV−−−−−EGTDTAETLAELNKKHGIP−−−IIVCGT−−−−−−−−−CADYYEVKDK−−−−−LRIGTISNMYRIMQLQVATRHIIYP 
fig|242619.8.peg.1744   Porphyromonas gingivalis W83     VDTRGKLCPLPLILLKKAVDGTPVGE−−−−EISVMTDNETAKCNLRDYIGELGAVAIESE−−−−−EGDYTTLTFR−−−−−VSTHIEEAA−−−−−−−−−−−−−−−−−−−PTSC−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PAEHPHTVAQGD−−−−−−−−−−−−−−−−−−−−−YLIVAKSN−−−−−−−−−−RMSTGNDELGSILM−−−−−−−−−−−−−−−−−−−−−−−−−RAFVNAIG−−ELD−−RLPSHIILYNTGVLLAV−−−−−EGTDTAETLAELNKKHGIP−−−IIVCGT−−−−−−−−−CADYYEVKDK−−−−−LRIGTISNMYRIMQLQVATRHIIYP 
fig|553175.3.peg.731   Porphyromonas endodontalis ATCC 35406              MPLILLKKALNSEGFSG−−−−EWQVLTDNATACQNLTDYIRQITSSLETEE−−−−−LQGYTSLRFT−−−−−LEEESC−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RPIGKKESGGED−−−−−−−−−−−−−−−−−−−−−YTVVLSSD−−−−−−−−−−TMGRGDDELGRILA−−−−−−−−−−−−−−−−−−−−−−−−−RAFVNALE−−GVE−−RKPNRIVCYNRGVLLAD−−−−−KDTDTGATLTRLHKEHGVE−−−VILCGT−−−−−−−−−CVDYFEFRDK−−−−−IAVGTISNMLVIAEYMRQASRLVTP 
fig|526224.5.peg.169   Brachyspira murdochii DSM 12563     IDARGVPCPKPLILTKTALNNAALNE−−−−EIEVLIDDDVAFHNITDFLKNNGITYTNEG−−−−−−−QNFKIVKN−−−−−KELSLNNS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KEKSSGP−−−−−−−−−−−−−−−−−−−−−VIAVVDKK−−−−−−−−−−VMGLGNDELGELLL−−−−−−−−−−−−−−−−−−−−−−−−−KAFLGALK−−DAN−−PKPEALYCYNGGVYLGI−−−−−EE−−PYKTLLQELRDAGIK−−−IFFCGT−−−−−−−−−CVKFYEL−−EG−−−−−IKVEEQTNMLGIIEAMANASAVIR  
fig|565034.3.peg.2413   Brachyspira hyodysenteriae WA1     VDARGIPCPKPLILTKTAITNAAINE−−−−EIEVLIDDEVAFHNITDFLKNNGITYTNEG−−−−−−−KNFKIIKN−−−−−KDLSSNDT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NKEKSSGP−−−−−−−−−−−−−−−−−−−−−VIAVVDKK−−−−−−−−−−VMGQGNDELGELLL−−−−−−−−−−−−−−−−−−−−−−−−−KAFLGALK−−DAN−−PKPEALYCYNGGVYLGV−−−−−EE−−PYKTLLQELRDAGIK−−−IFFCGT−−−−−−−−−CVKFYEL−−NE−−−−−IKVEEQTNMLGIIEAMANASAVIR  
fig|56780.15.peg.3004   Syntrophus aciditrophicus SB     IDARGLACPQPVILTKKALEHCD−−−−−−−−SLTVRVDNIAALENVKRMAKSQNCRVTVKQ−−−−AQDGTWTLELT−−−−−RESGAKEVE−−−−−−−−−−−−−−−−−−−EGSELQDIVCDVA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GKEESEPSLSGP−−−−−−−−−−−−−−−−−−−−−SVIVISSD−−−−−−−−−−CMGQGDDELGRLLM−−−−−−−−−−−−−−−−−−−−−−−−−RGFFHTLP−−QLD−−RRPDMIIFYNTGVKLTV−−−−−KGSEVLEDIGQLEQAGVE−−−ILVCGT−−−−−−−−−CLNFFNLTDQ−−−−−LSAGKISNMYDIADALTTAGRLARP 
fig|177439.1.peg.968   Desulfotalea psychrophila LSv54     IDACGLPCPGPVLLAKDAIEQPG−−ND−−−−QLTILLDNQASEENVSRFLQSQGFQVETGK−−−−−RGEIFEVRAT−−−−−RSGEFVASS−−−−−−−−−−−−−−−−−−−L−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TAPDKQEAGEQK−−−−−−−−−−−−−−−−−−−−−IVVMITSE−−−−−−−−−−YLGAGDKLLGEKLM−−−−−−−−−−−−−−−−−−−−−−−−−ISFIKTLK−−EMG−−PDLWQLIFVNGGVKLTL−−−−−ASSPVLRELQEYERAGTI−−−VLACGT−−−−−−−−−CLEHFGLMPE−−−−−KEVGSATNMLDIVSATQLADKVITI 
fig|177439.6.peg.1040   Desulfotalea psychrophila LSv54     IDACGLPCPGPVLLAKDAIEQPG−−ND−−−−QLTILLDNQASEENVSRFLQSQGFQVETGK−−−−−RGEIFEVRAT−−−−−RSGEFVASS−−−−−−−−−−−−−−−−−−−L−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TAPDKQEAGEQK−−−−−−−−−−−−−−−−−−−−−IVVMITSE−−−−−−−−−−YLGAGDKLLGEKLM−−−−−−−−−−−−−−−−−−−−−−−−−ISFIKTLK−−EMG−−PDLWQLIFVNGGVKLTL−−−−−ASSPVLRELQEYERAGTI−−−VLACGT−−−−−−−−−CLEHFGLMPE−−−−−KEVGSATNMLDIVSATQLADKVITI 
fig|96561.5.peg.2221   Desulfococcus oleovorans Hxd3     IDARNLACPGPVLAAKAFIEQND−−PN−−−−RITIVVDNEAARQNVERFLSSQGYDMQVEQ−−−−−SDDTWTITGI−−−−−RKSGAAFQE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EKIPVREHGSA−−−−−−−−−−−−−−−−−−−−−TLVLISSD−−−−−−−−−−RLGRGDDDLGEKLM−−−−−−−−−−−−−−−−−−−−−−−−−ASFIKTLE−−EMG−−TDLWRLVFVNSGVRLTI−−−−−DGSAVLPDLQKYEAAGTR−−−LLVCGT−−−−−−−−−CLTHFDLMDR−−−−−KQVGQTTNMLDIVTAMQLAEKVI   
fig|177437.4.peg.4756   Desulfobacterium autotrophicum HRM2     IDGQGLACPGPVLKTKEAVESQN−−PE−−−−QISVTVDNDAAAENVSRFLTHSGFEVSVDS−−−−−DGRTSVIEGT−−−−−RSGD−−YLP−−−−−−−−−−−−−−−−−−−AAKP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ESPAVDQTDHPK−−−−−−−−−−−−−−−−−−−−−IMVMIASQ−−−−−−−−−−TIGRGDDVLGEKLM−−−−−−−−−−−−−−−−−−−−−−−−−LSFLLTLR−−EMG−−EDLWRLVFVNSGVKFTI−−−−−EGSPVLEQIQALEAEGIH−−−ILVCGT−−−−−−−−−CLTHFDILDQ−−−−−KKVGETTNMLDIVTSMQLAHKVINL 
fig|439235.3.peg.1770   Desulfatibacillum alkenivorans AK-01     IDAKGLACPAPVLQTKKAVEDGR−−PE−−−−TIKVLVDNGAAKENVTRFLKSQGYESAVTE−−−−−SGGVFTISAS−−−−−STSEPPEP−−−−−−−−−−−−−−−−−−−GPEPD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YLACDIPGVHKK−−−−−−−−−−−−−−−−−−−−−IMVLAASD−−−−−−−−−−CMGRGDDVLGEKLM−−−−−−−−−−−−−−−−−−−−−−−−−MNYIATLK−−EMG−−PELWRLVLVNSGVKMAI−−−−−EGSQVLPHILDLEKAGVS−−−VLVCGT−−−−−−−−−CLDHFGILEQ−−−−−KQVGETTNMLDIVTSMQLADKVIKV 
fig|589865.4.peg.140   Desulfurivibrio alkaliphilus AHT2     LNCRGLACPAPVTQVRDLLVQGK−−PS−−−−TLAVLVDNEAARENVSRFLAYQGYQVMVEE−−−−−VDEGFKVIGT−−−−−GGDQACEVM−−−−−−−−−−−−−−−−−−−DE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KELAAAAGAGGK−−−−−−−−−−−−−−−−−−−−−ILVMITTD−−−−−−−−−−RLGHGDDQLGSGLM−−−−−−−−−−−−−−−−−−−−−−−−−LNFLKTLK−−EMG−−PELWRLVFINAGVKLTV−−−−−AGAETLAPLQELATGGVS−−−ILVCGT−−−−−−−−−CLNHFNLLDQ−−−−−KQVGETTNMLDIVTSLQLADKVINV 
fig|338966.9.peg.1865   Pelobacter propionicus DSM 2379     LDCRGLECPAPVLRVRQFIEEEN−−PA−−−−AIAVLVDNDAARQNVSRFLEHHSYRVSSEQ−−−−−QGGRFRVVGT−−−−−RTEGAAVPE−−−−−−−−−−−−−−−−−−−TMTPS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PVREKRESGAGK−−−−−−−−−−−−−−−−−−−−−IMVLITSE−−−−−−−−−−TMGHGDDALGDMLM−−−−−−−−−−−−−−−−−−−−−−−−−FNFLKTLK−−EMG−−PELWRVVFVNSGVKFTA−−−−−DGSEGVPVLRELVESGVG−−−IMACGA−−−−−−−−−CLAYFHILDK−−−−−IQVGEVTNMLEVVTAMKRADSVITV 
fig|335543.6.peg.3521   Syntrophobacter fumaroxidans MPOB     IRRSAGSRSGPVARRQGQEKRRQ−−−−−−−−PGVRQIDSVKHHKEEKMAEKNQG−−−−−−−−−−−−−−−−−−−EQK−−−−−KQASGAPG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AENKQDDNNSMK−−−−−−−−−−−−−−−−−−−−−TLVILATD−−−−−−−−−−CVGRGNDELGRGIV−−−−−−−−−−−−−−−−−−−−−−−−−ISFVKTMK−−EMK−−DELWRLVLLNGGVKLAA−−−−−EGSEALAPLQELARDGLG−−−ILVCGK−−−−−−−−−CLETFGLVEK−−−−−RRVGAAANMLDIVTAMQVAEKVISF 
fig|335543.9.peg.4035   Syntrophobacter fumaroxidans MPOB          MACPHPVLKAKEVVDRGD−−VA−−−−RFSVIVDNPAAKENVSRFLARAGYAVSVSE−−−−−QGETFEITGN−−−−−RDAT−−SSP−−−−−−−−−−−−−−−−−−−C−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ELPVDEAREETR−−−−−−−−−−−−−−−−−−−−−TAVLVATE−−−−−−−−−−FLGRGDDVLGGKLV−−−−−−−−−−−−−−−−−−−−−−−−−VNFIGTLK−−EMG−−QDLWRLIFLNGGVKLTA−−−−−EGSAALDALRELEREGVT−−−ILVCGT−−−−−−−−−CLNHFGLLEK−−−−−KQVGETTNMLDIVTAMQLADKVIS  
fig|335543.6.peg.3502   Syntrophobacter fumaroxidans MPOB     LDCRGMACPHPVLKAKEVVDRGD−−VA−−−−RFSVIVDNPAAKENVSRFLARAGYAVSVSE−−−−−QGETFEITGN−−−−−RDAT−−SSP−−−−−−−−−−−−−−−−−−−C−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ELPVDEAREETR−−−−−−−−−−−−−−−−−−−−−TAVLVATE−−−−−−−−−−FLGRGDDVLGGKLV−−−−−−−−−−−−−−−−−−−−−−−−−VNFIGTLK−−EMG−−QDLWRLIFLNGGVKLTA−−−−−EGSAALDALRELEREGVT−−−ILVCGT−−−−−−−−−CLNHFGLLEK−−−−−KQVGETTNMLDIVTAMQLADKVIS  
fig|485915.5.peg.865   Desulfohalobium retbaense DSM 5692     LDCQGLPCPQPVLQSKKTIESQQ−−PE−−−−TLLVTVDNEPAQHNVTRFLESQGYQIEAVE−−−−QNGAARCIKAL−−−−−RQGFQQTP−−−−−−−−−−−−−−−−−−−QETCPVCAPMT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EAEIKHVAENEQ−−−−−−−−−−−−−−−−−−−−−QLVLITSS−−−−−−−−−−CIGQGDDELGGGLM−−−−−−−−−−−−−−−−−−−−−−−−−KNFLATLP−−EMG−−RDLWRLILLNAGVKLAV−−−−−QDSPVLEELLALQSQGIS−−−ILVCGT−−−−−−−−−CLEHFGLLDH−−−−−KQVGETTNMLDVVTSLQTASKVIKV 
fig|555779.3.peg.1366   Desulfonatronospira thiodismutans ASO3-1     VDCRGLPCPQPVLKSREIIDSIN−−PD−−−−TLQVQVDNEPALENVSRFLSTQGYALEKPE−−−−KNGDIWTIHAS−−−−−RGEAPATGS−−−−−−−−−−−−−−−−−−−HEA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AAPGPGAGETLR−−−−−−−−−−−−−−−−−−−−−TMVFVSTS−−−−−−−−−−RLGTGDDELGSKLM−−−−−−−−−−−−−−−−−−−−−−−−−QNFIKTLP−−EMG−−SSLWMLVFVNSGVKLAV−−−−−KDSPVLETVQRLEENQVK−−−ILVCGT−−−−−−−−−CLEFFGLTDA−−−−−KDAGQTTNMLDIITAMSHADKVITV 
fig|411464.8.peg.1926   Desulfovibrio piger ATCC 29098     LDCRGLACPQPVMRTRDALEQGR−−PQ−−−−ELIVLVDNAAASENVSRFLRRSGFEVSVSQ−−−−PESALWEVHGL−−−−−SSATQVEAP−−−−−−−−−−−−−−−−−−−EQAP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ATAPAADTESRK−−−−−−−−−−−−−−−−−−−−−TLVLITTD−−−−−−−−−−TLGRGDDELGARLM−−−−−−−−−−−−−−−−−−−−−−−−−ENFLASLP−−ELG−−ASLWRIVLLNGGVKLAA−−−−−TEGKCLDTLKQLESNGVS−−−ILVCGT−−−−−−−−−CLNFFNLLEA−−−−−KQVGETTNMMDVVTSLSLADKVIRP 
fig|525146.3.peg.2203   Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774     LDCRGLACPQPVIRCRTAVDGGA−−−V−−−−ALEVVVDNAPALENVQRFLHSRGYTSEAIQ−−−−ETPQCWRITAALHTAESGLSAGAAP−−−−−−−−−−−−−−−−−−−AALSRT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AESDGEEGLGTQ−−−−−−−−−−−−−−−−−−−−−TLVLLTTE−−−−−−−−−−TLGRGDDTLGAKLM−−−−−−−−−−−−−−−−−−−−−−−−−ENFLATLP−−ELG−−PRLWRLVLVNGGVKLAA−−−−−RPGPALESLQRLAASGVS−−−ILVCGA−−−−−−−−−CLGHYGLLEA−−−−−KAVGETSNMLDIVTSLDLADKVIRP 
fig|644968.4.peg.645   Desulfovibrio sp. FW1012B     LDCRGLACPGPVLRCKECVEGDR−−PE−−−−TLTVTVDNEPARENVARFLAMRGYTVTMAA−−−−−KDGLFVLTAT−−−−−APQDATAPE−−−−−−−−−−−−−−−−−−−AARAGT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PSRPGPDSGNRK−−−−−−−−−−−−−−−−−−−−−TVVFITAD−−−−−−−−−−TLGRGDATLGHKLM−−−−−−−−−−−−−−−−−−−−−−−−−GNFLATLP−−ELG−−KELWRIILVNGGVKLAV−−−−−AGSPVLDRLQTLAASGVS−−−ILVCGT−−−−−−−−−CLDFFGVLDQ−−−−−KEVGETTNMLDVVTSLALADKVIQL 
fig|573370.3.peg.2252   Desulfovibrio magneticus RS-1     LDCRGLACPGPVLRCKECVEKDA−−PD−−−−TIAVTVDNEAARENVTRFLTMRGYAVTVAE−−−−AGDGVYVLTAT−−−−−AGAAPVAAP−−−−−−−−−−−−−−−−−−−D−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ATPAAKAEAGSR−−−−−−−−−−−−−−−−−−−−−TVVFITAD−−−−−−−−−−VIGRGDDTLGAKLM−−−−−−−−−−−−−−−−−−−−−−−−−VNFVGTLP−−ELG−−ERLWRIVLVNGGVRLAV−−−−−AGSPVLDKLKAMEQAGVS−−−ILVCGT−−−−−−−−−CLDFYGILDK−−−−−KEVGQTTNMLDVVTSLDLADKIVQI 
fig|526222.3.peg.1906   Desulfovibrio salexigens DSM 2638     IDCKGLPCPQPVLKCKNAIESEN−−PA−−−−KIKITVDNEAAKENVSRFMATKGYEVSVKE−−−−−KDNLFVVKGK−−−−−KNIS−−AEP−−−−−−−−−−−−−−−−−−−SAECEVCEV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MSAEELSNVGSK−−−−−−−−−−−−−−−−−−−−−TLVFLNSD−−−−−−−−−−VLGSGDDKLGAGLM−−−−−−−−−−−−−−−−−−−−−−−−−FNFLSTLP−−ELG−−DSLWRIIMVNGAVKLAT−−−−−EGSKCLEKLQDLEKAGVS−−−ILVCGT−−−−−−−−−CLDHFDLLDK−−−−−KKVGETTNMLDVVTSMQLASKVIK  
fig|643562.5.peg.380   Desulfovibrio aespoeensis Aspo-2     LECQGLPCPQPVLRCKDAVERLN−−PE−−−−RITVAVDNEAAKDNVSRFLGTRGYRVETAQ−−−−−SDRQYLITGT−−−−−RAQDDQAQP−−−−−−−−−−−−−−−−−−−ATGGQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SATSDAGTAPQK−−−−−−−−−−−−−−−−−−−−−ILVFISSE−−−−−−−−−−VIGSGDDGLGGRLM−−−−−−−−−−−−−−−−−−−−−−−−−FNFLATLK−−EIG−−GELWRIILVNGGVRLAV−−−−−PGSPCLNQLAALEQTGVS−−−ILVCGT−−−−−−−−−CLEHFGLTGQ−−−−−RQVGQVTNMLDVVTSFQLATKTV   
fig|525897.4.peg.3184   Desulfomicrobium baculatum DSM 4028     LNCENEPCPNPVLRCKRLLDEQT−−PQ−−−−KMEVIVDNEAAMDNVSRYLASKGMRVDETN−−−−KDGKLWTIKAS−−−−−QAGSADASP−−−−−−−−−−−−−−−−−−−AVQTPP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AQAEPKQGGTAK−−−−−−−−−−−−−−−−−−−−−ILVFLTSD−−−−−−−−−−TVGQGDDTLGSRLM−−−−−−−−−−−−−−−−−−−−−−−−−GNFLNTLP−−ELG−−EALWRIIMVNGAVKLAT−−−−−ATNPAIEALKKLEAAGVS−−−ILVCGT−−−−−−−−−CLEFFKLMDQ−−−−−KEVGQVTNMLDVVTSQQVADKVITL 
fig|882.1.peg.1663   Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough     LNCQKLPCPQPVLRCKALLDTEA−−PA−−−−RCTVTVDNAPASENVARFLTSRGYDTSVHA−−−−DPEGLWNIIAV−−−−−RKDSAVAP−−−−−−−−−−−−−−−−−−−SCDCEVMDARGI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AAIAGTAEMPQK−−−−−−−−−−−−−−−−−−−−−VTVFITSE−−−−−−−−−−TLGSGDDVLGGKLM−−−−−−−−−−−−−−−−−−−−−−−−−ANFLATLP−−ELG−−DELWRIVCVNGGVRLAT−−−−−REHPAVTHLNKLEAMGVD−−−ILVCGT−−−−−−−−−CLDHFGLLSE−−−−−KAVGQTTNMLDVVTSLQLATKVIRP 
fig|883.4.peg.385   Desulfovibrio vulgaris str. 'Miyazaki F'     LNCQNLPCPQPVLRCKRCLDEQS−−PA−−−−SLVVVVDNQAARENVTRFLSTQGYTVQVEAVSPDAGDGLWRLRGV−−−−−KGDAPATNP−−−−−−−−−−−−−−−−−−−ADDCEVCEV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MTEEQLRRMGEK−−−−−−−−−−−−−−−−−−−−−VVVFLTSD−−−−−−−−−−VIGSGDDALGAKLM−−−−−−−−−−−−−−−−−−−−−−−−−QNFLATLP−−ELG−−AELWRVVMLNGAVRLSA−−−−−ADSPALPHLKRLEAAGAT−−−VLVCGT−−−−−−−−−CLDHFGLLEQ−−−−−KAVGQTTNMLDVVTSLQLATKIIRP 
fig|207559.3.peg.1292   Desulfovibrio desulfuricans G20     LNCQNLPCPQPVLKCKDCIDTRS−−PA−−−−QMAVIVDNAAAKENVTRFLGTRGYAVTATE−−−−TPQGAWKLQAV−−−−−LESS−−VGA−−−−−−−−−−−−−−−−−−−QSGCEQCEV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LSSEELRALDEK−−−−−−−−−−−−−−−−−−−−−TVVLITTE−−−−−−−−−−VLGSGDDTLGTRLM−−−−−−−−−−−−−−−−−−−−−−−−−KNFLATLP−−ELG−−STLWRVVLLNGGVKLAS−−−−−DGHEALPELQKLESAGVD−−−ILVCGT−−−−−−−−−CLDFFGLLER−−−−−KAAGQTTNMLDVVTSLQLATKVIRP 
fig|207559.7.peg.1942   Desulfovibrio desulfuricans subsp. desulfuricans str. G20     LNCQNLPCPQPVLKCKDCIDTRS−−PA−−−−QMAVIVDNAAAKENVTRFLGTRGYAVTATE−−−−TPQGAWKLQAV−−−−−LESS−−VGA−−−−−−−−−−−−−−−−−−−QSGCEQCEV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LSSEELRALDEK−−−−−−−−−−−−−−−−−−−−−TVVLITTE−−−−−−−−−−VLGSGDDTLGTRLM−−−−−−−−−−−−−−−−−−−−−−−−−KNFLATLP−−ELG−−STLWRVVLLNGGVKLAS−−−−−DGHEALPELQKLESAGVD−−−ILVCGT−−−−−−−−−CLDFFGLLER−−−−−KAAGQTTNMLDVVTSLQLATKVIRP 
fig|352165.3.peg.1288   Pyramidobacter piscolens W5455     IDARGKACPEPVIMTKNAVADNP−−−D−−−−AVAVRVDNVPATQNVSRFFESKGYRAVVSG−−−−−EGKDFTVTGT−−−−−RDGSLPAPE−−−−−−−−−−−−−−−−−−−F−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−CGCDLMPSARLK−−−−−−−−−−−−−−−−−−−−−NAVFIAHS−−−−−−−−−−RIGGDDPQLGEVLM−−−−−−−−−−−−−−−−−−−−−−−−−KAFLGTLV−−QYDENERPAVIALMNEGVKLAE−−−−−RDTSSAETLRDYVARGGT−−−VLVCGT−−−−−−−−−CLKHFGLMEK−−−−−VGVGIVSNMFEIVSTLLACNTLSL  
fig|645512.3.peg.277   Jonquetella anthropi E3_33 E1                 MMTREALASAP−−−E−−−−AIQVTVDNAIAGQNVSRFLTSQGYAVKLSA−−−−−ENDDIIIEGT−−−−−KAVSSPAPT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KAECQPARALK−−−−−−−−−−−−−−−−−−−−−PAMLITHQ−−−−−−−−−−TLGGNDAELGEVLI−−−−−−−−−−−−−−−−−−−−−−−−−KGLLGTLS−−QLDDLRPAVVALMNEGVKLAV−−−−−RGTPTCEALNAYEKAGGS−−−VLVCGT−−−−−−−−−CLKHFGLTDS−−−−−IGVGVVSNMFEIVSTMLASNAV    
fig|572547.3.peg.1192   Aminobacterium colombiense DSM 12261     IDARGKACPQPVMMTKEAVEKGE−−−R−−−−DLVIYLDNPVAASNVQRFLSKQGFSMSLRD−−−−−EEGHIIIEAK−−−−−AQGNLSPVP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TLVQAQDNK−−−−−−−−−−−−−−−−−−−−−TAILITRI−−−−−−−−−−ILGGKDAELGEVLI−−−−−−−−−−−−−−−−−−−−−−−−−KGFLGTLA−−QLE−−VPPASIALMNEGVKLAN−−−−−KGTPTCEHLQEIAAKGTT−−−VLVCGT−−−−−−−−−CTNHFGITDN−−−−−VGVGTISNMFEITDTLLKAAKVISF 
fig|469381.5.peg.2277   Dethiosulfovibrio peptidovorans DSM 11002     VDARGKMCPQPVIMTKKAIEAGA−−−S−−−−EIKVIVDNAIAGQNVTRLLKSKGFEVVLEA−−−−ENDLDIAVTGI−−−−−KGDGPSEGE−−−−−−−−−−−−−−−−−−−DGTSPSEDTR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GRSNGPSGDSKA−−−−−−−−−−−−−−−−−−−−−IAVIITRD−−−−−−−−−−ILGGADRDLGEILI−−−−−−−−−−−−−−−−−−−−−−−−−KGFLGTLH−−QLDDELIPETLAFMNEGVKLAL−−−−−KDSSTCESIIELEKKGCR−−−ILVCGT−−−−−−−−−CVNHFGIADQ−−−−−VGVGEISNMFDISEAMLKADSILSL 
fig|525903.6.peg.255   Thermanaerovibrio acidaminovorans DSM 6589     VDARGQSCPKPVMMAKEAVDRGA−−−S−−−−RLEVLVDNPVSGENVTRFLKGQGFQVTRSE−−−−−GPEGILLTAE−−−−−RSAPPAEVP−−−−−−−−−−−−−−−−−−−EDHPP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−CSCPSDAPSKAP−−−−−−−−−−−−−−−−−−−−−MGLLILSR−−−−−−−−−−TLGGESAELGEALM−−−−−−−−−−−−−−−−−−−−−−−−−KAFLDTMR−−QAG−−−TVSVVALMNGGVFLSL−−−−−PDSSASDTLKEMEAQGTR−−−VLVCGT−−−−−−−−−CTKHFGVTDR−−−−−VCVGSISNMFEITSEVFAAAK     
fig|592015.5.peg.418   Anaerobaculum hydrogeniformans ATCC BAA-1850     VDARGTTCPKPVIMTKKAIDSGE−−−K−−−−EVEVLVDNDVSFQNVRRFLDSQGYEIIEAV−−−KKEDGTFVIRGK−−−−−SGETAEDST−−−−−−−−−−−−−−−−−−−AEIED−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TAKTKPNEEKKS−−−−−−−−−−−−−−−−−−−−−VGVLLLSD−−−−−−−−−−TIGRPNDGLGEVLM−−−−−−−−−−−−−−−−−−−−−−−−−KSFLGVLL−−EGE−−−PPVVIALMNEGVLLSL−−−−−PENSASEILRDLEKKGTS−−−ILVCGT−−−−−−−−−CTNHFGVTDK−−−−−VSVGTISNMFQITEAMLEVDK     
fig|429009.3.peg.633   Ammonifex degensii KC4     IDARGKPCPQPVLMVKEVVDAGV−−−D−−−−SFAVLVDSQASVENVRRFAERSGFSVTVEE−−−−−KEGFFRLVGR−−−−−KEGAPAEEE−−−−−−−−−−−−−−−−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AEKAAEIAPAPV−−−−−−−−−−−−−−−−−−−−−KTLLILSD−−−−−−−−−−TLGRDDPVLGRKLV−−−−−−−−−−−−−−−−−−−−−−−−−KILLDTLA−−VQE−−KQPQYIILMNAGVKLAC−−−−−EGSEVLEALADLEAKGVQ−−−ILACGT−−−−−−−−−CLNHFNLLPS−−−−−LRVGRPTNAYEVTNLLLAGGVLT   
fig|443144.3.peg.3411   Geobacter sp. M21     LDVRGMACPLPVVSVKRALESTE−−−G−−−−ELRVLLDDGAPRENVKRFVQGRGYQVREEQ−−−−−LEDGFALTIT−−−−−GTGSGAGKG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QAAPAERDGA−−−−−−−−−−−−−−−−−−−−−TVMLIGSD−−−−−−−−−−RLGDGAEELGRLLM−−−−−−−−−−−−−−−−−−−−−−−−−KNFIITLL−−DMS−−ELPDRIFFLNSGVLLVA−−−−−QGSEVIEALVELGNRGVE−−−VLSCGI−−−−−−−−−CLDFYKKKEL−−−−−LAAGGVTNMFTIAESMLQARSVVRL 
fig|404380.3.peg.3360   Geobacter bemidjiensis Bem     LDVRGMACPLPVVSVKRALESAE−−−G−−−−ELRVLLDDGAPRENVKRFVQGRGYQVQEEQ−−−−−LEDGFALTVS−−−−−GTGSGAAKR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EAAPAERSGA−−−−−−−−−−−−−−−−−−−−−TVMLIGSD−−−−−−−−−−RLGDGAEELGRLLM−−−−−−−−−−−−−−−−−−−−−−−−−KNFIITLL−−DMT−−ELPDRIFFLNSGVLLVA−−−−−QGSEVIEALVELGNRGVE−−−VLSCGI−−−−−−−−−CLDFYKKKEL−−−−−LAAGGVTNMFTIAESMLQARSVVRL 
fig|443143.3.peg.1678   Geobacter sp. M18     LDVRGMACPLPVVQVKRALESAQ−−−G−−−−ELRVLLDDGAPRENVKRFAQGRGYQVQEER−−−−−LEDGFAFTIT−−−−−GPGAAAAPR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QVVPAEAGGA−−−−−−−−−−−−−−−−−−−−−TVMLIGTD−−−−−−−−−−RLGDGPEELGRLLM−−−−−−−−−−−−−−−−−−−−−−−−−KNFIITLL−−DMS−−ELPDRIFFVNSGVLLAA−−−−−QGSEVIEALEELGNRGVE−−−VLSCGI−−−−−−−−−CLDFFKKKEL−−−−−LAAGGVTNMFTIAESMLNARSVVRL 
fig|351605.6.peg.4020   Geobacter uraniireducens Rf4     IDCRNMACPQPVVMVKRALEENP−−GE−−−−PLNVLLDDGAPRENVGRFAANRGLEVEETV−−−−−VGGAFSLVIS−−−−−GTQQQAKE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GVVSIGGK−−−−−−−−−−−−−−−−−−−−−TVMLVAAD−−−−−−−−−−RLGDGPEELGRLLM−−−−−−−−−−−−−−−−−−−−−−−−−KNFIITLL−−DVT−−DVPDLMLFVNTGVLLTT−−−−−EGSEVIEALEKLGNRGVE−−−IFSCGV−−−−−−−−−CLDFFHRKDK−−−−−LAAGTVTNMFTIAESMLQARSVIRV 
fig|243231.1.peg.2505   Geobacter sulfurreducens PCA     IDCRNMACPAPVVTTKRALEEAG−−GE−−−−TVRVLVDAGAPRENVARFAANRGFRVAVEE−−−−−ADGGFAITIG−−−−−SGEGAPSAP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AENPARQGR−−−−−−−−−−−−−−−−−−−−−TVMLITSD−−−−−−−−−−RLGDGPEDLGRLLM−−−−−−−−−−−−−−−−−−−−−−−−−KSFIITLL−−DQE−−SLPDRMMFLNSGVLLTT−−−−−EGSEVLQALEQLGNRGVE−−−VLSCGV−−−−−−−−−CLDFFHCKEK−−−−−LAAGTVTNMFTTAEALLTAGSVIRL 
fig|269799.3.peg.1469   Geobacter metallireducens GS-15     IDCRNMACPAPVVTTKRALEEAG−−GE−−−−TVQVLVDPGAPRENVIRFAENRGFAVSEVE−−−−−ADNGFALTIT−−−−−SPGSAPVEP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VRTVAGKGGK−−−−−−−−−−−−−−−−−−−−−TVMLVASD−−−−−−−−−−RLGDGPEELGRLLM−−−−−−−−−−−−−−−−−−−−−−−−−KNFIITLL−−DLA−−ELPDRMLFVNTGVLLTT−−−−−EGSEVLEALQSLGNRGVE−−−VLSCGV−−−−−−−−−CLDFFHRKEK−−−−−LVAGSVTNMFTIAESLLGAGSVVRL 
fig|691164.3.peg.2398   Geobacter metallireducens RCH3     IDCRNMACPAPVVTTKRALEEAG−−GE−−−−TVQVLVDPGAPRENVIRFAENRGFAVSEVE−−−−−ADNGFALTIT−−−−−SPGSAPVEP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VRTVAGKGGK−−−−−−−−−−−−−−−−−−−−−TVMLVASD−−−−−−−−−−RLGDGPEELGRLLM−−−−−−−−−−−−−−−−−−−−−−−−−KNFIITLL−−DLA−−ELPDRMLFVNTGVLLTT−−−−−EGSEVLEALQSLGNRGVE−−−VLSCGV−−−−−−−−−CLDFFHRKEK−−−−−LVAGSVTNMFTIAESLLGAGSVVRL 
fig|398767.5.peg.2371   Geobacter lovleyi SZ     IDCRGQACPAPVIATKKALEESA−−−A−−−−GVCVLVDDGAPRENVGRFARNRGYQVTETA−−−−−QGDGWSLLLS−−−−−SSGTTAIAE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PGGQTGGLTGE−−−−−−−−−−−−−−−−−−−−−RVLLVTSN−−−−−−−−−−RLGEGPEELGQLLM−−−−−−−−−−−−−−−−−−−−−−−−−KNFLFTLL−−ETP−−QQPDRILLLNSGVLLAT−−−−−AGAETVEALKRLEERGTE−−−IFACGV−−−−−−−−−CLDYFKKKDQ−−−−−LAAGRVTNMFSTAENLLAAALVIKL 
fig|338963.6.peg.338   Pelobacter carbinolicus DSM 2380     IDCRGLSCPRPVVETKKAMEAFP−−DA−−−−EIEVLLNDEIACENVSRLAAGRHWTVVAVT−−−−REGEDIQLLL−−−−−RSENAEAGE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PAPEALSDEEA−−−−−−−−−−−−−−−−−−−−−FLVYCPSD−−−−−−−−−−KLGRGDDKLGEILM−−−−−−−−−−−−−−−−−−−−−−−−−QSFIKSLV−−DMP−−PLPKRIVFLNSGVRLAT−−−−−EGSAVLDTLRYFEEQGVE−−−IFSCGT−−−−−−−−−CLDFFGLKEQ−−−−−LRVGNATNMFEIITALRSFDRVVQP 
fig|891.1.peg.4290   Desulfuromonas acetoxidans     LDCRGKKCPQPVIETRKVLLANP−−AA−−−−SQRVLVSDETARQNVSRLAESLGRSVIATA−−−−−TEGGFALEIA−−−−−AGAIQEAAT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SEPAVHGK−−−−−−−−−−−−−−−−−−−−−TVVFVSSD−−−−−−−−−−KMGSGDDELGHILM−−−−−−−−−−−−−−−−−−−−−−−−−KNFIFTLL−−EIN−−PVPDALYFVNAGVKLTT−−−−−KGSDVLEALGRLADQGAD−−−IASCGL−−−−−−−−−CLEFFDLKES−−−−−LAVGRATNMLDTVETLSTAGRIIRP 
fig|891.1.peg.4481   Desulfuromonas acetoxidans     LDCRELQCPRPVLETRKQILAHP−−DE−−−−PVQVRVGNDIAQANVTRLATKEGFAVTATS−−−−−KGDEIVLDLT−−−−−PQETPQVVE−−−−−−−−−−−−−−−−−−−TQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−APPATTKKITQD−−−−−−−−−−−−−−−−−−−−−TVVYIASA−−−−−−−−−−CMGRGNDELGEVLM−−−−−−−−−−−−−−−−−−−−−−−−−RNFICTLL−−ESS−−QLPSTMLFVNGGVKLTC−−−−−EGSAVLEPLQRLEESGVT−−−INVCGL−−−−−−−−−CLEFYELKDQ−−−−−LKVGQVSNMLDTVEAMQQADRIIQP 
fig|360109.10.peg.1840   Campylobacter jejuni subsp. doylei 269.97     IDCRNLSCPQPIVETKNAFEKLQENE−−−−ILEIVLNSIISKNNVVKFLNSLNLNPVVDE−−−−−NAQEFCIKVQ−−−−−KKNFNS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SEVNIHDY−−−−−−−−−−−−−−−−−−−−−NVLFLKTD−−−−−−−−−−KVGEG−−ELGQNLL−−−−−−−−−−−−−−−−−−−−−−−−−VGFLNTLK−−NLD−−HAPSKILCVNESVLINV−−−−−DENHKAHLAMKELENLGIE−−−IISCGA−−−−−−−−−CLEFFNKSKE−−−−−LKIGNIGNAYEILNELFGKAKIITL 
fig|683083.3.peg.1092   Campylobacter jejuni subsp. jejuni 414     IDCRNLSCPQPIVETKNALEKLQEGE−−−−TLEIILNSFISKNNVVKFLNSLKLNPIVDE−−−−−NAQEFYIKVQ−−−−−KKNFNS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SEVNVHDY−−−−−−−−−−−−−−−−−−−−−SVLFLKTD−−−−−−−−−−KVGKG−−ELGQNLL−−−−−−−−−−−−−−−−−−−−−−−−−VGFLNTLK−−NLD−−HAPSKILCVNESVLINV−−−−−DENHKAHLVMKELENLGIE−−−IISCGA−−−−−−−−−CLEFFNKSKE−−−−−LKIGSMGNAYEILNELFSKAKIITL 
fig|889230.3.peg.213   Campylobacter jejuni subsp. jejuni 1213     IDCRNLSCPQPIVETKNALEKLQENE−−−−ILEIVLNSIISKNNVVKFLNSLNLNPIIDE−−−−−NAQEFCIKVQ−−−−−KKNFNS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SEINVHDY−−−−−−−−−−−−−−−−−−−−−NVLFLKTD−−−−−−−−−−KVGEG−−ELGQNLL−−−−−−−−−−−−−−−−−−−−−−−−−VGFLSTLK−−NLD−−HAPSKILCVNESVLINV−−−−−DENHKAHLAMKELENLGIE−−−IISCGA−−−−−−−−−CLEFFNKSKE−−−−−LKIGNIGNAYEILNELFGKAKIITL 
fig|407148.6.peg.1418   Campylobacter jejuni subsp. jejuni 81116     IDCRNLSCPQPIVETKNALEKLQENE−−−−ILEIVLNSIISKNNVVKFLNSLNLNPIIDE−−−−−NAQEFCIKVQ−−−−−KKNFNS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SEVNIHDY−−−−−−−−−−−−−−−−−−−−−NVLFLKTD−−−−−−−−−−KVGEG−−ELGQNLL−−−−−−−−−−−−−−−−−−−−−−−−−VGFLSTLK−−NLD−−HAPSKILCVNESVLINV−−−−−DENHKAHLAMKELENLGIE−−−IISCGA−−−−−−−−−CLEFFNKSKE−−−−−LKIGNIGNAYEILNELFGKAKIITL 
fig|1093788.3.peg.231   Campylobacter jejuni subsp. jejuni NW     IDCRNLSCPQPIVETKNALEKLQENE−−−−ILEIVLNSIISKNNVVKFLNSLNLNPIVDE−−−−−NAQEFCIKVQ−−−−−KKNFDS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SEVNIHDY−−−−−−−−−−−−−−−−−−−−−NVLFLKTD−−−−−−−−−−KVGEG−−ELGQNLL−−−−−−−−−−−−−−−−−−−−−−−−−VGFLSTLK−−NLD−−HAPSKILCVNESVLINV−−−−−DENHKAHLAMKELENLGIE−−−IISCGA−−−−−−−−−CLEFFNKSKE−−−−−LKIGNIGNAYEILNELFGKAKIITL 
fig|360112.4.peg.197   Campylobacter jejuni subsp. jejuni HB93-13     IDCRNLSCPQPIVETKNALEKLQENE−−−−ILEIVLNSIISKNNVVKFLNSLNLNPVVDE−−−−−NAQEFCIKVQ−−−−−KKNFDS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SEVNIHDY−−−−−−−−−−−−−−−−−−−−−NVLFLKTD−−−−−−−−−−KVGEG−−ELGQNLL−−−−−−−−−−−−−−−−−−−−−−−−−VGFLSTLK−−NLD−−HAPSKILCVNESVLINV−−−−−DENHKAHLAMKELENLGIE−−−IISCGA−−−−−−−−−CLEFFNKSKE−−−−−LKIGNIGNAYEILNELFGKAKIITL 
fig|885274.3.peg.516   Campylobacter jejuni subsp. jejuni H22082     IDCRNLSCPQPIVETKNALEKLQENE−−−−ILEIVLNSIISKNNVVKFLNSLNLNPVVDE−−−−−NAQEFCIKVQ−−−−−KKNFDS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SEVNIHDY−−−−−−−−−−−−−−−−−−−−−NVLFLKTD−−−−−−−−−−KVGEG−−ELGQNLL−−−−−−−−−−−−−−−−−−−−−−−−−VGFLSTLK−−NLD−−HAPSKILCVNESVLINV−−−−−DENHKAHLAMKELENLGIE−−−IISCGA−−−−−−−−−CLEFFNKSKE−−−−−LKIGNIGNAYEILNELFGKAKIITL 
fig|889213.3.peg.1152   Campylobacter jejuni subsp. jejuni 129-258     IDCRNLSCPQPIVETKNALEKLQENE−−−−ILEIVLNSIISKNNVVKFLNSLNLTPVVDE−−−−−NAQEFCIKVQ−−−−−KKNFDS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SEVNIHDY−−−−−−−−−−−−−−−−−−−−−NVLFLKTD−−−−−−−−−−KVGEG−−ELGQNLL−−−−−−−−−−−−−−−−−−−−−−−−−VGFLSTLK−−NLD−−HAPSKILCVNESVLINV−−−−−DENHKAHLAMKELENLGIE−−−IISCGA−−−−−−−−−CLEFFNKSKE−−−−−LKIGNIGNAYEILNELFGKAKIITL 
fig|889227.3.peg.500   Campylobacter jejuni subsp. jejuni 51037     IDCRNLSCPQPIVETKNALEKLQENE−−−−ILEIVLNSIISKNNVVKFLNSLNLNPVVDE−−−−−NAQEFCIKVQ−−−−−KKNFDS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SKVNIHDY−−−−−−−−−−−−−−−−−−−−−NVLFLKTD−−−−−−−−−−KVGEG−−ELGQNLL−−−−−−−−−−−−−−−−−−−−−−−−−VGFLSTLK−−NLD−−HAPSKILCVNESVLINV−−−−−DENHKAHLAMKELENLGIE−−−IISCGA−−−−−−−−−CLEFFNKSKE−−−−−LKIGNIGNAYEILNELFGKAKIITL 
fig|887280.3.peg.875   Campylobacter coli 111-3     IDCRNLECPKPIVETKKALQNLQNNE−−−−ILEIVLNSVISKNNVLKFLTSLNLHADIEE−−−−−NNNEFYIRVK−−−−−KQELDF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SKASTDEY−−−−−−−−−−−−−−−−−−−−−NVLFLKTD−−−−−−−−−−KVGDG−−KLGENLL−−−−−−−−−−−−−−−−−−−−−−−−−VGFLSTLK−−NVE−−NIPSKILCVNESVFINV−−−−−DENHRAHLAMKELEKLGVE−−−IISCGA−−−−−−−−−CLEFFGKSKE−−−−−LKIGSIGNAYEILNELCGKAKIITL 
fig|306264.5.peg.942   Campylobacter upsaliensis RM3195     IDCRNLDCPAPVIETKNALEKLENGE−−−−KLEILLNSHIAKNNVIKFLNSLNLTHTCEE−−−−−RGEEFYITVQ−−−−−KSACEL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NFNKEINN−−−−−−−−−−−−−−−−−−−−−TILFLKST−−−−−−−−−−KVGDG−−ELGENLL−−−−−−−−−−−−−−−−−−−−−−−−−LGFLSTLK−−NLE−−NRPNKIICVNDSVLINT−−−−−DKTHKAHEAMLELENLGVE−−−IISCGA−−−−−−−−−CLEFFDKTKE−−−−−LKIGSIGNAYAILNELFGKAKIITL 
fig|306263.5.peg.363   Campylobacter lari RM2100     IDCRDLACPRPVIETKKALEELKENE−−−−NLEILLNSQASKENVMRFLKSLNLKFSVKD−−−−−LDDESVISIV−−−−−KDGNIAHNQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EQNLQEY−−−−−−−−−−−−−−−−−−−−−NVLFLKSD−−−−−−−−−−RVGEG−−ELGKNLM−−−−−−−−−−−−−−−−−−−−−−−−−LGFLKTLK−−DLP−−NKPVKILCVNDSVLMNT−−−−−DCSHMAFEAMKELENLGVE−−−IYSCGA−−−−−−−−−CLEFFGKSKE−−−−−LKIGKIGNAYEILNELFGKAKIISL 
fig|360106.6.peg.334   Campylobacter fetus subsp. fetus 82-40     IDCRGLECPKPIIKTRDALNELSIGD−−−−KLEIVVNSPASLANVQKFLSANGLEFNISQ−−−−−NGSEYTVTAV−−−−−KSCDLTEID−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IQNYSCETDFKKH−−−−−−−−−−−−−−−−−−−−−KVLFLKYD−−−−−−−−−−KVGS−−DPIGKGLL−−−−−−−−−−−−−−−−−−−−−−−−−TKFLSAISAVQAN−−KRVTHIICVNEAVLMTT−−−−−NRSHPSFAVLKDLSSLGIN−−−VLSCGS−−−−−−−−−CLEAFGLVDR−−−−−LGVGQISNAFEIMSLMLENETV    
fig|360107.7.peg.1696   Campylobacter hominis ATCC BAA-381     IDCRNLECPKPVIKTKETLKSLKIGQ−−−−NLEILVNSKTSLENISRFLNTNSMKFEVSE−−−−LDGGEFCIKTT−−−−−KMDELEDEN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDFAVCDSGVKNVK−−−−−−−−−−−−−−−−−−−−−KVIFLNEE−−−−−−−−−−SCGSG−−EVGKSLL−−−−−−−−−−−−−−−−−−−−−−−−−AKFLGTIK−−NLT−−NPPKTIICVNNAVFMTT−−−−−NRAHACYPVLKDLESIGIE−−−ILSCGS−−−−−−−−−CLEAYKLVDK−−−−−LSIGKMSNAYEIMEILTQ        
fig|553220.3.peg.238   Campylobacter gracilis RM3268     LDCRNLNCPEPLLRTKKALGELKIAE−−−−SLEILVNDIAPRENIKRFLAKNGFEAQISQ−−−−−AGADTLIKTV−−−−−KTDELKDES−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDDIYCDVAAPKRG−−−−−−−−−−−−−−−−−−−−−KVIFLNEE−−−−−−−−−−QCGSG−−PIGKSLL−−−−−−−−−−−−−−−−−−−−−−−−−AKFLGAAL−−SLD−−EKPVKLICVNNAVLITT−−−−−NRGHECFEAIKKLNEAGAE−−−ILSCGS−−−−−−−−−CLEGYKLVDK−−−−−LAIGEISNAYEIMDVLSKYEVIKL 
fig|936554.3.peg.1588   Campylobacter sp. FOBRC14     LDCRNLACPEPVIKTKNAIGGLKEGE−−−−ELEILLNSVASFENVSKFLTSQGQNFKRKE−−−−LGGGEYVIKAI−−−−−KSGEINEQI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DASEYVCEPIGKNVK−−−−−−−−−−−−−−−−−−−−−KVIYLNED−−−−−−−−−−RAGSG−−AVGEVLL−−−−−−−−−−−−−−−−−−−−−−−−−SKFLGGFA−−QID−−NKPYAVVCVNTAVKMTT−−−−−DRSHPGFKPLRDLESLGVK−−−IFSCGS−−−−−−−−−CLEAYGLVDK−−−−−LSIGEMTNAYEVAEILSKYDEI    
fig|360104.4.peg.1764   Campylobacter concisus 13826     IDCRNLECPKPVIMTKNALEGLNEGE−−−−SLEIIVNALAPKENISRFLKNQNIEFSLES−−−−−NGNETKILAI−−−−−KGKSALELT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NFDEFVCDITPKNE−−−−−−−−−−−−−−−−−−−−−−KVLYLNEE−−−−−−−−−−RAGSG−−EVGINLL−−−−−−−−−−−−−−−−−−−−−−−−−SKFLGALL−−QVE−−KKPKIIICVNNAVKMTT−−−−−NRSHPSFKPLKDLEAAGVQ−−−ILSCGS−−−−−−−−−CLEAYKLVSD−−−−−LAVGEISNAYEIIDILSTHEQI    
fig|553219.3.peg.1653   Campylobacter showae RM3277     IDCRNLACPEPVIRTKNTLESLKVGE−−−−KLEILVNSIAPKENISRFLKNQNVEFSVEQ−−−−−NGAETKITAV−−−−−KGESKLELA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NFDEFVCEITPKAKK−−−−−−−−−−−−−−−−−−−−−TVVYLNEE−−−−−−−−−−YAGSG−−DVGVSLL−−−−−−−−−−−−−−−−−−−−−−−−−SKFLGALL−−QVE−−−KPEYVICVNNAVKMTT−−−−−NRAHAGFKPLKDLEAAGVK−−−ILSCGS−−−−−−−−−CLEAYKLVGD−−−−−LSVGEISNAYEIMQILTSHEQI    
fig|553218.4.peg.731   Campylobacter rectus RM3267     IDCRNLACPEPVIRTKNALDGLRVGE−−−−KLEILVNSIAPKENISRFLKSQNVEFSVLQ−−−−−NGAETKITAV−−−−−KGESKLELT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NFDKFACEIMPKTKK−−−−−−−−−−−−−−−−−−−−−TVVYLNEE−−−−−−−−−−YAGSG−−DVGVSLL−−−−−−−−−−−−−−−−−−−−−−−−−AKFLGALL−−QVE−−−KPEYVICVNNAVKMTT−−−−−NRAHPSFKPLKDLEAAGVK−−−ILSCGS−−−−−−−−−CLEAYKLVSD−−−−−LSVGEMSNAYEVMQILTTHEQI    
fig|273121.1.peg.930   Wolinella succinogenes DSM 1740     IDVRNLGCPEPVIRTKKALDALGTEG−−−−ILEVLGNTEASKENILRFAQNSGYGASLEE−−−−RAGGEFLITLT−−−−−KGYECTLAS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PKPSRESGE−−−−−−−−−−−−−−−−−−−−−KVMFVKDD−−−−−−−−−−CIGERSELGEKLA−−−−−−−−−−−−−−−−−−−−−−−−−RGFLKALL−−EAN−−TLPKKIIFVNRGVWLTTKE−−−ENRATIDDLILLEKKGVE−−−IYSCGA−−−−−−−−−CLDYFGLAQE−−−−−LKVGKIGNALETINTLLDSSGVISL 
fig|1206745.3.peg.1140   Helicobacter cinaedi ATCC BAA-847     IDVRDLPCPEPVVKAKKALVGVNEHSLKLHSYEIIGNSPSSKENLSRFLKTEGFEFEIGL−−−−GRDEQFIIFL−−−−−KGKVGKLSK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ESKDKIIP−−−−−−−−−−−−−−−−−−−−−KMMLIKND−−−−−−−−−−RVGEG−−ELGGMLI−−−−−−−−−−−−−−−−−−−−−−−−−NGFIKSLL−−QTE−−VLPHKILFINRGVLLTTDNKEVDNAEIVEVLKELEKQGVE−−−IYSCGS−−−−−−−−−CLSYFALTER−−−−−LKVGMIGNAIDGVQNMLTSDSLISL 
fig|235279.5.peg.1711   Helicobacter hepaticus ATCC 51449     IDVRDLPCPEPVLKAKKALLGINEHTLKLHNYEIIGNSPSSKENLMRFLNTEGFEFEVGF−−−−GRDEQFMIIL−−−−−KGKASKQN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AHKDKIIP−−−−−−−−−−−−−−−−−−−−−KMMLIKND−−−−−−−−−−RVGEG−−ELGGMLI−−−−−−−−−−−−−−−−−−−−−−−−−NGFIKSLL−−QTD−−ILPQKIFFVNRGVLLTTDNKEVDNTEIVEVLKELEKQGVE−−−VYSCGS−−−−−−−−−CLSYFSLTER−−−−−LKVGMIGNAIQGVQNMLLADSLISL 
fig|391592.5.peg.446   Caminibacter mediatlanticus TB-2     IDCRGLACPEPVIKTKRALDEIN−−EG−−−−VIEVIVDNIASKENVKRFAENQGYSVDVKE−−−−−DNGISILTIV−−−−−KGYECKIVE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DNSNNLLN−−−−−−−−−−−−−−−−−−−−−KTLLFKDD−−−−−−−−−−KVGEG−−ELGKKLL−−−−−−−−−−−−−−−−−−−−−−−−−RGFLKTLL−−DFD−−KLPKTITFINRGVFVTTKE−−−EFSDVQEILKELNKKGVE−−−IYSCGL−−−−−−−−−CMEHFGINPKE−−−−−LKVGEIGNAFGTMDALLNSENTITF 
fig|525898.4.peg.1912   Sulfurospirillum deleyianum DSM 6946     IDCSGLACPEPVLQTKKALESLPNDS−−−−ILEVIVDNIAARENVVRFAQNGGFETRLEG−−−−LEEGKTLVSII−−−−−KGFACQIVA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TSKDDAFLD−−−−−−−−−−−−−−−−−−−−−KTLFLKSH−−−−−−−−−−TVGEG−−ELGEKLV−−−−−−−−−−−−−−−−−−−−−−−−−VGFLKSAL−−ELP−−KIPKRIICVNTAVYLTSAE−−−ENSPIMEVLKAFEAKGVE−−−IYSCGI−−−−−−−−−CLEFYGVMDK−−−−−LKVGKIGNAYGTLEMLLGGEGTISL 
fig|598659.3.peg.1247   Nautilia profundicola AmH     IDCRNMACPQPVLETKKALEEMD−−EG−−−−ILEVLVNSVSSVQNVKRYAMNNGFEPKVEE−−−−LENGDTLITIV−−−−−KGYECAIVA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DEEEEEKFLN−−−−−−−−−−−−−−−−−−−−−KSLFIKTD−−−−−−−−−−KVGNG−−ELGSILM−−−−−−−−−−−−−−−−−−−−−−−−−KGFLKTTL−−EFK−−KLPKNIIFVNEGVFLTTKE−−−ENAEVIEILKEFEKRGVK−−−IYSCGL−−−−−−−−−CMNHYNIPAED−−−−−LKVGEIGNAYDTMDMLLHTEVISL 
fig|289376.4.peg.980   Thermodesulfovibrio yellowstonii DSM 11347     IDARGLECPKPIILAENALSKIE−−EG−−−−VLTIIVDNEGSLENLKKYATRFGYYYEVEK−−−−−NENYWKLKIV−−−−−KGYTCQLNN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ISEKAIKKN−−−−−−−−−−−−−−−−−−−−−LLVIISSD−−−−−−−−−−VIGKDENLGRILM−−−−−−−−−−−−−−−−−−−−−−−−−KAFFDTMI−−VTG−−QLPQMIFLMNTAVKLST−−−−−IDEEFISILKKVEQMGTE−−−IFTCGT−−−−−−−−−CLKYYNLEDS−−−−−LKVGYRGTTNHFVEGMFDFHKTV   
fig|522772.6.peg.421   Denitrovibrio acetiphilus DSM 12809     IDARGLACPQPVLMIKAELEKIE−−EG−−−−VVTILVDNKGSSINVKNFCEANGHTVSVDE−−−−−TDGYYKISAA−−−−−KGYDCAIAE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ETEADTDTN−−−−−−−−−−−−−−−−−−−−−IVVFITGE−−−−−−−−−−TLGDDKELGAMLM−−−−−−−−−−−−−−−−−−−−−−−−−KGFIGNLK−−NMD−−ILPKTVIFVNNSVKLLT−−−−−FNEDVIASVRGLVDSGVE−−−ILACGM−−−−−−−−−CLEFYGITDK−−−−−LAIGRISDAYTVADKLFKSDKLIRL 
fig|639282.3.peg.346   Deferribacter desulfuricans SSM1     VDARGKACPTPVIMTKKALESI