(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00009626

fig|396513.4.peg.2285   Staphylococcus carnosus subsp. carnosus TM300            HGSGDKELPDTG−−−NDNKQAGLFGGLFAALGSALLFGRRKKDKK
fig|585159.3.peg.679   Staphylococcus aureus subsp. aureus M899      MSATKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|585158.3.peg.1064   Staphylococcus aureus subsp. aureus M876      MSATKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|585151.3.peg.182   Staphylococcus aureus subsp. aureus C427      MSATKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|585158.3.peg.1063   Staphylococcus aureus subsp. aureus M876      MSATKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|585153.3.peg.1122   Staphylococcus aureus subsp. aureus E1410      MSATKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|585158.3.peg.1062   Staphylococcus aureus subsp. aureus M876      MSATKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|585151.3.peg.181   Staphylococcus aureus subsp. aureus C427      MSATKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|1157028.3.peg.2658   Staphylococcus aureus M0408      MSATKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|1157028.3.peg.2660   Staphylococcus aureus M0408      MSATKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|585145.3.peg.1065   Staphylococcus aureus subsp. aureus 65-1322      MSATKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|585145.3.peg.1067   Staphylococcus aureus subsp. aureus 65-1322      MSATKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|585145.3.peg.1068   Staphylococcus aureus subsp. aureus 65-1322      MSATKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|585147.3.peg.117   Staphylococcus aureus subsp. aureus A017934/97      MSATKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|585147.3.peg.120   Staphylococcus aureus subsp. aureus A017934/97      MSATKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|585152.3.peg.480   Staphylococcus aureus subsp. aureus D139      MSATKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|585153.3.peg.1124   Staphylococcus aureus subsp. aureus E1410      MSATKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|585153.3.peg.1126   Staphylococcus aureus subsp. aureus E1410      MSATKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|585159.3.peg.677   Staphylococcus aureus subsp. aureus M899      MSATKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|585160.3.peg.85   Staphylococcus aureus subsp. aureus WBG10049      MSATKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|904728.3.peg.241   Staphylococcus aureus subsp. aureus 21195      MSATKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|904728.3.peg.2541   Staphylococcus aureus subsp. aureus 21195      MSATKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|904728.3.peg.400   Staphylococcus aureus subsp. aureus 21195      MSATKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|904786.3.peg.1359   Staphylococcus aureus subsp. aureus IS-160      MSATKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|904786.3.peg.2647   Staphylococcus aureus subsp. aureus IS-160      MSATKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|585147.3.peg.119   Staphylococcus aureus subsp. aureus A017934/97      MSATKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|904772.3.peg.1102   Staphylococcus aureus subsp. aureus 21342      MSATKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|585160.3.peg.86   Staphylococcus aureus subsp. aureus WBG10049      MSATKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|282458.4.peg.574   Staphylococcus aureus subsp. aureus MRSA252      MSATKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|585150.3.peg.1112   Staphylococcus aureus subsp. aureus C160      MSATKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|931452.3.peg.1069   Staphylococcus aureus subsp. aureus CIG1267      MSATKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|585159.3.peg.678   Staphylococcus aureus subsp. aureus M899      MSATKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|282458.4.peg.575   Staphylococcus aureus subsp. aureus MRSA252      MSATKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|585150.3.peg.1113   Staphylococcus aureus subsp. aureus C160      MSATKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|931452.3.peg.1070   Staphylococcus aureus subsp. aureus CIG1267      MSATKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|585160.3.peg.87   Staphylococcus aureus subsp. aureus WBG10049      MSATKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|450394.6.peg.1117   Staphylococcus aureus subsp. aureus USA300_TCH959      MSATKDHDNKAKALPETGNENSGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|681288.4.peg.515   Staphylococcus aureus subsp. aureus ED98      MSTTKGHHNKAKALPETGNENSGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|418127.6.peg.565   Staphylococcus aureus subsp. aureus Mu3      MSTTKDHHNKAKALPETGNENSGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|1157029.3.peg.476   Staphylococcus aureus M0427      MSTTKDHHNKAKALPETGNENSGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|1158482.3.peg.482   Staphylococcus aureus M1257      MSTTKDHHNKAKALPETGNENSGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|1158486.3.peg.84   Staphylococcus aureus M1320      MSTTKDHHNKAKALPETGNENSGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|1169274.3.peg.485   Staphylococcus aureus M1309      MSTTKDHHNKAKALPETGNENSGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|1213724.3.peg.487   Staphylococcus aureus M0673      MSTTKDHHNKAKALPETGNENSGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|553568.3.peg.2501   Staphylococcus aureus A6224      MSTTKDHHNKAKALPETGNENSGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|553571.3.peg.1345   Staphylococcus aureus A6300      MSTTKDHHNKAKALPETGNENSGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|889933.4.peg.496   Staphylococcus aureus subsp. aureus ECT-R 2      MSTTKDHHNKAKALPETGNENSGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|931439.3.peg.993   Staphylococcus aureus subsp. aureus CIG1750      MSTTKDHHNKAKALPETGNENSGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|1156999.3.peg.498   Staphylococcus aureus HI022      MSTTKDHHNKAKALPETGNENSGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|451515.3.peg.610   Staphylococcus aureus subsp. aureus USA300_FPR3757      MSTTKDHHNKAKALPETGNENSGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|93062.4.peg.1061   Staphylococcus aureus subsp. aureus COL      MSTTKDHHNKAKALPETGNENSGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|553567.3.peg.2201   Staphylococcus aureus A5948      MSTTKDHHNKAKALPETGNENSGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|196620.1.peg.517   Staphylococcus aureus subsp. aureus MW2      MSTTKDHHNKAKALPETGNENSGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|1157001.3.peg.1104   Staphylococcus aureus HI168      MSTTKDHHNKAKALPETGNENSGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|1157011.3.peg.1083   Staphylococcus aureus M0103      MSTTKDHHNKAKALPETGNENSGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|1157013.3.peg.1399   Staphylococcus aureus M0173      MSTTKDHHNKAKALPETGNENSGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|1158529.3.peg.701   Staphylococcus aureus M0396      MSTTKDHHNKAKALPETGNENSGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|455227.3.peg.2601   Staphylococcus aureus D30      MSTTKDHHNKAKALPETGNENSGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|548474.3.peg.1668   Staphylococcus aureus subsp. aureus TCH130      MSTTKDHHNKAKALPETGNENSGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|548475.3.peg.849   Staphylococcus aureus subsp. aureus TCH70      MSTTKDHHNKAKALPETGNENSGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|553565.3.peg.1300   Staphylococcus aureus A5937      MSTTKDHHNKAKALPETGNENSGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|553574.3.peg.2576   Staphylococcus aureus A8117      MSTTKDHHNKAKALPETGNENSGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|553590.4.peg.2860   Staphylococcus aureus A9754      MSTTKDHHNKAKALPETGNENSGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|553592.3.peg.2706   Staphylococcus aureus A9763      MSTTKDHHNKAKALPETGNENSGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|644279.4.peg.634   Staphylococcus aureus subsp. aureus 132      MSTTKDHHNKAKALPETGNENSGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|904744.3.peg.1191   Staphylococcus aureus subsp. aureus 21259      MSTTKDHHNKAKALPETGNENSGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|904795.7.peg.1466   Staphylococcus aureus subsp. aureus CO-23      MSTTKDHHNKAKALPETGNENSGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|282459.1.peg.515   Staphylococcus aureus subsp. aureus MSSA476      MSTTKDHHNKAKALPETGNENSGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|762962.3.peg.132   Staphylococcus aureus subsp. aureus ATCC 51811      MSTTKDHHNKAKALPETGNENSGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|426430.8.peg.572   Staphylococcus aureus subsp. aureus str. Newman      MSTTKDHHNKAKALPETGNENSGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|904754.3.peg.336   Staphylococcus aureus subsp. aureus 21283      MSTTKDHHNKAKALPETGNENSGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|93062.19.peg.592   Staphylococcus aureus subsp. aureus COL      MSTTKDHHNKAKALPETGNENSGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|1169277.3.peg.487   Staphylococcus aureus M1510      MSTTKDHHNKAKALPETGNENSGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|158879.1.peg.534   Staphylococcus aureus subsp. aureus N315      MSTTKDHHNKAKALPETGNENSGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|553581.3.peg.1498   Staphylococcus aureus A9299      MSTTKDHHNKAKALPETGNENSGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|904750.3.peg.96   Staphylococcus aureus subsp. aureus 21272      MSTTKDHHNKAKALPETGNENSGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|359787.11.peg.627   Staphylococcus aureus subsp. aureus JH1      MSTTKDHHNKAKALPETGNENSGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|1169277.3.peg.488   Staphylococcus aureus M1510      MSTTKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|158879.1.peg.535   Staphylococcus aureus subsp. aureus N315      MSTTKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|553571.3.peg.1344   Staphylococcus aureus A6300      MSTTKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|553581.3.peg.1497   Staphylococcus aureus A9299      MSTTKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|681288.4.peg.516   Staphylococcus aureus subsp. aureus ED98      MSTTKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|93062.19.peg.593   Staphylococcus aureus subsp. aureus COL      MSTTKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|93062.4.peg.1062   Staphylococcus aureus subsp. aureus COL      MSTTKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|1156999.3.peg.499   Staphylococcus aureus HI022      MSTTKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|1157001.3.peg.1105   Staphylococcus aureus HI168      MSTTKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|451515.3.peg.611   Staphylococcus aureus subsp. aureus USA300_FPR3757      MSTTKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|1028799.3.peg.480   Staphylococcus aureus subsp. aureus VC40      MSTTKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|93061.5.peg.491   Staphylococcus aureus subsp. aureus NCTC 8325      MSTTKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|1137133.3.peg.2208   Staphylococcus aureus subsp. aureus MRGR3      MSTTKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|1137133.3.peg.450   Staphylococcus aureus subsp. aureus MRGR3      MSTTKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|1158477.3.peg.45   Staphylococcus aureus M1216      MSTTKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|1158477.3.peg.46   Staphylococcus aureus M1216      MSTTKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|1158482.3.peg.483   Staphylococcus aureus M1257      MSTTKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|1158529.3.peg.702   Staphylococcus aureus M0396      MSTTKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|450394.6.peg.1118   Staphylococcus aureus subsp. aureus USA300_TCH959      MSTTKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|455227.3.peg.1692   Staphylococcus aureus D30      MSTTKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|548474.3.peg.1666   Staphylococcus aureus subsp. aureus TCH130      MSTTKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|548475.3.peg.850   Staphylococcus aureus subsp. aureus TCH70      MSTTKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|553565.3.peg.1821   Staphylococcus aureus A5937      MSTTKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|553567.3.peg.478   Staphylococcus aureus A5948      MSTTKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|553568.3.peg.2366   Staphylococcus aureus A6224      MSTTKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|553574.3.peg.2307   Staphylococcus aureus A8117      MSTTKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|553583.3.peg.1503   Staphylococcus aureus A9635      MSTTKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|553590.4.peg.1274   Staphylococcus aureus A9754      MSTTKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|553592.3.peg.757   Staphylococcus aureus A9763      MSTTKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|553594.3.peg.2171   Staphylococcus aureus A9765      MSTTKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|585152.3.peg.479   Staphylococcus aureus subsp. aureus D139      MSTTKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|644279.4.peg.637   Staphylococcus aureus subsp. aureus 132      MSTTKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|904731.3.peg.2608   Staphylococcus aureus subsp. aureus 21201      MSTTKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|904754.3.peg.957   Staphylococcus aureus subsp. aureus 21283      MSTTKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|904795.7.peg.1123   Staphylococcus aureus subsp. aureus CO-23      MSTTKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|904795.7.peg.340   Staphylococcus aureus subsp. aureus CO-23      MSTTKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|585155.3.peg.1106   Staphylococcus aureus subsp. aureus H19      MSTTKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|273036.6.peg.558   Staphylococcus aureus RF122      MSTTKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|426430.8.peg.573   Staphylococcus aureus subsp. aureus str. Newman      MSTTKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|196620.1.peg.518   Staphylococcus aureus subsp. aureus MW2      MSTTKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|282459.1.peg.516   Staphylococcus aureus subsp. aureus MSSA476      MSTTKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|762962.3.peg.131   Staphylococcus aureus subsp. aureus ATCC 51811      MSTTKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|1157029.3.peg.477   Staphylococcus aureus M0427      MSTTKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|1158486.3.peg.85   Staphylococcus aureus M1320      MSTTKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|1157011.3.peg.1086   Staphylococcus aureus M0103      MSTTKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|1157013.3.peg.1400   Staphylococcus aureus M0173      MSTTKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|889933.4.peg.497   Staphylococcus aureus subsp. aureus ECT-R 2      MSTTKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|931439.3.peg.994   Staphylococcus aureus subsp. aureus CIG1750      MSTTKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|359787.11.peg.628   Staphylococcus aureus subsp. aureus JH1      MSTTKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|418127.6.peg.566   Staphylococcus aureus subsp. aureus Mu3      MSTTKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|273036.6.peg.557   Staphylococcus aureus RF122      MSTTKDHHNKAKALPETGSENNVSNNATLFGGLFAALGSLLLFGRRKKQNK
fig|450394.6.peg.2320   Staphylococcus aureus subsp. aureus USA300_TCH959      MSVTKDHHNKAKALPETGSGNDESNNGTLFGGLFAALGSLLLFGRRKKQNK
fig|553590.4.peg.1801   Staphylococcus aureus A9754      MSTVKDQHKTAKALPETGSENNNSNNGTLFGGLFAALGSLLLFGRRKKQNK
fig|1156999.3.peg.497   Staphylococcus aureus HI022      MSTVKDQHKTAKALPETGSENNNSNNGTLFGGLFAALGSLLLFGRRKKQNK
fig|451515.3.peg.609   Staphylococcus aureus subsp. aureus USA300_FPR3757      MSTVKDQHKTAKALPETGSENNNSNNGTLFGGLFAALGSLLLFGRRKKQNK
fig|553567.3.peg.2202   Staphylococcus aureus A5948      MSTVKDQHKTAKALPETGSENNNSNNGTLFGGLFAALGSLLLFGRRKKQNK
fig|93062.19.peg.591   Staphylococcus aureus subsp. aureus COL      MSTVKDQHKTAKALPETGSENNNSNNGTLFGGLFAALGSLLLFGRRKKQNK
fig|93062.4.peg.1060   Staphylococcus aureus subsp. aureus COL      MSTVKDQHKTAKALPETGSENNNSNNGTLFGGLFAALGSLLLFGRRKKQNK
fig|762962.3.peg.133   Staphylococcus aureus subsp. aureus ATCC 51811      MSTVKDQHKTAKALPETGSENNNSNNGTLFGGLFAALGSLLLFGRRKKQNK
fig|158879.1.peg.533   Staphylococcus aureus subsp. aureus N315      MSTVKDQHKTAKALPETGSENNNSNNGTLFGGLFAALGSLLLFGRRKKQNK
fig|418127.6.peg.564   Staphylococcus aureus subsp. aureus Mu3      MSTVKDQHKTAKALPETGSENNNSNNGTLFGGLFAALGSLLLFGRRKKQNK
fig|553571.3.peg.1346   Staphylococcus aureus A6300      MSTVKDQHKTAKALPETGSENNNSNNGTLFGGLFAALGSLLLFGRRKKQNK
fig|1137133.3.peg.1239   Staphylococcus aureus subsp. aureus MRGR3      MSTVKDQHKTAKALPETGSENNNSNNGTLFGGLFAALGSLLLFGRRKKQNK
fig|1157013.3.peg.1397   Staphylococcus aureus M0173      MSTVKDQHKTAKALPETGSENNNSNNGTLFGGLFAALGSLLLFGRRKKQNK
fig|1158477.3.peg.44   Staphylococcus aureus M1216      MSTVKDQHKTAKALPETGSENNNSNNGTLFGGLFAALGSLLLFGRRKKQNK
fig|1158482.3.peg.481   Staphylococcus aureus M1257      MSTVKDQHKTAKALPETGSENNNSNNGTLFGGLFAALGSLLLFGRRKKQNK
fig|455227.3.peg.2595   Staphylococcus aureus D30      MSTVKDQHKTAKALPETGSENNNSNNGTLFGGLFAALGSLLLFGRRKKQNK
fig|548474.3.peg.2128   Staphylococcus aureus subsp. aureus TCH130      MSTVKDQHKTAKALPETGSENNNSNNGTLFGGLFAALGSLLLFGRRKKQNK
fig|548475.3.peg.591   Staphylococcus aureus subsp. aureus TCH70      MSTVKDQHKTAKALPETGSENNNSNNGTLFGGLFAALGSLLLFGRRKKQNK
fig|553565.3.peg.195   Staphylococcus aureus A5937      MSTVKDQHKTAKALPETGSENNNSNNGTLFGGLFAALGSLLLFGRRKKQNK
fig|553568.3.peg.2500   Staphylococcus aureus A6224      MSTVKDQHKTAKALPETGSENNNSNNGTLFGGLFAALGSLLLFGRRKKQNK
fig|553574.3.peg.2571   Staphylococcus aureus A8117      MSTVKDQHKTAKALPETGSENNNSNNGTLFGGLFAALGSLLLFGRRKKQNK
fig|553581.3.peg.1499   Staphylococcus aureus A9299      MSTVKDQHKTAKALPETGSENNNSNNGTLFGGLFAALGSLLLFGRRKKQNK
fig|553592.3.peg.2421   Staphylococcus aureus A9763      MSTVKDQHKTAKALPETGSENNNSNNGTLFGGLFAALGSLLLFGRRKKQNK
fig|644279.4.peg.636   Staphylococcus aureus subsp. aureus 132      MSTVKDQHKTAKALPETGSENNNSNNGTLFGGLFAALGSLLLFGRRKKQNK
fig|904795.7.peg.1573   Staphylococcus aureus subsp. aureus CO-23      MSTVKDQHKTAKALPETGSENNNSNNGTLFGGLFAALGSLLLFGRRKKQNK
fig|681288.4.peg.514   Staphylococcus aureus subsp. aureus ED98      MSTVKDQHKTAKALPETGSENNNSNNGTLFGGLFAALGSLLLFGRRKKQNK
fig|1157011.3.peg.1082   Staphylococcus aureus M0103      MSTVKDQHKTAKALPETGSENNNSNNGTLFGGLFAALGSLLLFGRRKKQNK
fig|1157029.3.peg.475   Staphylococcus aureus M0427      MSTVKDQHKTAKALPETGSENNNSNNGTLFGGLFAALGSLLLFGRRKKQNK
fig|1158486.3.peg.83   Staphylococcus aureus M1320      MSTVKDQHKTAKALPETGSENNNSNNGTLFGGLFAALGSLLLFGRRKKQNK
fig|1169274.3.peg.484   Staphylococcus aureus M1309      MSTVKDQHKTAKALPETGSENNNSNNGTLFGGLFAALGSLLLFGRRKKQNK
fig|1213724.3.peg.486   Staphylococcus aureus M0673      MSTVKDQHKTAKALPETGSENNNSNNGTLFGGLFAALGSLLLFGRRKKQNK
fig|359787.11.peg.626   Staphylococcus aureus subsp. aureus JH1      MSTVKDQHKTAKALPETGSENNNSNNGTLFGGLFAALGSLLLFGRRKKQNK
fig|931439.3.peg.992   Staphylococcus aureus subsp. aureus CIG1750      MSTVKDQHKTAKALPETGSENNNSNNGTLFGGLFAALGSLLLFGRRKKQNK
fig|196620.1.peg.516   Staphylococcus aureus subsp. aureus MW2      MSTVKDQHKTAKALPETGSENNNSNNGTLFGGLFAALGSLLLFGRRKKQNK
fig|282459.1.peg.514   Staphylococcus aureus subsp. aureus MSSA476      MSTVKDQHKTAKALPETGSENNNSNNGTLFGGLFAALGSLLLFGRRKKQNK
fig|1028799.3.peg.479   Staphylococcus aureus subsp. aureus VC40      MSTVKDQHKTAKALPETGSENNNSNNGTLFGGLFAALGSLLLFGRRKKQNK
fig|93061.5.peg.490   Staphylococcus aureus subsp. aureus NCTC 8325      MSTVKDQHKTAKALPETGSENNNSNNGTLFGGLFAALGSLLLFGRRKKQNK
fig|426430.8.peg.571   Staphylococcus aureus subsp. aureus str. Newman      MSTVKDQHKTAKALPETGSENNNSNNGTLFGGLFAALGSLLLFGRRKKQNK
fig|904754.3.peg.335   Staphylococcus aureus subsp. aureus 21283      MSTVKDQHKTAKALPETGSENNNSNNGTLFGGLFAALGSLLLFGRRKKQNK
fig|553594.3.peg.2801   Staphylococcus aureus A9765      MSTVKDQHKTAKALPETGSENNNSNNGTLFGGLFAALGSLLLFGRRKKQNK
fig|546342.4.peg.594   Staphylococcus aureus subsp. aureus str. JKD6008      MSTVKDQHKTAKALPETGSENNNSNNGTFFGGLFAALGSLLLFGRRKKQNK
fig|553583.3.peg.313   Staphylococcus aureus A9635      MSAVKDHNNKAKALPETGTENNNSNNGTLFGGLFAALGSLLLFGRRKKQNK
fig|904730.3.peg.1141   Staphylococcus aureus subsp. aureus 21200      MSAVKDHNNKAKALPETGTENNNSNNGTLFGGLFAALGSLLLFGRRKKQNK
fig|1158529.3.peg.700   Staphylococcus aureus M0396      MSTVKDHHNKAKALPETGSENNNSNNGTLFGGLFAALGSLLLFGRRKKQNK
fig|450394.6.peg.735   Staphylococcus aureus subsp. aureus USA300_TCH959      MSTVKDHHNKAKALPETGSENNNSNNGTLFGGLFAALGSLLLFGRRKKQNK
fig|279808.8.peg.2615   Staphylococcus haemolyticus JCSC1435            QLNQPKHLPNTGSDDANINKSLLATMFASLGSVLLFGRRRRDGQ
fig|525378.3.peg.1852   Staphylococcus epidermidis M23864:W1               KVASLPDTGISDKNNDKTLFATVFTVLGSLILLGRRRRKSK
fig|1157011.3.peg.332   Staphylococcus aureus M0103         TKQKQSKKSELPETGGEESTNKGMLFGGLFSILGLVLL−−RRNKKNNK
fig|1157013.3.peg.661   Staphylococcus aureus M0173         TKQKQSKKSELPETGGEESTNKGMLFGGLFSILGLVLL−−RRNKKNNK
fig|1157029.3.peg.2360   Staphylococcus aureus M0427         TKQKQSKKSELPETGGEESTNKGMLFGGLFSILGLVLL−−RRNKKNNK
fig|1158482.3.peg.2364   Staphylococcus aureus M1257         TKQKQSKKSELPETGGEESTNKGMLFGGLFSILGLVLL−−RRNKKNNK
fig|1158486.3.peg.2008   Staphylococcus aureus M1320         TKQKQSKKSELPETGGEESTNKGMLFGGLFSILGLVLL−−RRNKKNNK
fig|1169274.3.peg.2453   Staphylococcus aureus M1309         TKQKQSKKSELPETGGEESTNKGMLFGGLFSILGLVLL−−RRNKKNNK
fig|1169277.3.peg.2490   Staphylococcus aureus M1510         TKQKQSKKSELPETGGEESTNKGMLFGGLFSILGLVLL−−RRNKKNNK
fig|1213724.3.peg.2433   Staphylococcus aureus M0673         TKQKQSKKSELPETGGEESTNKGMLFGGLFSILGLVLL−−RRNKKNNK
fig|359787.11.peg.2628   Staphylococcus aureus subsp. aureus JH1         TKQKQSKKSELPETGGEESTNKGMLFGGLFSILGLVLL−−RRNKKNNK
fig|418127.6.peg.2550   Staphylococcus aureus subsp. aureus Mu3         TKQKQSKKSELPETGGEESTNKGMLFGGLFSILGLVLL−−RRNKKNNK
fig|553574.3.peg.2205   Staphylococcus aureus A8117         TKQKQSKKSELPETGGEESTNKGMLFGGLFSILGLVLL−−RRNKKNNK
fig|553592.3.peg.496   Staphylococcus aureus A9763         TKQKQSKKSELPETGGEESTNKGMLFGGLFSILGLVLL−−RRNKKNNK
fig|889933.4.peg.2279   Staphylococcus aureus subsp. aureus ECT-R 2         TKQKQSKKSELPETGGEESTNKGMLFGGLFSILGLVLL−−RRNKKNNK
fig|904731.3.peg.1299   Staphylococcus aureus subsp. aureus 21201         TKQKQSKKSELPETGGEESTNKGMLFGGLFSILGLVLL−−RRNKKNNK
fig|904750.3.peg.496   Staphylococcus aureus subsp. aureus 21272         TKQKQSKKSELPETGGEESTNKGMLFGGLFSILGLVLL−−RRNKKNNK
fig|931439.3.peg.346   Staphylococcus aureus subsp. aureus CIG1750         TKQKQSKKSELPETGGEESTNKGMLFGGLFSILGLVLL−−RRNKKNNK
fig|681288.4.peg.2531   Staphylococcus aureus subsp. aureus ED98         TKQKQSKKSELPETGGEESTNKGMLFGGLFSILGLVLL−−RRNKKNNK
fig|553571.3.peg.576   Staphylococcus aureus A6300         TKQKQSKKSELPETGGEESTNKGMLFGGLFSILGLVLL−−RRNKKNNK
fig|158879.1.peg.2375   Staphylococcus aureus subsp. aureus N315         TKQKQSKKSELPETGGEESTNKGMLFGGLFSILGLVLL−−RRNKKNNK
fig|553565.3.peg.468   Staphylococcus aureus A5937         TKQKQSKKSELPETGGEESTNKGMLFGGLFSILGLVLL−−RRNKKNNK
fig|553568.3.peg.1406   Staphylococcus aureus A6224         TKQKQSKKSELPETGGEESTNKGMLFGGLFSILGLVLL−−RRNKKNNK
fig|553583.3.peg.2508   Staphylococcus aureus A9635         TKQKQSKKSELPETGGEESTNKGMLFGGLFSILGLTLL−−RRNKKNNK
fig|1028799.3.peg.2258   Staphylococcus aureus subsp. aureus VC40         TKKAQSKKSELPETGGEESTNNGMLFGGLFSILGLALL−−RRNKKN  
fig|1156999.3.peg.2427   Staphylococcus aureus HI022         TKKAQSKKSELPETGGEESTNNGMLFGGLFSILGLALL−−RRNKKN  
fig|451515.3.peg.2610   Staphylococcus aureus subsp. aureus USA300_FPR3757         TKKAQSKKSELPETGGEESTNNGMLFGGLFSILGLALL−−RRNKKN  
fig|546342.4.peg.2671   Staphylococcus aureus subsp. aureus str. JKD6008         TKKAQSKKSELPETGGEESTNNGMLFGGLFSILGLALL−−RRNKKN  
fig|553567.3.peg.2740   Staphylococcus aureus A5948         TKKAQSKKSELPETGGEESTNNGMLFGGLFSILGLALL−−RRNKKN  
fig|904795.7.peg.682   Staphylococcus aureus subsp. aureus CO-23         TKKAQSKKSELPETGGEESTNNGMLFGGLFSILGLALL−−RRNKKN  
fig|93061.5.peg.2534   Staphylococcus aureus subsp. aureus NCTC 8325         TKKAQSKKSELPETGGEESTNNGMLFGGLFSILGLALL−−RRNKKN  
fig|93062.19.peg.2444   Staphylococcus aureus subsp. aureus COL         TKKAQSKKSELPETGGEESTNNGMLFGGLFSILGLALL−−RRNKKN  
fig|93062.4.peg.2559   Staphylococcus aureus subsp. aureus COL         TKKAQSKKSELPETGGEESTNNGMLFGGLFSILGLALL−−RRNKKN  
fig|426430.8.peg.2604   Staphylococcus aureus subsp. aureus str. Newman         TKKAQSKKSELPETGGEESTNNGMLFGGLFSILGLALL−−RRNKKN  
fig|426430.8.peg.2606   Staphylococcus aureus subsp. aureus str. Newman         TKKAQSKKSELPETGGEESTNNGMLFGGLFSILGLALL−−RRNKKN  
fig|553590.4.peg.2838   Staphylococcus aureus A9754         TKKAQSKKSELPETGGEESTNNGMLFGGLFSILGLALL−−RRNKKN  
fig|1157001.3.peg.335   Staphylococcus aureus HI168         TKKAQSKKSELPETGGEESTNNGMLFGGLFSILGLALL−−RRNKKN  
fig|904754.3.peg.1130   Staphylococcus aureus subsp. aureus 21283         TKKAQSKKSELPETGGEESTNNGMLFGGLFSILGLALL−−RRNKKN  
fig|644279.4.peg.2647   Staphylococcus aureus subsp. aureus 132         TKKAQSKKSELPETGGEESTNNGMLFGGLFSILGLALL−−RRNKKN  
fig|553594.3.peg.1493   Staphylococcus aureus A9765         TKKAQSKKSELPETGGEESTNNGMLFGGLFSILGLALL−−RRNKKN  
fig|176279.9.peg.2323   Staphylococcus epidermidis RP62A                 KDLPQTG−−EENFNKSTLFGTLVASLGALLLFFKRRKKDE
fig|525375.3.peg.1088   Staphylococcus epidermidis M23864:W2(grey)                 KDLPQTG−−EENFNKSTLFGTLVASLGALLLFFKRRKKDE
fig|279808.8.peg.2383   Staphylococcus haemolyticus JCSC1435     KDHNDKADKPNNKELPDTG−−NDAQNNATLFGSLFAALGGLFLVGRRRK    
fig|93062.19.peg.49   Staphylococcus aureus subsp. aureus COL         DKTDKPNNKELPDTG−−NDAQNNGTLFGSLFAALGGLFLVGRRRK    
fig|93062.4.peg.66   Staphylococcus aureus subsp. aureus COL         DKTDKPNNKELPDTG−−NDAQNNGTLFGSLFAALGGLFLVGRRRK    
fig|904334.3.peg.805   Staphylococcus epidermidis VCU116        NLVMEQHHKQELPDTG−−YDVANNGTLFGGILAALGSLLLVGSKRRSKK
fig|176279.9.peg.2329   Staphylococcus epidermidis RP62A              DNKNQLPDTGENRQANEGTLVGSLLAIVGSLFIFGRRKKGNE
fig|525375.3.peg.1094   Staphylococcus epidermidis M23864:W2(grey)              DNKNQLPDTGENRQANEGTLVGSLLAIVGSLFIFGRRKKGNE
fig|176280.1.peg.175   Staphylococcus epidermidis ATCC 12228              DNKNQLPDTGENRQANEGTLVGSLLAIVGSLFIFGRRKKGNE
fig|596317.3.peg.2209   Staphylococcus epidermidis SK135              DNKNQLPDTGENRQANEGTLVGSLLAIVGSLFIFGRRKKGNE
fig|396513.4.peg.1999   Staphylococcus carnosus subsp. carnosus TM300              NEAEALPETGETDNVPTASLFGTLFAVLGSIFLFWRRRKEE  
fig|525376.3.peg.37   Staphylococcus epidermidis W23144         VDKDHSDKEALPQTGEQSNSNNATLFGSLFAGLGSLFLFGRRRKKD  
fig|585159.3.peg.107   Staphylococcus aureus subsp. aureus M899     NHSNKASKQHQTDALPETGDKSENTNATLFDAMVALLGSLLLFRKRKQDHK
fig|546342.4.peg.2832   Staphylococcus aureus subsp. aureus str. JKD6008     NHSNKASKQHQTDALPETGDKSENTNATLFDAMVALLGSLLLFRKRKQDHK
fig|585145.3.peg.909   Staphylococcus aureus subsp. aureus 65-1322     NHSNKASKQHQTDALPETGDKSENTNATLFDAMVALLGSLLLFRKRKQDHK
fig|585160.3.peg.2457   Staphylococcus aureus subsp. aureus WBG10049     NHSNKASKQHQTDALPETGDKSENTNATLFDAMVALLGSLLLFRKRKQDHK
fig|585153.3.peg.913   Staphylococcus aureus subsp. aureus E1410     NHSNKASKQHQTDALPETGDKSENTNATLFDAMVALLGSLLLFRKRKQDHK
fig|585158.3.peg.688   Staphylococcus aureus subsp. aureus M876     NHSNKASKQHQTDALPETGDKSENTNATLFDAMVALLGSLLLFRKRKQDHK
fig|585147.3.peg.2262   Staphylococcus aureus subsp. aureus A017934/97     NHSNKASKQHQTDALPETGDKSENTNATLFDAMVALLGSLLLFRKRKQDHK
fig|282458.4.peg.2744   Staphylococcus aureus subsp. aureus MRSA252     NHSNKASKQHQTDALPETGDKSENTNATLFDAMVALLGSLLLFRKRKQDHK
fig|931452.3.peg.459   Staphylococcus aureus subsp. aureus CIG1267     NHSNKASKQHQTDALPETGDKSENTNATLFDAMVALLGSLLLFRKRKQDHK
fig|585151.3.peg.2626   Staphylococcus aureus subsp. aureus C427     NHSNKASKQHQTDALPETGDKSENTNATLFGAMMALLGSLLLFRKRKQDHK
fig|585152.3.peg.2629   Staphylococcus aureus subsp. aureus D139     NHSNKASKQHQTDALPETGDKSENTNATLFGAMMALLGSLLLFRKRKQDHK
fig|585155.3.peg.184   Staphylococcus aureus subsp. aureus H19     NHSNKASKQHQTDALPETGDKSENTNATLFGAMMALLGSLLLFRKRKQDHK
fig|455227.3.peg.2614   Staphylococcus aureus D30               KTDALPETGDKSENTNATLFGAMMALLGSLLLFRKRKQDHK
fig|548474.3.peg.241   Staphylococcus aureus subsp. aureus TCH130               KTDALPETGDKSENTNATLFGAMMALLGSLLLFRKRKQDHK
fig|644279.4.peg.118   Staphylococcus aureus subsp. aureus 132               KTDALPETGDKSENTNATLFGAMMALLGSLLLFRKRKQDHK
fig|553592.3.peg.2707   Staphylococcus aureus A9763               KTDALPETGDKSENTNATLFGAMMALLGSLLLFRKRKQDHK
fig|548475.3.peg.1536   Staphylococcus aureus subsp. aureus TCH70               KTDALPETGDKSENTNATLFGAMMALLGSLLLFRKRKQDHK
fig|196620.1.peg.2551   Staphylococcus aureus subsp. aureus MW2          VSKQHKTDALPETGDKSENTNATLFGAMMALLGSLLLFRKRKQDHK
fig|1156999.3.peg.2560   Staphylococcus aureus HI022          VSKQHKTDALPETGDKSENTNATLFGAMMALLGSLLLFRKRKQDHK
fig|1157001.3.peg.468   Staphylococcus aureus HI168          VSKQHKTDALPETGDKSENTNATLFGAMMALLGSLLLFRKRKQDHK
fig|451515.3.peg.2745   Staphylococcus aureus subsp. aureus USA300_FPR3757          VSKQHKTDALPETGDKSENTNATLFGAMMALLGSLLLFRKRKQDHK
fig|1157011.3.peg.461   Staphylococcus aureus M0103          VSKQHKTDALPETGDKSENTNATLFGAMMALLGSLLLFRKRKQDHK
fig|1157013.3.peg.790   Staphylococcus aureus M0173          VSKQHKTDALPETGDKSENTNATLFGAMMALLGSLLLFRKRKQDHK
fig|1157029.3.peg.2490   Staphylococcus aureus M0427          VSKQHKTDALPETGDKSENTNATLFGAMMALLGSLLLFRKRKQDHK
fig|1158482.3.peg.2496   Staphylococcus aureus M1257          VSKQHKTDALPETGDKSENTNATLFGAMMALLGSLLLFRKRKQDHK
fig|1158486.3.peg.2139   Staphylococcus aureus M1320          VSKQHKTDALPETGDKSENTNATLFGAMMALLGSLLLFRKRKQDHK
fig|1213724.3.peg.2562   Staphylococcus aureus M0673          VSKQHKTDALPETGDKSENTNATLFGAMMALLGSLLLFRKRKQDHK
fig|158879.1.peg.2510   Staphylococcus aureus subsp. aureus N315          VSKQHKTDALPETGDKSENTNATLFGAMMALLGSLLLFRKRKQDHK
fig|359787.11.peg.2761   Staphylococcus aureus subsp. aureus JH1          VSKQHKTDALPETGDKSENTNATLFGAMMALLGSLLLFRKRKQDHK
fig|418127.6.peg.2682   Staphylococcus aureus subsp. aureus Mu3          VSKQHKTDALPETGDKSENTNATLFGAMMALLGSLLLFRKRKQDHK
fig|553565.3.peg.1059   Staphylococcus aureus A5937          VSKQHKTDALPETGDKSENTNATLFGAMMALLGSLLLFRKRKQDHK
fig|553571.3.peg.1165   Staphylococcus aureus A6300          VSKQHKTDALPETGDKSENTNATLFGAMMALLGSLLLFRKRKQDHK
fig|681288.4.peg.2664   Staphylococcus aureus subsp. aureus ED98          VSKQHKTDALPETGDKSENTNATLFGAMMALLGSLLLFRKRKQDHK
fig|931439.3.peg.476   Staphylococcus aureus subsp. aureus CIG1750          VSKQHKTDALPETGDKSENTNATLFGAMMALLGSLLLFRKRKQDHK
fig|553568.3.peg.1522   Staphylococcus aureus A6224          VSKQHKTDALPETGDKSENTNATLFGAMMALLGSLLLFRKRKQDHK
fig|1028799.3.peg.2393   Staphylococcus aureus subsp. aureus VC40          VSKQHKTDALPETGDKSENTNATLFGAMMALLGSLLLFRKRKQDHK
fig|93061.5.peg.2673   Staphylococcus aureus subsp. aureus NCTC 8325          VSKQHKTDALPETGDKSENTNATLFGAMMALLGSLLLFRKRKQDHK
fig|426430.8.peg.2742   Staphylococcus aureus subsp. aureus str. Newman          VSKQHKTDALPETGDKSENTNATLFGAMMALLGSLLLFRKRKQDHK
fig|93062.19.peg.2578   Staphylococcus aureus subsp. aureus COL          VSKQHKTDALPETGDKSENTNATLFGAMMALLGSLLLFRKRKQDHK
fig|93062.4.peg.2083   Staphylococcus aureus subsp. aureus COL          VSKQHKTDALPETGDKSENTNATLFGAMMALLGSLLLFRKRKQDHK
fig|273036.6.peg.2638   Staphylococcus aureus RF122          VSKQHKTDALPETGDKSENTNATLFGAMMALLGSLLLFRKRKQDHK
fig|282459.1.peg.2496   Staphylococcus aureus subsp. aureus MSSA476          VSKQHKTDALPETGDKSENTNATLFGAMMALLGSLLLFRKRKQDHK
fig|553574.3.peg.1529   Staphylococcus aureus A8117          VSKQHKTDALPETGDKSENTNATLFGAMMALLGSLLLFRKRKQDHK