(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00009663

fig|1209359.3.peg.4659   Staphylococcus sp. MDS7B        EDKLEQVKGNIKETVGDATNNDNLEQEGKKDKASGKAKEVIDNVKDKASDVVDKFKK
fig|979208.3.peg.2074   Staphylococcus epidermidis NIHLM040        EDKLEQVKGNIKETVGDATNNDNLEQEGKKDKASGKAKEVIDNVKDKASDVVDKFKK
fig|525378.3.peg.136   Staphylococcus epidermidis M23864:W1        EDKLEQVKGNIKETVGDAANNDNLEQEGKKDKASGKAKEVIDNVKDKASDVVDKFKK
fig|525375.3.peg.2083   Staphylococcus epidermidis M23864:W2(grey)        EDKLDQVKGNIKETVGDATNNDNLEQEGKKDKASGKAKEVVDNVKDKASDVVDKFKK
fig|1209359.3.peg.2790   Staphylococcus sp. MDS7B        EDKFEQAKGNIKETVGNATDNKELEKDGKGDKASGKAKEAVENVKEKANDVIDKFK 
fig|525375.3.peg.1611   Staphylococcus epidermidis M23864:W2(grey)        EDKFEQAKGNIKETVGNATDNKELEKDGKGDKASGKAKEAVENVKEKANDVIDKFK 
fig|979208.3.peg.1254   Staphylococcus epidermidis NIHLM040        EDKFEQAKGNIKETVGNATDNKELEKDGKGDKASGKAKEAVENVKEKANDVIDKFK 
fig|1209359.3.peg.4295   Staphylococcus sp. MDS7B        EDKFEQAKGNIKETVGNATDNKDLEKEGQGDKASGKAKEVVDNVKDKANDVIDKLK 
fig|1134914.3.peg.1153   Staphylococcus haemolyticus R1P1        EDKFEQAKGNLKETVGNVTDNKDLEKEGQNDKASGKAKEAVENVKNKANDLIDKVK 
fig|525378.3.peg.2462   Staphylococcus epidermidis M23864:W1        EEKFEQAKGNIKETIGDATDNKDLKAEGKGDKASGKAKEVVDDVKDKANDLIDKVK 
fig|979208.3.peg.1442   Staphylococcus epidermidis NIHLM040        EEKFEQAKGNIKETIGDATDNKDLKAEGKGDKASGKAKEVVDDVKDKANDLIDKVK 
fig|1034809.4.peg.1973   Staphylococcus lugdunensis N920143     MAEDNKFEQAKGNVKETVGNVTDNKDLEKEGKEDKASGKVKETIDNVKDKAKDFVDNIK 
fig|1194526.3.peg.1831   Staphylococcus warneri SG1        EDKFEQAKGNVKETVGNVTDNENLEKEGKEDKASGKVKEAVNNVIDKVKG       
fig|396513.4.peg.1236   Staphylococcus carnosus subsp. carnosus TM300       EEDKLEQAKGNVKETVGNATDNKDLEKEGKADKTSGKMNEKIDEVADKAKGFTDKLK 
fig|1158495.3.peg.804   Staphylococcus aureus M1462     MADESKFEQAKGNVKETVGNVTDNKNLENEGKEDKASGKAKEFVENAKEKATDFIDKVK 
fig|585161.3.peg.580   Staphylococcus aureus subsp. aureus WW2703/97     MADESKFEQAKGNVKETVGNVTDNKNLENEGKEDKASGKAKEFVENAKEKATDFIDKVK 
fig|585148.3.peg.383   Staphylococcus aureus subsp. aureus Btn1260     MADESKFEQAKGNVKETVGNVTDNKNLENEGKEDKASGKAKEFVENAKEKATDFIDKVK 
fig|273036.6.peg.827   Staphylococcus aureus RF122     MADESKFEQAKGNVKETIGNVTDNKNLENEGKEDKASGKAKEFVENAKEKATDFIDKVK 
fig|525378.3.peg.825   Staphylococcus epidermidis M23864:W1     MADESKFEQAKGNIKETIGNATNNEELENEGQEDKTSGKAKEFVENAKDKANDFIDNLKK
fig|342451.11.peg.1133   Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305     MADENKFEQAKGNVKETVGNVTDNKELENEGKEDKTSGKAKEFVENAKDKANEVIDKFKK
fig|525378.3.peg.1276   Staphylococcus epidermidis M23864:W1     MAEDNKFEQAKGNIKETVGNATDNKDLEQEGKEDKTSGKAKEFVDNAKEKANDVIDKFK 
fig|435838.3.peg.417   Staphylococcus caprae C87     MAEDNKFEQAKGNIKETVGNATDNKNLEQEGKEDKTSGKAKEVVDNAKEKANDVIDKFK 
fig|342451.11.peg.1893   Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305     MADESKFEQVKGNVKETAGNVMDNKDLEQEGKEDKASGKAKEVTENAKDKVNDFIDKLKK
fig|273036.6.peg.1587   Staphylococcus aureus RF122     MADESKFDQFKGNVKETVGNVTDNKELE−−−−−−−−−−−−KEVVENAKNKITDAIDKLKK
fig|1158495.3.peg.1656   Staphylococcus aureus M1462     MADESKFDQFKGNVKETVGNVTDNKELEKEGQQDKVIGKAKEVVENAKNKITDAIDKLKK
fig|585161.3.peg.1347   Staphylococcus aureus subsp. aureus WW2703/97     MADESKFDQFKGNVKETVGNVTDNKELEKEGQQDKATGKAKEVVENAKNKITDAIDKLK 
fig|585148.3.peg.1210   Staphylococcus aureus subsp. aureus Btn1260     MADESKFDQFKGNVKETVGNVTDNKELEKEGQQDKATGKAKEVVENAKNKITDAIDKLKK
fig|458233.11.peg.339   Macrococcus caseolyticus JCSC5402     MTNEGKFEQLKGNVQETVGNATGNRELEQEGKESKISGKVKEVSENVQDKVNEALDKFKK
fig|318586.4.peg.3400   Paracoccus denitrificans PD1222        EGKWNQLKGSVKEKWGDFTDDELTEVAGKKDKLAGKLQEKYGWTKEKADEQINSFFK
fig|526999.3.peg.4389   Bacillus mycoides Rock3-17           FNTVQGEVKEVVGKVTDNKELQATGKWDKIKGTVKHTAGNVTEKVHE       
fig|1151121.3.peg.3746   Bacillus sp. 95MFCvi2.1           FNTVKGEVKEVVGKVTDNKELQATGKWDKIKGTVKHTVGNVTEKVHE       
fig|527000.3.peg.3501   Bacillus pseudomycoides DSM 12442           FNTVKGEVKEVVGKVTDNKELQATGKWDKIKGTVKHTVGNVTEKVHE       
fig|460265.11.peg.1793   Methylobacterium nodulans ORS 2060            EQAKGSLKEGVGNVLGDAKLQAEGKLDKAEGKAQSTVGGIKD           
fig|137722.3.peg.1354   Azospirillum sp. B510        EGAARSIKGSIKETVGKMTGDTKTEAEGRGEKAAGKVQNSIGGAKDAVRDAL     
fig|391165.9.peg.318   Granulibacter bethesdensis CGDNIH1              LKGKVKDAAGGLTGDTGLQAEGKLDQGISKAKQFAHDATDAVQDGVEHLR 
fig|391038.7.peg.4869   Burkholderia phymatum STM815        EGAVREAAGNVKETIGSIAGDVGMQLGGKADELRGKAQQVCADATDLARDAM     
fig|220664.3.peg.5166   Pseudomonas fluorescens Pf-5             EAIGNVKQGVGKATDNTKLQAEGKLQEKKGEAQQAVGKAKDAVKKTIDK   
fig|314260.3.peg.2067   Parvularcula bermudensis HTCC2503        KGKAKELQGKAKELAGDATDNDKLKAEGEVDQAEGKVRQAADDVKDAVS        
fig|266835.1.peg.1632   Mesorhizobium loti MAFF303099             EAVGKAKEGVGKAVGNDRLRAEGAAQEAKGKVQKAVGDAKSAVKDATNK   
fig|638301.3.peg.184   Granulicatella adiacens ATCC 49175     MSLEDKLQQATGAAKELAGKVTGDKSLESEGAVEKGLGKAKEVIDNVKESVEGAVEGIK
fig|370554.3.peg.1802   Streptococcus pyogenes MGAS10750       LKSKIEQASGGLKEGAGKLTGDKELEAKGFVEKTIAKGKELADDAKEAVEGAVDAVKE
fig|981539.3.peg.2050   Streptococcus gallolyticus subsp. gallolyticus ATCC 43143        DAKLDQIKGNLKEGFGKVTGDKKLETEGLAEKTIAKGKELASDVKESAEGAVEGVKK
fig|516950.3.peg.1581   Streptococcus pneumoniae CGSP14     MSLENKLEQATGAVKEGFGKVTGDSKTELEGAVEKTVAKAKDVVEDAKGAVEGAVEGLK
fig|760791.3.peg.1486   Streptococcus pneumoniae GA17570     MSLENKLEQATGAVKEGFGKVTGDSKTELEGAVEKTVAKAKDVVEDAKGAVEGAVEGLK
fig|406561.4.peg.1799   Streptococcus pneumoniae SP18-BS74     MSLENKLEQATGAVKEGFGKVTGDSKTELEGAVEKTVAKAKDVVEDAKGAVEGAVEGLK
fig|453364.8.peg.1091   Streptococcus pneumoniae CDC0288-04     MSLENKLEQATGAVKEGFGKVTGDSKTELEGAVEKTVAKAKDVVEDAKGAVEGLKNVFTK
fig|760808.3.peg.1482   Streptococcus pneumoniae GA41277     MSLENKLEQATGAVKEGFGKVTGDSKTELEGAVEKTVAKAKDVVEDAKGAVEGLKNVFTK
fig|488221.3.peg.1619   Streptococcus pneumoniae 70585     MSLENKLEQATGAVKEGFGKVTGDSKTELEGAVEKTVAKAKDVVENAKGAVEGAVEGLK
fig|760864.3.peg.1443   Streptococcus pneumoniae 4027-06     MSLENKLEQATGAVKEGFGKVTGDSKTELEGAVEKTVSKAKDVVEDAKGAVEGAVEGLK
fig|760854.3.peg.1534   Streptococcus pneumoniae GA49447     MSLENKLEQATGAVKEGFGKVTGDSKTELEGVVEKTVAKAKDVVEDAKGAVEGAVEGLK
fig|585202.3.peg.171   Streptococcus mitis SK321     MSLENKLEQATGAIKEGFGKVTGDGKTEAEGAVEKTVAKAKEVVEDAKGAVEGAVEGLK
fig|655813.3.peg.723   Streptococcus oralis ATCC 35037     MSLENKLDQATGAIKEGFGKVTGDSKTEAEGTVEKTVAKAKEVVEDAKGAVEGAVEGLK
fig|388919.8.peg.1545   Streptococcus sanguinis SK36     MSLENKFDQAKGAVKEGVGKVTGDNKTEAEGFVEKTVAKAKEVAEDAKGAVEGAVEGIK
fig|467705.9.peg.384   Streptococcus gordonii str. Challis substr. CH1     MSLEEKFNQAKGSVKEGVGKLTGDTKTQAEGVAEKVASKAKEVAEDAKEAVEGAIEGVK
fig|469609.3.peg.393   Streptococcus sp. 2_1_36FAA     MSLEEKFNQAKGSVKEGVGKLTGDTKTQAEGVAEKVASKAKEVAEDAKGAVEGAIEGVK
fig|760570.3.peg.1724   Streptococcus parasanguinis ATCC 15912     MSLEEKLNQAKGSVKEGFGKLTGDKKTEAEGTAEKVASKAKEVAEDAKEAVEGAIKGVK
fig|546270.5.peg.623   Gemella haemolysans ATCC 10379     MSLENKFDEIKGSVKEGLGKLTGDKSLEGEGLAEQVVSKVKEAAEDAKEAVEGVIDNVK
fig|546270.5.peg.618   Gemella haemolysans ATCC 10379     MSLENKFNQLKGSVKEGLGKLTGNEKLQAEGFTEKVVSKVKEAAEDAFDGVKNV      
fig|626369.3.peg.763   Granulicatella elegans ATCC 700633     MSAEEKLNQVAGSIKEGFGKLTGDKKLESEGATEQVVSKVKEVAEDAKEAVEGAIEGVK
fig|388919.8.peg.1907   Streptococcus sanguinis SK36     MSTEEKFNQAKGSVKEGLGKITGDKKTEKEGAAEKVVSKVKEVAEDAKDAIEGAIEGVK
fig|467705.9.peg.1802   Streptococcus gordonii str. Challis substr. CH1     MSTEEKFNQAKGSVKEGLGKLTGDKKTEKEGAAEKVVSKVKEVAEDAKDAVEGAIEGVK
fig|469609.3.peg.1860   Streptococcus sp. 2_1_36FAA     MSTEEKFNQAKGSVKEGLGKLTGDKKTEKEGAAEKVVSKVKEVAEDAKDAVEGAIEGVK
fig|638301.3.peg.1209   Granulicatella adiacens ATCC 49175     MSVEEKFNQAKGSVKEGLGKLTGDKKTEKEGAAEKVVSKVKEVAEDAKDAVEGAIEGVK
fig|322159.7.peg.1892   Streptococcus thermophilus LMD-9     MSVEEKLNQANGAIKEGVGKVTDDKKTEKEGAAEKGVSKVKEVAEDAKDAVKGAIEGVK
fig|264199.3.peg.1451   Streptococcus thermophilus LMG 18311     MSVEEKLNQANGAIKEGVGKVTDDKKTEKEGAAEKGVSKVREVAEDAKDAVKGAIEGVK
fig|471872.6.peg.461   Streptococcus infantarius subsp. infantarius ATCC BAA-102     MSVEEKFNQAKGTIKEGIGKVTDDKKTEKEGAAEKVVSKVKEVAEDTKEAVEGGIEGVK
fig|1200793.3.peg.667   Streptococcus salivarius K12     MSVEEKLNQAKGAFKEGVGKLTGDKKTEKEGAAEKAVSKVKEVAEDAKDAVEGAIEGVK
fig|1239792.3.peg.847   Streptococcus mitis 11/5     MSVEEKLNQAKGSIKEGVGKAIGDEKMEKEGTAEKVVSKVKEVAEDAKDAVEGAIEGVK
fig|246201.6.peg.386   Streptococcus mitis NCTC 12261     MSVEEKLNQAKGSIKEGVGKAIGDEKMEKEGTAEKVVSKVKEVAEDAKDAVEGAIEGVK
fig|655813.3.peg.870   Streptococcus oralis ATCC 35037     MSTEEKLNQAKGSIKEGVGKMIGDEKMEKEGTAEKVVSKVKEVAEDAKDAVEGAIEGVK
fig|453364.8.peg.1409   Streptococcus pneumoniae CDC0288-04     MSVEEKLNQAKGSIKEGVGKTIGDEKMEKEGAAEKVVSKVKEVAEDAKDAVEGAVEGVK
fig|585202.3.peg.1113   Streptococcus mitis SK321     MSVEEKLNQAKGSIKEGVGKAIGDEKMEKEGAAEKVVSKVKEVAEDAKDAVEGAVEGIK
fig|406561.4.peg.891   Streptococcus pneumoniae SP18-BS74     MSVEEKLNQAKGSIKEGVGKAIGDEKMEKEGAAEKVVSKVKEVAEDAKDAVEGAVEGVK
fig|488221.3.peg.1922   Streptococcus pneumoniae 70585     MSVEEKLNQAKGSIKEGVGKAIGDEKMEKEGAAEKVVSKVKEVAEDAKDAVEGAVEGVK
fig|516950.3.peg.1865   Streptococcus pneumoniae CGSP14     MSVEEKLNQAKGSIKEGVGKAIGDEKMEKEGAAEKVVSKVKEVAEDAKDAVEGAVEGVK
fig|760791.3.peg.1785   Streptococcus pneumoniae GA17570     MSVEEKLNQAKGSIKEGVGKAIGDEKMEKEGAAEKVVSKVKEVAEDAKDAVEGAVEGVK
fig|760808.3.peg.1810   Streptococcus pneumoniae GA41277     MSVEEKLNQAKGSIKEGVGKAIGDEKMEKEGAAEKVVSKVKEVAEDAKDAVEGAVEGVK
fig|760854.3.peg.1806   Streptococcus pneumoniae GA49447     MSVEEKLNQAKGSIKEGVGKAIGDEKMEKEGAAEKVVSKVKEVAEDAKDAVEGAVEGVK
fig|760864.3.peg.1720   Streptococcus pneumoniae 4027-06     MSVEEKLNQAKGSIKEGVGKAIGDEKMEKEGAAEKVVSKVKEVAEDAKDAVEGAVEGVK