(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00009583

fig|450394.6.peg.100   Staphylococcus aureus subsp. aureus USA300_TCH959       TASEVVEWAK−−SNIGKRINIDNYRGSQCWDTPNFIFKRYW−−GFVTWGNAKDMAN−−−YR−−YPKGFRFYRYSSGFVPEPGDIAVWHPGNGIGSDGHTAIVVGPSNKSYFYSVDQNWVNSNSWT−−−−−−−−−GSPGSLVRHPY−−−−VSVTGFVRPPYSKD−−−TS−−KPSSTDTSSASKANDSTIT−−−GEAKKPQFKEVKTVKYTA                                                                             
fig|505321.3.peg.2   Staphylococcus aureus subsp. aureus str. CF-Marseille       TASEVVEWAK−−SNIGKRINIDNYRGSQCWDTPNFIFKRYW−−GFVTWGNAKDMAN−−−YR−−YPKGFRFYRYSSGFVPEPGDIAVWHPGNGIGSDGHTAIVVGPSNKSYFYSVDQNWVNSNSWT−−−−−−−−−GSPGSLVRHPY−−−−VSVTGFVRPPYSKD−−−TS−−KPSSTDTSSASKANDSTIT−−−GEAKKPQFKEVKTVKYTA                                                                             
fig|1158692.3.peg.38   Staphylococcus aureus M0687       TASEVVEWAK−−SNIGKRINIDNYRGSQCWDTPNFIFKRYW−−GFVTWGNAKDMAN−−−YR−−YPKGFRFYRYSSGFVPEPGDIAVWHPGNGIGSDGHTAIVVGPSNKSYFYSVDQNWVNSNSWT−−−−−−−−−GSPGSLVRHPY−−−−VSVTGFVRPPYSKD−−−TS−−KPSSTDTSSASKANDSTIT−−−GEAKKPQFKEVKTVKYTA                                                                             
fig|359786.13.peg.408   Staphylococcus aureus subsp. aureus JH9       TASEVVEWAK−−SNIGKRINIDNYRGSQCWDTPNFIFKRYW−−GFVTWGNAKDMAN−−−YR−−YPKGFRFYRYSSGFVPEPGDIAVWHPGNGIGSDGHTAIVVGPSNKSYFYSVDQNWVNSNSWT−−−−−−−−−GSPGSLVRHPY−−−−VSVTGFVRPPYSKD−−−TS−−KPSSTDTSSASKANDSTIT−−−GEAKKPQFKEVKTVKYTA                                                                             
fig|359787.3.peg.579   Staphylococcus aureus subsp. aureus JH1       TASEVVEWAK−−SNIGKRINIDNYRGSQCWDTPNFIFKRYW−−GFVTWGNAKDMAN−−−YR−−YPKGFRFYRYSSGFVPEPGDIAVWHPGNGIGSDGHTAIVVGPSNKSYFYSVDQNWVNSNSWT−−−−−−−−−GSPGSLVRHPY−−−−VSVTGFVRPPYSKD−−−TS−−KPSSTDTSSASKANDSTIT−−−GEAKKPQFKEVKTVKYTA                                                                             
fig|1158533.3.peg.629   Staphylococcus aureus M0510       TASEVVEWAK−−SNIGKRINIDNYRGSQCWDTPNFIFKRYW−−GFVTWGNAKDMAN−−−YR−−YPKGFRFYRYSSGFVPEPGDIAVWHPGNGIGSDGHTAIVVGPSNKSYFYSVDQNWVNSNSWT−−−−−−−−−GSPGSLVRHPY−−−−VSVTGFVRPPYSKD−−−TS−−KPSSTDTSSASKANDSTIT−−−GEAKKPQFKEVKTVKYTA                                                                             
fig|904753.3.peg.1737   Staphylococcus aureus subsp. aureus 21282       TASEVVEWAK−−SNIGKRINIDNYRGSQCWDTPNFIFKRYW−−GFVTWGNAKDMAN−−−YR−−YPKGFRFYRYSSGFVPEPGDIAVWHPGNGIGSDGHTAIVVGPSNKSYFYSVDQNWVNSNSWT−−−−−−−−−GSPGSLVRHPY−−−−VSVTGFVRPPYSKD−−−TS−−KPSSTDTSSASKANDSTIT−−−GEAKKPQFKEVKTVKYTA                                                                             
fig|553583.3.peg.1934   Staphylococcus aureus A9635       TASEVVEWAK−−SNIGKRINIDNYRGSQCWDTPNFIFKRYW−−GFVTWGNAKDMAN−−−YR−−YPKGFRFYRYSSGFVPEPGDIAVWHPGNGIGSDGHTAIVVGPSNKSYFYSVDQNWVNSNSWT−−−−−−−−−GSPGSLVRHPY−−−−VSVTGFVRPPYSKD−−−TS−−KPSSTDTSSASKANDSTIT−−−GEAKKPQFKEVKTVKYTA                                                                             
fig|644279.4.peg.1309   Staphylococcus aureus subsp. aureus 132       TASEVVEWAK−−SNIGKRINIDNYRGSQCWDTPNFIFKRYW−−GFVTWGNAKDMAN−−−YR−−YPKGFRFYRYSSGFVPEPGDIAVWHPGNGIGSDGHTAIVVGPSNKSYFYSVDQNWVNSNSWT−−−−−−−−−GSPGSLVRHPY−−−−VSVTGFVRPPYSKD−−−TS−−KPSSTDTSSASKANDSTIT−−−GEAKKPQFKEVKTVKYTA                                                                             
fig|585155.3.peg.2409   Staphylococcus aureus subsp. aureus H19       TASEVVEWAK−−SNIGKRINIDNYRGSQCWDTPNFIFKRYW−−GFVTWGNAKDMAN−−−YR−−YPKGFRFYRYSSGFVPEPGDIAVWHPGNGIGSDGHTAIVVGPSNKSYFYSVDQNWVNSNSWT−−−−−−−−−GSPGRLVRHPY−−−−VSVTGFVRPPYSKD−−−IS−−KPSSTDTSSASKANDSTIT−−−GEAKKPQFKEVKTVKYTA                                                                             
fig|546342.4.peg.1931   Staphylococcus aureus subsp. aureus str. JKD6008       TASEVVEWAK−−SNIGKRINIDNYRGSQCWDTPNFIFKRYW−−GFVTWGNAKDMAN−−−YR−−YPKGFRFYRYSSGFVPEPGDIAVWHPGNGIGSDGHTAIVVGPSNKSYFYSVDQNWVNSNSWT−−−−−−−−−GSPGRLVRHPY−−−−VSVTGFVRPPYSKD−−−TS−−KPSSTDTSSASKANDSTIT−−−GEAKKP                                                                                         
fig|1157007.3.peg.2147   Staphylococcus aureus M0045       TASEVVEWAK−−SNIGKRINIDNYRGSQCWDTPNFIFKRYW−−GFVTWGNAKDMAN−−−YR−−YPKGFRFYRYSSGFVPEPGDIAVWHPGNGIGSDGHTAIVVGPSNKSYFYSVDQNWVNSNSWT−−−−−−−−−GSPGRLVRHPY−−−−VSVTGFVRPPYSKD−−−TS−−KPSSTDTSSASKANDSTIT−−−GEAKKPQFKEVKTVKYTA                                                                             
fig|1158472.3.peg.1992   Staphylococcus aureus M1170       TASEVVEWAK−−SNIGKRINIDNYRGSQCWDTPNFIFKRYW−−GFVTWGNAKDMAN−−−YR−−YPKGFRFYRYSSGFVPEPGDIAVWHPGNGIGSDGHTAIVVGPSNKSYFYSVDQNWVNSNSWT−−−−−−−−−GSPGRLVRHPY−−−−VSVTGFVRPPYSKD−−−TS−−KPSSTDTSSASKANDSTIT−−−GEAKKPQFKEVKTVKYTA                                                                             
fig|1224925.3.peg.1932   Staphylococcus aureus M0273       TASEVVEWAK−−SNIGKRINIDNYRGSQCWDTPNFIFKRYW−−GFVTWGNAKDMAN−−−YR−−YPKGFRFYRYSSGFVPEPGDIAVWHPGNGIGSDGHTAIVVGPSNKSYFYSVDQNWVNSNSWT−−−−−−−−−GSPGRLVRHPY−−−−VSVTGFVRPPYSKD−−−TS−−KPSSTDTSSASKANDSTIT−−−GEAKKPQFKEVKTVKYTA                                                                             
fig|553580.3.peg.2877   Staphylococcus aureus A8819       TASEVVEWAK−−SNIGKRINIDNYRGSQCWDTPNFIFKRYW−−GFVTWGNAKDMAN−−−YR−−YPKGFRFYRYSSGFVPEPGDIAVWHPGNGIGSDGHTAIVVGPSNKSYFYSVDQNWVNSNSWT−−−−−−−−−GSPGRLVRHPY−−−−VSVTGFVRPPYSKD−−−TS−−KPSSTDTSSASKANDSTIT−−−GEAKKPQFKEVKTVKYTA                                                                             
fig|931437.3.peg.127   Staphylococcus aureus subsp. aureus CIG1500       TASEVVEWAK−−SNIGKRINIDNYRGSQCWDTPNFIFKRYW−−GFVTWGNAKDMAN−−−YR−−YPKGFRFYRYSSGFVPEPGDIAVWHPGNGIGSDGHTAIVVGPSNKSYFYSVDQNWVNSNSWT−−−−−−−−−GSPGRLVRHPY−−−−VSVTGFVRPPYSKD−−−TS−−KPSSTDTSSASKANDSTIT−−−GEAKKPQFKEVKTVKYTA                                                                             
fig|525375.3.peg.1953   Staphylococcus epidermidis M23864:W2(grey)       TASEVAAWAR−−SMIGRRVDVDGYYGAQCWDLPNYIFNRYW−−RFRTTGNAIAMAW−−−YR−−YPKGFKFYRNTRNFVPKPGDMAVWGKGSFNNGVGHTAVVIGPSTKSYFTSVDQNWIGANSYT−−−−−−−−−GSPGAKIKHSY−−−−NGISGFVRPPYHAE−−−TK−−KPSKASSTPSKPSSDNTPK−−−NTK                                                                                            
fig|273036.3.peg.1649   Staphylococcus aureus RF122                       RVIDVDRAYGGQCWDVPNYILERYW−−GFRTWGNANAMAQ−−KSN−−YRGRDFKIYRNTASFTPKPGDWAVWAN−−−−RNPGHVAIVVGPADKNAFVSVDQNWYTANWS−−−−−−−−−GSPPYKIKHTYHDGPGGVTHFVRPPYHPD−−−KT−−TPAPQPVPKPKDDSDDKEK−−−NNKKVPI                                                                                        
fig|273036.6.peg.1807   Staphylococcus aureus RF122                       RVIDVDRAYGGQCWDVPNYILERYW−−GFRTWGNANAMAQ−−KSN−−YRGRDFKIYRNTASFTPKPGDWAVWAN−−−−RNPGHVAIVVGPADKNAFVSVDQNWYTANWS−−−−−−−−−GSPPYKIKHTYHDGPGGVTHFVRPPYHPD−−−KT−−TPAPQPVPKPKDDSDDKEK−−−NNKKVPI                                                                                        
fig|553212.3.peg.2151   Staphylococcus capitis SK14       TASQVVDWAKWMAKNHKGVDIDGRYGFQCWDLPNYIFQRYW−−HFRTWGNANAMAN−−RSQ−−YPNRSWKIYRNTSSFVPKPGDIAVWTY−−−−GWAGHTAIVVGPSDKSHFKCVDQNWVGSNQWS−−−−−−−−−GSRAAFVNHNYNGNGGNIYFIRPPYKAE−−−KNPPKPSGGSDTSNTTTKDNNKT−−−VTIKKKQTHIDFTID                                                                                
fig|553212.3.peg.2157   Staphylococcus capitis SK14                         IDKDHSFHAQCMDLAIDYVMWLTDNQTEMWGDAKSSIM−−−NK−−FPKGWKIVENKPSTIPKKGWIAVFTSGTYDKYGHIGIVYNGGNTTSFQILEQNWNGWA−−−−−−−−−−−−NKKPSLRWDNY−−−−YGLTHFIVPPVAKE−−−IEAPKKDAKSAPKQSIKKNSSIK−−−VNTNHIKG                                                                                      
fig|525375.3.peg.1321   Staphylococcus epidermidis M23864:W2(grey)                         IDKDRAYHAQCMDLAIDYVMWLTDNQTEMWGDAKSSIK−−−NK−−FPKGWKIVENKPSTIPKKGWIAVYTAGTYSRYGHIGIVYDGGNTNSFQILEQNWNGWA−−−−−−−−−−−−NKKPSLRWDNY−−−−YGLTHFIVPPVAKE−−−IEAPKKDVKSAPKQSVKENSNIK−−−VNTNHIKG                                                                                      
fig|698737.3.peg.2179   Staphylococcus lugdunensis HKU09-01                         VDVDHFYHAQCADLPTDYILWLTDNQYKAWGNAKDFPN−−−NK−−FPTGWKVIENMPETVPQKGWIAVFTSGTYAQYGHIGIVYNGGNTNSFQILEQNWNGYA−−−−−−−−−−−−NKKPTLRWDNY−−−−YGLTHFIVPPVAKE−−−FKVLKTETKKAPTQTNKTKTKKIEVNTKRITGWTMDKRGYNPHGVVIHNDAGSANSQNYYNSLVNANYDR                                                
fig|279808.8.peg.2292   Staphylococcus haemolyticus JCSC1435                         IDVDKSFHAQCADLTIDYILWLTDNEFRIRGNAKDAINPKKNK−−LPEGWKIVLNRPSTVPRKGWIAVFTDGTYWEYGHIGMVYDGGNTSRFQILEQNWNGWA−−−−−−−−−−−−NKKPSLRWDNY−−−−YGLTHFIVPPVAKE−−−NKAVSSSKQQAPKQKVKKASTKKALPKITKHITGYNMDKRGYNPKGVVLHNDAGGMNYKQYYNNLVNANYDR                                                
fig|279808.3.peg.1853   Staphylococcus haemolyticus JCSC1435                         IDVDKSFHAQCADLTIDYILWLTDNEFRIRGNAKDAINPKKNK−−LPEGWKIVLNRPSTVPRKGWIAVFTDGTYWEYGHIGMVYDGGNTSRFQILEQNWNGWA−−−−−−−−−−−−NKKPSLRWDNY−−−−YGLTHFIVPPVAKE−−−NKAVSSSKQQAPKQKVKKASTKKALPKITKHITGYNMDKRGYNPKGVVLHNDAGGMNYKQYYNNLVNANYDR                                                
fig|525374.3.peg.1025   Staphylococcus epidermidis BCM-HMP0060      KDYQSAINYMY−−SLKGKFVDFDNRWAYQCMDLAVDYVYHITNGKVRMWGNAKDSIL−−−NI−−FPKGWKIVKNTPDYVPPVGAIGVCTYGIYQRYGHIYLVWDNSGGTNTQTVLEQNFDGNA−−−−−−−−−−−−DTPAKLRVDNF−−−−YGTTHYIVPSFVDE−−−DYDVNKIKTVTTRKATNKYNGKR−−−−−−−−VPKNLVWSKT−−−PHYIAKADSADVTICKDVKNGYMKKTNLVYKAGYSP−−−FYVYEVREG−−−−−WARVYSESSNYWVWHERLIITKEY
fig|273036.3.peg.882   Staphylococcus aureus RF122     MKTYSEARARLR−−WYQGRYIDFDGWYGYQCADLAVDYIYWLL−−EIRMWGNAKDAIN−−−ND−−FKNMATVYENTPSFVPQIGDVAVFTKGIYKQYGHIGLVFNGGNTNQFLILEQNYDGNA−−−−−−−−−−−−NTPAKLRWDNY−−−−YGCTHFIRPKYKSEGLMNKITNKVKPPAQKAVGKSASKIT−−−VGSKAPYNLKWSKG−−−AYFNAKIDGLGATSATRYGDNRTNYRFDVGQAIYAPGTLIYVFEIIDG−−−−−WCRIYWNNHNEWVWHERLIVKEVY
fig|273036.6.peg.836   Staphylococcus aureus RF122     MKTYSEARARLR−−WYQGRYIDFDGWYGYQCADLAVDYIYWLL−−EIRMWGNAKDAIN−−−ND−−FKNMATVYENTPSFVPQIGDVAVFTKGIYKQYGHIGLVFNGGNTNQFLILEQNYDGNA−−−−−−−−−−−−NTPAKLRWDNY−−−−YGCTHFIRPKYKSEGLMNKITNKVKPPAQKAVGKSASKIT−−−VGSKAPYNLKWSKG−−−AYFNAKIDGLGATSATRYGDNRTNYRFDVGQAIYAPGTLIYVFEIIDG−−−−−WCRIYWNNHNEWVWHERLIVKEVY
fig|585147.3.peg.1486   Staphylococcus aureus subsp. aureus A017934/97     MKTYSEARARLR−−WYQGRYIDFDGWYGYQCADLAVDYIYWLL−−EIRMWGNAKDAIN−−−ND−−FKNMATVYENTPSFVPQIGDVAVFTKGIYKQYGHIGLVFNGGNTNQFLILEQNYDGNA−−−−−−−−−−−−NTPAKLRWDNY−−−−YGCTHFIRPKYKSEGLMNKITNKVKPPAQKAVGKSASKIT−−−VGSKAPYNLKWSKG−−−AYFNAKIDGLGATSAARYGDNRTNYRFDVGQAVYAPGTLIYVFEIIDG−−−−−WCRIYWNNHNEWIWHERLIVKEVF
fig|1137131.3.peg.1023   Staphylococcus aureus subsp. aureus 122051     MKTYSEARARLR−−WYQGRYIDFDGWYGYQCADLAVDYIYWLL−−EIRMWGNAKDAIN−−−ND−−FKNMATVYENTPSFVPQIGDVAVFTKGIYKQYGHIGLVFNGGNTNQFLILEQNYDGNA−−−−−−−−−−−−NTPAKLRWDNY−−−−YGCTHFIRPKYKSEGLMNKITNKVKPPAQKAVGKSASKIT−−−VGSKAPYNLKWSKG−−−AYFNAKIDGLGATSATRYGDNRTNYRFDVGQAVYAPGTLIYVFEIIDG−−−−−WCRIYWNNHNEWIWHERLIVKEVF
fig|1157005.3.peg.1396   Staphylococcus aureus M0029     MKTYSEARARLR−−WYQGRYIDFDGWYGYQCADLAVDYIYWLL−−EIRMWGNAKDAIN−−−ND−−FKNMATVYENTPSFVPQIGDVAVFTKGIYKQYGHIGLVFNGGNTNQFLILEQNYDGNA−−−−−−−−−−−−NTPAKLRWDNY−−−−YGCTHFIRPKYKSEGLMNKITNKVKPPAQKAVGKSASKIT−−−VGSKAPYNLKWSKG−−−AYFNAKIDGLGATSATRYGDNRTNYRFDVGQAVYAPGTLIYVFEIIDG−−−−−WCRIYWNNHNEWIWHERLIVKEVF
fig|1157007.3.peg.297   Staphylococcus aureus M0045     MKTYSEARARLR−−WYQGRYIDFDGWYGYQCADLAVDYIYWLL−−EIRMWGNAKDAIN−−−ND−−FKNMATVYENTPSFVPQIGDVAVFTKGIYKQYGHIGLVFNGGNTNQFLILEQNYDGNA−−−−−−−−−−−−NTPAKLRWDNY−−−−YGCTHFIRPKYKSEGLMNKITNKVKPPAQKAVGKSASKIT−−−VGSKAPYNLKWSKG−−−AYFNAKIDGLGATSATRYGDNRTNYRFDVGQAVYAPGTLIYVFEIIDG−−−−−WCRIYWNNHNEWIWHERLIVKEVF
fig|1158472.3.peg.88   Staphylococcus aureus M1170     MKTYSEARARLR−−WYQGRYIDFDGWYGYQCADLAVDYIYWLL−−EIRMWGNAKDAIN−−−ND−−FKNMATVYENTPSFVPQIGDVAVFTKGIYKQYGHIGLVFNGGNTNQFLILEQNYDGNA−−−−−−−−−−−−NTPAKLRWDNY−−−−YGCTHFIRPKYKSEGLMNKITNKVKPPAQKAVGKSASKIT−−−VGSKAPYNLKWSKG−−−AYFNAKIDGLGATSATRYGDNRTNYRFDVGQAVYAPGTLIYVFEIIDG−−−−−WCRIYWNNHNEWIWHERLIVKEVF
fig|1158481.3.peg.1963   Staphylococcus aureus M1255     MKTYSEARARLR−−WYQGRYIDFDGWYGYQCADLAVDYIYWLL−−EIRMWGNAKDAIN−−−ND−−FKNMATVYENTPSFVPQIGDVAVFTKGIYKQYGHIGLVFNGGNTNQFLILEQNYDGNA−−−−−−−−−−−−NTPAKLRWDNY−−−−YGCTHFIRPKYKSEGLMNKITNKVKPPAQKAVGKSASKIT−−−VGSKAPYNLKWSKG−−−AYFNAKIDGLGATSATRYGDNRTNYRFDVGQAVYAPGTLIYVFEIIDG−−−−−WCRIYWNNHNEWIWHERLIVKEVF
fig|1158533.3.peg.1521   Staphylococcus aureus M0510     MKTYSEARARLR−−WYQGRYIDFDGWYGYQCADLAVDYIYWLL−−EIRMWGNAKDAIN−−−ND−−FKNMATVYENTPSFVPQIGDVAVFTKGIYKQYGHIGLVFNGGNTNQFLILEQNYDGNA−−−−−−−−−−−−NTPAKLRWDNY−−−−YGCTHFIRPKYKSEGLMNKITNKVKPPAQKAVGKSASKIT−−−VGSKAPYNLKWSKG−−−AYFNAKIDGLGATSATRYGDNRTNYRFDVGQAVYAPGTLIYVFEIIDG−−−−−WCRIYWNNHNEWIWHERLIVKEVF
fig|1169274.3.peg.1922   Staphylococcus aureus M1309     MKTYSEARARLR−−WYQGRYIDFDGWYGYQCADLAVDYIYWLL−−EIRMWGNAKDAIN−−−ND−−FKNMATVYENTPSFVPQIGDVAVFTKGIYKQYGHIGLVFNGGNTNQFLILEQNYDGNA−−−−−−−−−−−−NTPAKLRWDNY−−−−YGCTHFIRPKYKSEGLMNKITNKVKPPAQKAVGKSASKIT−−−VGSKAPYNLKWSKG−−−AYFNAKIDGLGATSATRYGDNRTNYRFDVGQAVYAPGTLIYVFEIIDG−−−−−WCRIYWNNHNEWIWHERLIVKEVF
fig|1224925.3.peg.88   Staphylococcus aureus M0273     MKTYSEARARLR−−WYQGRYIDFDGWYGYQCADLAVDYIYWLL−−EIRMWGNAKDAIN−−−ND−−FKNMATVYENTPSFVPQIGDVAVFTKGIYKQYGHIGLVFNGGNTNQFLILEQNYDGNA−−−−−−−−−−−−NTPAKLRWDNY−−−−YGCTHFIRPKYKSEGLMNKITNKVKPPAQKAVGKSASKIT−−−VGSKAPYNLKWSKG−−−AYFNAKIDGLGATSATRYGDNRTNYRFDVGQAVYAPGTLIYVFEIIDG−−−−−WCRIYWNNHNEWIWHERLIVKEVF
fig|359786.13.peg.2118   Staphylococcus aureus subsp. aureus JH9     MKTYSEARARLR−−WYQGRYIDFDGWYGYQCADLAVDYIYWLL−−EIRMWGNAKDAIN−−−ND−−FKNMATVYENTPSFVPQIGDVAVFTKGIYKQYGHIGLVFNGGNTNQFLILEQNYDGNA−−−−−−−−−−−−NTPAKLRWDNY−−−−YGCTHFIRPKYKSEGLMNKITNKVKPPAQKAVGKSASKIT−−−VGSKAPYNLKWSKG−−−AYFNAKIDGLGATSATRYGDNRTNYRFDVGQAVYAPGTLIYVFEIIDG−−−−−WCRIYWNNHNEWIWHERLIVKEVF
fig|359787.3.peg.2628   Staphylococcus aureus subsp. aureus JH1     MKTYSEARARLR−−WYQGRYIDFDGWYGYQCADLAVDYIYWLL−−EIRMWGNAKDAIN−−−ND−−FKNMATVYENTPSFVPQIGDVAVFTKGIYKQYGHIGLVFNGGNTNQFLILEQNYDGNA−−−−−−−−−−−−NTPAKLRWDNY−−−−YGCTHFIRPKYKSEGLMNKITNKVKPPAQKAVGKSASKIT−−−VGSKAPYNLKWSKG−−−AYFNAKIDGLGATSATRYGDNRTNYRFDVGQAVYAPGTLIYVFEIIDG−−−−−WCRIYWNNHNEWIWHERLIVKEVF
fig|426430.6.peg.1830   Staphylococcus aureus subsp. aureus str. Newman     MKTYSEARARLR−−WYQGRYIDFDGWYGYQCADLAVDYIYWLL−−EIRMWGNAKDAIN−−−ND−−FKNMATVYENTPSFVPQIGDVAVFTKGIYKQYGHIGLVFNGGNTNQFLILEQNYDGNA−−−−−−−−−−−−NTPAKLRWDNY−−−−YGCTHFIRPKYKSEGLMNKITNKVKPPAQKAVGKSASKIT−−−VGSKAPYNLKWSKG−−−AYFNAKIDGLGATSATRYGDNRTNYRFDVGQAVYAPGTLIYVFEIIDG−−−−−WCRIYWNNHNEWIWHERLIVKEVF
fig|450394.6.peg.2468   Staphylococcus aureus subsp. aureus USA300_TCH959     MKTYSEARARLR−−WYQGRYIDFDGWYGYQCADLAVDYIYWLL−−EIRMWGNAKDAIN−−−ND−−FKNMATVYENTPSFVPQIGDVAVFTKGIYKQYGHIGLVFNGGNTNQFLILEQNYDGNA−−−−−−−−−−−−NTPAKLRWDNY−−−−YGCTHFIRPKYKSEGLMNKITNKVKPPAQKAVGKSASKIT−−−VGSKAPYNLKWSKG−−−AYFNAKIDGLGATSATRYGDNRTNYRFDVGQAVYAPGTLIYVFEIIDG−−−−−WCRIYWNNHNEWIWHERLIVKEVF
fig|546342.4.peg.2052   Staphylococcus aureus subsp. aureus str. JKD6008     MKTYSEARARLR−−WYQGRYIDFDGWYGYQCADLAVDYIYWLL−−EIRMWGNAKDAIN−−−ND−−FKNMATVYENTPSFVPQIGDVAVFTKGIYKQYGHIGLVFNGGNTNQFLILEQNYDGNA−−−−−−−−−−−−NTPAKLRWDNY−−−−YGCTHFIRPKYKSEGLMNKITNKVKPPAQKAVGKSASKIT−−−VGSKAPYNLKWSKG−−−AYFNAKIDGLGATSATRYGDNRTNYRFDVGQAVYAPGTLIYVFEIIDG−−−−−WCRIYWNNHNEWIWHERLIVKEVF
fig|553580.3.peg.2592   Staphylococcus aureus A8819     MKTYSEARARLR−−WYQGRYIDFDGWYGYQCADLAVDYIYWLL−−EIRMWGNAKDAIN−−−ND−−FKNMATVYENTPSFVPQIGDVAVFTKGIYKQYGHIGLVFNGGNTNQFLILEQNYDGNA−−−−−−−−−−−−NTPAKLRWDNY−−−−YGCTHFIRPKYKSEGLMNKITNKVKPPAQKAVGKSASKIT−−−VGSKAPYNLKWSKG−−−AYFNAKIDGLGATSATRYGDNRTNYRFDVGQAVYAPGTLIYVFEIIDG−−−−−WCRIYWNNHNEWIWHERLIVKEVF
fig|553583.3.peg.543   Staphylococcus aureus A9635     MKTYSEARARLR−−WYQGRYIDFDGWYGYQCADLAVDYIYWLL−−EIRMWGNAKDAIN−−−ND−−FKNMATVYENTPSFVPQIGDVAVFTKGIYKQYGHIGLVFNGGNTNQFLILEQNYDGNA−−−−−−−−−−−−NTPAKLRWDNY−−−−YGCTHFIRPKYKSEGLMNKITNKVKPPAQKAVGKSASKIT−−−VGSKAPYNLKWSKG−−−AYFNAKIDGLGATSATRYGDNRTNYRFDVGQAVYAPGTLIYVFEIIDG−−−−−WCRIYWNNHNEWIWHERLIVKEVF
fig|553590.4.peg.1564   Staphylococcus aureus A9754     MKTYSEARARLR−−WYQGRYIDFDGWYGYQCADLAVDYIYWLL−−EIRMWGNAKDAIN−−−ND−−FKNMATVYENTPSFVPQIGDVAVFTKGIYKQYGHIGLVFNGGNTNQFLILEQNYDGNA−−−−−−−−−−−−NTPAKLRWDNY−−−−YGCTHFIRPKYKSEGLMNKITNKVKPPAQKAVGKSASKIT−−−VGSKAPYNLKWSKG−−−AYFNAKIDGLGATSATRYGDNRTNYRFDVGQAVYAPGTLIYVFEIIDG−−−−−WCRIYWNNHNEWIWHERLIVKEVF
fig|585144.3.peg.2520   Staphylococcus aureus subsp. aureus 58-424     MKTYSEARARLR−−WYQGRYIDFDGWYGYQCADLAVDYIYWLL−−EIRMWGNAKDAIN−−−ND−−FKNMATVYENTPSFVPQIGDVAVFTKGIYKQYGHIGLVFNGGNTNQFLILEQNYDGNA−−−−−−−−−−−−NTPAKLRWDNY−−−−YGCTHFIRPKYKSEGLMNKITNKVKPPAQKAVGKSASKIT−−−VGSKAPYNLKWSKG−−−AYFNAKIDGLGATSATRYGDNRTNYRFDVGQAVYAPGTLIYVFEIIDG−−−−−WCRIYWNNHNEWIWHERLIVKEVF
fig|585145.3.peg.2506   Staphylococcus aureus subsp. aureus 65-1322     MKTYSEARARLR−−WYQGRYIDFDGWYGYQCADLAVDYIYWLL−−EIRMWGNAKDAIN−−−ND−−FKNMATVYENTPSFVPQIGDVAVFTKGIYKQYGHIGLVFNGGNTNQFLILEQNYDGNA−−−−−−−−−−−−NTPAKLRWDNY−−−−YGCTHFIRPKYKSEGLMNKITNKVKPPAQKAVGKSASKIT−−−VGSKAPYNLKWSKG−−−AYFNAKIDGLGATSATRYGDNRTNYRFDVGQAVYAPGTLIYVFEIIDG−−−−−WCRIYWNNHNEWIWHERLIVKEVF
fig|585151.3.peg.1716   Staphylococcus aureus subsp. aureus C427     MKTYSEARARLR−−WYQGRYIDFDGWYGYQCADLAVDYIYWLL−−EIRMWGNAKDAIN−−−ND−−FKNMATVYENTPSFVPQIGDVAVFTKGIYKQYGHIGLVFNGGNTNQFLILEQNYDGNA−−−−−−−−−−−−NTPAKLRWDNY−−−−YGCTHFIRPKYKSEGLMNKITNKVKPPAQKAVGKSASKIT−−−VGSKAPYNLKWSKG−−−AYFNAKIDGLGATSATRYGDNRTNYRFDVGQAVYAPGTLIYVFEIIDG−−−−−WCRIYWNNHNEWIWHERLIVKEVF
fig|585152.3.peg.1923   Staphylococcus aureus subsp. aureus D139     MKTYSEARARLR−−WYQGRYIDFDGWYGYQCADLAVDYIYWLL−−EIRMWGNAKDAIN−−−ND−−FKNMATVYENTPSFVPQIGDVAVFTKGIYKQYGHIGLVFNGGNTNQFLILEQNYDGNA−−−−−−−−−−−−NTPAKLRWDNY−−−−YGCTHFIRPKYKSEGLMNKITNKVKPPAQKAVGKSASKIT−−−VGSKAPYNLKWSKG−−−AYFNAKIDGLGATSATRYGDNRTNYRFDVGQAVYAPGTLIYVFEIIDG−−−−−WCRIYWNNHNEWIWHERLIVKEVF
fig|644279.4.peg.2100   Staphylococcus aureus subsp. aureus 132     MKTYSEARARLR−−WYQGRYIDFDGWYGYQCADLAVDYIYWLL−−EIRMWGNAKDAIN−−−ND−−FKNMATVYENTPSFVPQIGDVAVFTKGIYKQYGHIGLVFNGGNTNQFLILEQNYDGNA−−−−−−−−−−−−NTPAKLRWDNY−−−−YGCTHFIRPKYKSEGLMNKITNKVKPPAQKAVGKSASKIT−−−VGSKAPYNLKWSKG−−−AYFNAKIDGLGATSATRYGDNRTNYRFDVGQAVYAPGTLIYVFEIIDG−−−−−WCRIYWNNHNEWIWHERLIVKEVF
fig|904753.3.peg.629   Staphylococcus aureus subsp. aureus 21282     MKTYSEARARLR−−WYQGRYIDFDGWYGYQCADLAVDYIYWLL−−EIRMWGNAKDAIN−−−ND−−FKNMATVYENTPSFVPQIGDVAVFTKGIYKQYGHIGLVFNGGNTNQFLILEQNYDGNA−−−−−−−−−−−−NTPAKLRWDNY−−−−YGCTHFIRPKYKSEGLMNKITNKVKPPAQKAVGKSASKIT−−−VGSKAPYNLKWSKG−−−AYFNAKIDGLGATSATRYGDNRTNYRFDVGQAVYAPGTLIYVFEIIDG−−−−−WCRIYWNNHNEWIWHERLIVKEVF
fig|904776.3.peg.834   Staphylococcus aureus subsp. aureus IS-24     MKTYSEARARLR−−WYQGRYIDFDGWYGYQCADLAVDYIYWLL−−EIRMWGNAKDAIN−−−ND−−FKNMATVYENTPSFVPQIGDVAVFTKGIYKQYGHIGLVFNGGNTNQFLILEQNYDGNA−−−−−−−−−−−−NTPAKLRWDNY−−−−YGCTHFIRPKYKSEGLMNKITNKVKPPAQKAVGKSASKIT−−−VGSKAPYNLKWSKG−−−AYFNAKIDGLGATSATRYGDNRTNYRFDVGQAVYAPGTLIYVFEIIDG−−−−−WCRIYWNNHNEWIWHERLIVKEVF
fig|904783.3.peg.600   Staphylococcus aureus subsp. aureus IS-122     MKTYSEARARLR−−WYQGRYIDFDGWYGYQCADLAVDYIYWLL−−EIRMWGNAKDAIN−−−ND−−FKNMATVYENTPSFVPQIGDVAVFTKGIYKQYGHIGLVFNGGNTNQFLILEQNYDGNA−−−−−−−−−−−−NTPAKLRWDNY−−−−YGCTHFIRPKYKSEGLMNKITNKVKPPAQKAVGKSASKIT−−−VGSKAPYNLKWSKG−−−AYFNAKIDGLGATSATRYGDNRTNYRFDVGQAVYAPGTLIYVFEIIDG−−−−−WCRIYWNNHNEWIWHERLIVKEVF
fig|93061.5.peg.1970   Staphylococcus aureus subsp. aureus NCTC 8325     MKTYSEARARLR−−WYQGRYIDFDGWYGYQCADLAVDYIYWLL−−EIRMWGNAKDAIN−−−ND−−FKNMATVYENTPSFVPQIGDVAVFTKGIYKQYGHIGLVFNGGNTNQFLILEQNYDGNA−−−−−−−−−−−−NTPAKLRWDNY−−−−YGCTHFIRPKYKSEGLMNKITNKVKPPAQKAVGKSASKIT−−−VGSKAPYNLKWSKG−−−AYFNAKIDGLGATSATRYGDNRTNYRFDVGQAVYAPGTLIYVFEIIDG−−−−−WCRIYWNNHNEWIWHERLIVKEVF
fig|931437.3.peg.1766   Staphylococcus aureus subsp. aureus CIG1500     MKTYSEARARLR−−WYQGRYIDFDGWYGYQCADLAVDYIYWLL−−EIRMWGNAKDAIN−−−ND−−FKNMATVYENTPSFVPQIGDVAVFTKGIYKQYGHIGLVFNGGNTNQFLILEQNYDGNA−−−−−−−−−−−−NTPAKLRWDNY−−−−YGCTHFIRPKYKSEGLMNKITNKVKPPAQKAVGKSASKIT−−−VGSKAPYNLKWSKG−−−AYFNAKIDGLGATSATRYGDNRTNYRFDVGQAVYAPGTLIYVFEIIDG−−−−−WCRIYWNNHNEWIWHERLIVKEVF
fig|585155.3.peg.2552   Staphylococcus aureus subsp. aureus H19     MKTYSEARARLR−−WYQGRYIDFDGWHGYQCADLAVDYIYWLL−−EIRMWGNAKDAIN−−−ND−−FKNMATVYENTPSFVPQIGDVAVFTKGIYKQYGHIGLVFNGGNTNQFLILEQNYDGNA−−−−−−−−−−−−NTPAKLRWDNY−−−−YGCTHFIRPKYKSEGLMNKITNKVKPPAQKAVGKSASKIT−−−VGSKAPYNLKWSKG−−−AYFNAKIDGLGATSATRYGDNRTNYRFDVGQAVYAPGTLIYVFEIING−−−−−WCRIYWNNHNEWIWHERLIVKEVF
fig|1231383.3.peg.1074   Staphylococcus aureus KT/314250     MKTYSEARARLR−−WYQGRYIDFDGWYGYQCADLAVDYIYWLL−−EIRMWGNAKDAIN−−−ND−−FKNMATVYENTPSFVPQIGDVAVFTKGIYKQYGHIGLVFNGGNTNQFLILEQDYDGNA−−−−−−−−−−−−NTPAKLRWDNY−−−−YGCTHFIRPKYKSEGLMNKITNKVKPPAQKAVGKSASKIT−−−VGSKAPYNLKWSKG−−−AYFNAKIDGLGATSATRYGDNRTNYRFDVGQAVYAPGTLIYVFEIIDG−−−−−WCRIYWNNHNEWIWHERLIVKEVF
fig|282459.5.peg.1948   Staphylococcus aureus subsp. aureus MSSA476     MKTYSEARARLR−−WYQGRYIDFDGWYGYQCADLAVDYIYWLL−−EIRMWGNAKDAIN−−−ND−−FKNMATVYENTPSFVPQIGDVAVFTKGIYKQYGHIGLVFNGGNTNQFLILEQDYDGNA−−−−−−−−−−−−NTPAKLRWDNY−−−−YGCTHFIRPKYKSEGLMNKITNKVKPPAQKAVGKSASKIT−−−VGSKAPYNLKWSKG−−−AYFNAKIDGLGATSATRYGDNRTNYRFDVGQAVYAPGTLIYVFEIIDG−−−−−WCRIYWNNHNEWIWHERLIVKEVF
fig|418127.4.peg.1797   Staphylococcus aureus subsp. aureus Mu3     MKTYSEARARLR−−WYQGRYIDFDGWYGYQCADLAVDYIYWLL−−EIRMWGNAKDAIN−−−ND−−FKNMATVYENTPSFVPQIGDVAVFTKGIYKQYGHIGLVFNGGNTNQFLILEQNYDGNA−−−−−−−−−−−−NTPAKLRWDNY−−−−YGCTHFIRPKYKSEGLMNKITNKVKPPAQKAVGKSASKIT−−−VGSKAPYNLKWSKG−−−AYFNAKIDGLGATSATRYGDNRTNYRFDVGQAVYAPGTLIYVFEIIDG−−−−−WCRIYWNNHNEWICYE        
fig|1158682.3.peg.1961   Staphylococcus aureus M0528     MKTYSEARARLR−−WYQGRYIDFDGWYGYQCADLAVDYIYWLL−−EIRMWGNAKDAIN−−−ND−−FKNMATVYENTPSFVPQIGDVAVFTKGIYKQYGHIGLVFNGGNTNQFLILEQNYDGNA−−−−−−−−−−−−NTPAKLRWDNY−−−−YGCTHFIRPKYKSEGLMNKITNKINPPAQKAVGKSASKIT−−−VGSKAPYNLKWSKG−−−AYFNAKIDGLGATSATRYGDNRTNYRFDVGQAVYAPGTLIYVFEIIDG−−−−−WCRIYWNNHNEWIWHERLIVKEAF
fig|1158692.3.peg.1721   Staphylococcus aureus M0687     MKTYSEARARLR−−WYQGRYIDFDGWYGYQCADLAVDYIYWLL−−EIRMWGNAKDAIN−−−ND−−FKNMATVYENTPSFVPQIGDVAVFTKGIYKQYGHIGLVFNGGNTNQFLILEQNYDGNA−−−−−−−−−−−−NTPAKLRWDNY−−−−YGCTHFIRPKYKSEGLMNKITNKINPPAQKAVGKSASKIT−−−VGSKAPYNLKWSKG−−−AYFNAKIDGLGATSATRYGDNRTNYRFDVGQAVYAPGTLIYVFEIIDG−−−−−WCRIYWNNHNEWIWHERLIVKEAF
fig|505321.3.peg.2700   Staphylococcus aureus subsp. aureus str. CF-Marseille     MKTYSEARARLR−−WYQGRYIDFDGWYGYQCADLAVDYIYWLL−−EIRMWGNAKDAIN−−−ND−−FKNMATVYENTPSFVPQIGDVAVFTKGIYKQYGHIGLVFNGGNTNQFLILEQNYDGNA−−−−−−−−−−−−NTPAKLRWDNY−−−−YGCTHFIRPKYKSEGLMNKITNKINPPAQKAVGKSASKIT−−−VGSKAPYNLKWSKG−−−AYFNAKIDGLGATSATRYGDNRTNYRFDVGQAVYAPGTLIYVFEIIDG−−−−−WCRIYWNNHNEWIWHERLIVKEAF
fig|931439.3.peg.2630   Staphylococcus aureus subsp. aureus CIG1750     MKTYSEARARLR−−WYQGRYIDFDGWYGYQCADLAVDYIYWLL−−EIRMWGNAKDAIN−−−ND−−FKNMATVYENTPSFVPQIGDVAVFTKGIYKQYGHIGLVFNGGNTNQFLILEQNYDGNA−−−−−−−−−−−−NTPAKLRWDNY−−−−YGCTHFIRPKYKSEGLMNKITNKINPPAQKAVGKSASKIT−−−VGSKAPYNLKWSKG−−−AYFNAKIDGLGATSATRYGDNRTNYRFDVGQAVYAPGTLIYVFEIIDG−−−−−WCRIYWNNHNEWIWHERLIVKEAF
fig|585152.3.peg.1775   Staphylococcus aureus subsp. aureus D139       TKKEFIEWLK−−TSEGKQFNIDLWYAFQCFDYANAGWKALFGLLLKGVGAKDIPFA−−−NN−−FDGLATVYQNTPDFLAQPGDMVVFGSNYGAGYGHVAWVI−−EATLDYIIVYEQNWLGGGWTDGIEQPGWGWEKVTRRQHAY−−−−DFPMWFIRPNFKS−−−−ETAPRSVQSPTQAPKKETAKPQP                                                                                                  
fig|426430.6.peg.1011   Staphylococcus aureus subsp. aureus str. Newman       TKKEFIEWLK−−TSEGKQFNIDLWYAFQCFDYANAGWKALFGLLLKGVGAKDIPFA−−−NN−−FDGLATVYQNTPDFLAQPGDMVVFGSNYGAGYGHVAWVI−−EATLDYIIVYEQNWLGGGWTDGIEQPGWGWEKVTRRQHAY−−−−DFPMWFIRPNFKS−−−−ETAPRSVQSPTQAPKKETAKPQP                                                                                                  
fig|1157007.3.peg.2150   Staphylococcus aureus M0045       TKKEFIEWLK−−TSEGKQFNIDLWYAFQCFDYANAGWKALFGLLLKGVGAKDIPFA−−−NN−−FDGLATVYQNTPDFLAQPGDMVVFGSNYGAGYGHVAWVI−−EATLDYIIVYEQNWLGGGWTDGIEQPGWGWEKVTRRQHAY−−−−DFPMWFIRPNFKS−−−−ETAPRSIQSPTQAPKKETAKPQP                                                                                                  
fig|1169274.3.peg.1035   Staphylococcus aureus M1309       TKKEFIEWLK−−TSEGKQFNIDLWYAFQCFDYANAGWKALFGLLLKGVGAKDIPFA−−−NN−−FDGLATVYQNTPDFLAQPGDMVVFGSNYGAGYGHVAWVI−−EATLDYIIVYEQNWLGGGWTDGIEQPGWGWEKVTRRQHAY−−−−DFPMWFIRPNFKS−−−−ETAPRSIQSPTQAPKKETAKPQP                                                                                                  
fig|553583.3.peg.1930   Staphylococcus aureus A9635       TKKEFIEWLK−−TSEGKQFNIDFWYAFQCFDYANAGWKALFGLLLKGVGAKDIPFA−−−NN−−FDGLATVYQNTPDFLAQPGDVVVFGSNYGAGYGHVAWVI−−EATLDYIIVYEQNWLGGGWTDGIEQPGWGWEKVTRRQHAY−−−−DFPMWFIRPNFKS−−−−ETAPRSVQSPTQAPKKETAKPQP−−−KAI                                                                                            
fig|1224925.3.peg.1936   Staphylococcus aureus M0273       TKKEFIEWLK−−TSEGKQFNVDLWYAFQCFDYANAGWKALFGLLLKGVGAKDIPFA−−−NN−−FDGLATVYQNTPDFLAQPGDMVVFGSNYGAGYGHVAWVI−−EATLDYIIVYEQNWLGGGWTDGIEQPGWGWEKVTRRQHAY−−−−DFPMWFIRPNFKS−−−−ETAPRSVQSPTQAPKKETAKPQP                                                                                                  
fig|273036.3.peg.1646   Staphylococcus aureus RF122       TKKEFIEWLK−−TSEGKQYNADGWYGFQCFDYANAGWKALFGLLLKGVGAKDIPFA−−−NN−−FDGLATVYQNTPDFLAQPGDMVVFGSNYGAGYGHVAWVI−−EATLDYIIVYEQNWLGGGWTDGVQQPGSGWEKVTRRQHAY−−−−DFPMWFIRPNFKS−−−−ETAPRSVQSPTQASKKETAKPQP−−−KAVELKIIKDVVKG                                                                                 
fig|273036.6.peg.1804   Staphylococcus aureus RF122       TKKEFIEWLK−−TSEGKQYNADGWYGFQCFDYANAGWKALFGLLLKGVGAKDIPFA−−−NN−−FDGLATVYQNTPDFLAQPGDMVVFGSNYGAGYGHVAWVI−−EATLDYIIVYEQNWLGGGWTDGVQQPGSGWEKVTRRQHAY−−−−DFPMWFIRPNFKS−−−−ETAPRSVQSPTQASKKETAKPQP−−−KAVELKIIKDVVKG                                                                                 
fig|546342.4.peg.1927   Staphylococcus aureus subsp. aureus str. JKD6008       TKKEFIEWLK−−TSEGKQFNVDLWYGFQCFDYANAGWKVLFGLLLKGVGAKDIPFA−−−NN−−FDGLATVYQNTPDFLAQPGDMVVFGSNYGAGYGHVAWVI−−EATLDYIIVYEQNWLGGGWTDGIEQPGWGWEKVTRRQHAY−−−−DFPMWFIRPNFKS−−−−ETAPRSVQSPTQAPKKETAKPQP−−−KAI                                                                                            
fig|93061.5.peg.1832   Staphylococcus aureus subsp. aureus NCTC 8325       TKNEFIEWLK−−TSEGKQFNVDLWYGFQCFDYANAGWKVLFGLLLKGLGAKDIPFA−−−NN−−FDGLATVYQNTPDFLAQPGDMVVFGSNYGAGYGHVAWVI−−EATLDYIIVYEQNWLGGGWTDGIEQPGWGWEKVTRRQHAY−−−−DFPMWFIRPNFKS−−−−ETAPRSVQSPTQAPKKETAKPQP                                                                                                  
fig|418127.4.peg.837   Staphylococcus aureus subsp. aureus Mu3       TKKEFIEWLK−−TSEGKQFNVDLWYGFQCFDYANAGWKVLFGLLLKGLGAKDIPFA−−−NN−−FDGLATVYQNTPDFLAQPGDMVVFGSNYGAGYGHVAWVI−−EATLDYIIVYEQNWLGGGWTDRIEQPGWGWEKVTRRQHAY−−−−DFPMWFIRPNFKS−−−−ETAPRSIQSPTQASKKETAKPQP−−−KAVELKIIKDVVKG                                                                                 
fig|505321.3.peg.2666   Staphylococcus aureus subsp. aureus str. CF-Marseille       TKKEFIEWLK−−TSEGKQFNVDLWYGFQCFDYANAGWKVLFGLLLKGLGAKDIPFA−−−NN−−FDGLATVYQNTPDFLAQPGDMVVFGSNYGAGYGHVAWVI−−EATLDYIIVYEQNWLGGGWTDRIEQPGWGWEKVTRRQHAY−−−−DFPMWFIRPNFKS−−−−ETAPRSIQSPTQASKKETAKPQP−−−KAVELKIIKDVVKG                                                                                 
fig|585151.3.peg.1498   Staphylococcus aureus subsp. aureus C427       TKKEFIEWLK−−TSEGKQFNADLWYGFQCFDYANAGWKVLFGLLLKGLGAKDIPFA−−−NN−−FDGLATVYQNTPDFLAQPGDMVVFGSNYGAGYGHVAWVI−−EATLDYIIVYEQNWLGGGWTDGIEQPGWGWEKVTRRKHAY−−−−DFPMWFIRPNFKS−−−−EIAPRSVQSPTQAPKKETAKPQP                                                                                                  
fig|359786.13.peg.1152   Staphylococcus aureus subsp. aureus JH9       TKKDFIEWLK−−TSEGKQFNVDLWYGFQCFDYANAGWKVLFGLLLKGLGAKDIPFA−−−NN−−FDGLATVYQNTPDFLAQPGDMVVFGSNYGAGYGHVAWVI−−EATLDYIIVYEQNWLGGGWTDGIEQPGWGWEKVTRRQHAY−−−−DFPMWFIRPNFKS−−−−EITPRSVQSPTQAPKKETA                                                                                                      
fig|359787.3.peg.1782   Staphylococcus aureus subsp. aureus JH1       TKKDFIEWLK−−TSEGKQFNVDLWYGFQCFDYANAGWKVLFGLLLKGLGAKDIPFA−−−NN−−FDGLATVYQNTPDFLAQPGDMVVFGSNYGAGYGHVAWVI−−EATLDYIIVYEQNWLGGGWTDGIEQPGWGWEKVTRRQHAY−−−−DFPMWFIRPNFKS−−−−EITPRSVQSPTQAPKKETA                                                                                                      
fig|585155.3.peg.2405   Staphylococcus aureus subsp. aureus H19       TKKEFIEWLK−−TSEGKQFNVDLWYGFQCFDYANAGWKVLFGLLLKGLGAKDIPFA−−−NN−−FDGLATVYQNTPDFLAQPGDMVVFGSNYGAGYGHVAWVI−−EATLDYIIVYEQNWLGGGWTDGIEQPGWGWEKVTRRQHAY−−−−DFPMWFIRPNFKS−−−−EIAPRSVQSPTQAPKKETA                                                                                                      
fig|931437.3.peg.131   Staphylococcus aureus subsp. aureus CIG1500       TKKEFIEWLK−−TSEGKQFNADLWYGFQCFDYANAAWKVLFGLLLKGLGAKDIPFA−−−NN−−FDGLATVYQNTPDFLAQPGDMVVFGSNYGAGYGHVAWVI−−EATLDYIIVYEQNWLGGGWTDGIEQPGWGWEKVTRRQHAY−−−−DFPMWFIRPNFKS−−−−ETAPRSVQSPTQAPKKETAKPQP                                                                                                  
fig|1158682.3.peg.315   Staphylococcus aureus M0528       TKKEFIEWLK−−TSEGKQFNADLWYGFQCFDYANAAWKVLFGLLLKGLGAKDIPFA−−−NN−−FDGLATVYQNTPDFLAQPGDMVVFGSNYGAGYGHVAWVI−−EASLDYIIVYEQNWLGGGWTDGIEQPGWGWEKVTRRQHAY−−−−DFPMWFIRPNFKS−−−−ETAPRSVQSPTQAPKKETA                                                                                                      
fig|1158692.3.peg.43   Staphylococcus aureus M0687       TKKEFIEWLK−−TSEGKQFNADLWYGFQCFDYANAAWKVLFGLLLKGLGAKDIPFA−−−NN−−FDGLATVYQNTPDFLAQPGDMVVFGSNYGAGYGHVAWVI−−EASLDYIIVYEQNWLGGGWTDGIEQPGWGWEKVTRRQHAY−−−−DFPMWFIRPNFKS−−−−ETAPRSVQSPTQAPKKETA                                                                                                      
fig|359786.13.peg.412   Staphylococcus aureus subsp. aureus JH9       TKKEFIEWLK−−TSEGKQFNADLWYGFQCFDYANAAWKVLFGLLLKGLGAKDIPFA−−−NN−−FDGLATVYQNTPDFLAQPGDMVVFGSNYGAGYGHVAWVI−−EASLDYIIVYEQNWLGGGWTDGIEQPGWGWEKVTRRQHAY−−−−DFPMWFIRPNFKS−−−−ETAPRSVQSPTQAPKKETA                                                                                                      
fig|359787.3.peg.577   Staphylococcus aureus subsp. aureus JH1       TKKEFIEWLK−−TSEGKQFNADLWYGFQCFDYANAAWKVLFGLLLKGLGAKDIPFA−−−NN−−FDGLATVYQNTPDFLAQPGDMVVFGSNYGAGYGHVAWVI−−EASLDYIIVYEQNWLGGGWTDGIEQPGWGWEKVTRRQHAY−−−−DFPMWFIRPNFKS−−−−ETAPRSVQSPTQAPKKETA                                                                                                      
fig|458233.11.peg.1649   Macrococcus caseolyticus JCSC5402     MRTKQEAIKWIN−−NSIGKQYDFDGYFGFQCVDYSNAYWNYVTGGRLAGEGAKDLPFW−−−ND−−FKGVATVYKNTPSFLAQGGDIVVWGSTFGNGFGHTGVVI−−DANSNYIVVVEQNWLLGGWTQGDARGGTGWEKATKRIHDY−−−−HYDMWFIRPKFKNPIKASVSNMVKKATSVTKKKAPAKTT−−−KNKRIKVWSKTPHYKGVIKY−−−−−−−−NASLRQRSGSNFDNFNFNKEIGIVYQGETVYIFEEIQDEQGNIWCRTYSPSNNGWV           
fig|396513.4.peg.520   Staphylococcus carnosus subsp. carnosus TM300     IRTYKQAISYLK−−SMEGHAYNPDNAYGVQCFDLANQYWLYLFNHGLKGVGAADIPTW−−−NN−−FTNEATVYENTQSFQALPGDVVIFNRNYGEGYGHVGIVL−−KATLNSITILEQNWLGGAYWTP−−−−−−−−PEVATRRTHGY−−−−DFPMWFIRPFYAK−−−−STKLNAVKSKSKPARKAKANKGK−−−−−−−−−−−−−−−−−−−−−−KIMLVAGHGKGAYSNDPGAVANGYN                                                   
fig|1158682.3.peg.1052   Staphylococcus aureus M0528     VRTYSQAISYLK−−SLEGKAWNPDNAFGCQCFDTANQYWLYLFNHRLKGVGAADIPTW−−−ND−−FTNEATVYENTVSFQALPGDVVIFNRNYGGGYGHVGIVI−−SATLDSITILEQNWLGGAYWNP−−−−−−−−PEVTTRRTHGY−−−−DFPMWFIRPFYAK−−−−ETTANKLRSAVTPVKQDKLSKGK−−−−−−−−−−−−−−−−−−−−−−KIMLVAGHGIGAYSN                                                             
fig|1157005.3.peg.368   Staphylococcus aureus M0029     VRTYSQAISYLK−−SLEGKAWNPDNAFGCQCFDTANQYWLYLFNHRLKGVGAADIPTW−−−ND−−FTNEATVYENTVSFQALPGDVVIFNRNYGGGYGHVGIVI−−SATLDSITILEQNWLGGAYWSP−−−−−−−−PEVTTRRTHGY−−−−DFPMWFIRPFYAK−−−−ETTANKLRSAVKPVKQDKLSKGK−−−−−−−−−−−−−−−−−−−−−−KIMLVAGHGIGAYSN                                                             
fig|1158533.3.peg.376   Staphylococcus aureus M0510     VRTYSQAISYLK−−SLEGKAWNPDNAFGCQCFDTANQYWLYLFNHRLKGVGAADIPTW−−−ND−−FTNEATVYENTVSFQALPGDVVIFNRNYGGGYGHVGIVI−−SATLDSITILEQNWLGGAYWSP−−−−−−−−PEVTTRRTHGY−−−−DFPMWFIRPFYAK−−−−ETTANKLRSAVKPVKQDKLSKGK−−−−−−−−−−−−−−−−−−−−−−KIMLVAGHGIGAYSN                                                             
fig|1224925.3.peg.1675   Staphylococcus aureus M0273     VRTYSQAISYLK−−SLEGKAWNPDNAFGCQCFDTANQYWLYLFNHRLKGVGAADIPTW−−−ND−−FTNEATVYENTVSFQALPGDVVIFNRNYGGGYGHVGIVI−−SATLDSITILEQNWLGGAYWSP−−−−−−−−PEVTTRRTHGY−−−−DFPMWFIRPFYAK−−−−ETTANKLRSAVKPVKQDKLSKGK−−−−−−−−−−−−−−−−−−−−−−KIMLVAGHGIGAYSN                                                             
fig|359786.13.peg.981   Staphylococcus aureus subsp. aureus JH9     VRTYSQAISYLK−−SLEGKAWNPDNAFGCQCFDTANQYWLYLFNHRLKGVGAADIPTW−−−ND−−FTNEATVYENTVSFQALPGDVVIFNRNYGGGYGHVGIVI−−SATLDSITILEQNWLGGAYWSP−−−−−−−−PEVTTRRTHGY−−−−DFPMWFIRPFYAK−−−−ETTANKLRSAVKPVKQDKLSKGK−−−−−−−−−−−−−−−−−−−−−−KIMLVAGHGIGAYSN                                                             
fig|359787.3.peg.2533   Staphylococcus aureus subsp. aureus JH1     VRTYSQAISYLK−−SLEGKAWNPDNAFGCQCFDTANQYWLYLFNHRLKGVGAADIPTW−−−ND−−FTNEATVYENTVSFQALPGDVVIFNRNYGGGYGHVGIVI−−SATLDSITILEQNWLGGAYWSP−−−−−−−−PEVTTRRTHGY−−−−DFPMWFIRPFYAK−−−−ETTANKLRSAVKPVKQDKLSKGK−−−−−−−−−−−−−−−−−−−−−−KIMLVAGHGIGAYSN                                                             
fig|553580.3.peg.2809   Staphylococcus aureus A8819     VRTYSQAISYLK−−SLEGKAWNPDNAFGCQCFDTANQYWLYLFNHRLKGVGAADIPTW−−−ND−−FTNEATVYENTVSFQALPGDVVIFNRNYGGGYGHVGIVI−−SATLDSITILEQNWLGGAYWSP−−−−−−−−PEVTTRRTHGY−−−−DFPMWFIRPFYAK−−−−ETTANKLRSAVKPVKQDKLSKGK−−−−−−−−−−−−−−−−−−−−−−KIMLVAGHGIGAYSN                                                             
fig|931439.3.peg.1296   Staphylococcus aureus subsp. aureus CIG1750     VRTYSQAISYLK−−SLEGKAWNPDNAFGCQCFDTANQYWLYLFNHRLKGVGAADIPTW−−−ND−−FTNEATVYENTVSFQALPGDVVIFNRNYGGGYGHVGIVI−−SATLDSITILEQNWLGGAYWSP−−−−−−−−PEVTTRRTHGY−−−−DFPMWFIRPFYAK−−−−ETTANKLRSAVKPVKQDKLSKGK−−−−−−−−−−−−−−−−−−−−−−KIMLVAGHGIGAYSN                                                             
fig|931437.3.peg.2297   Staphylococcus aureus subsp. aureus CIG1500     LMTKNQAEKWFD−−NSLGKQFNPDGWYGFQCYDYANMFFMLATGERLQGLYAYNIPFD−−−NKAKIEKYGQIIKNYDSFLPQKLDIVVFPSKYGGGAGHVEIVE−−SANLNTFTSFGQNWNGKGWTNGVAQPGWGPETVTRRVHYY−−−−DNPMYFIRLNFPNN−−−LSVGNKAKGIIKQATTK                                                                                                        
fig|1157005.3.peg.1617   Staphylococcus aureus M0029     LMTKNQAEKWFD−−NSLGKQFNPDGWYGFQCYDYANMFFMLATGERLQGLYAYNIPFD−−−NKAKIEKYGQIIKNYDSFLPQKLDIVVFPSKYGGGAGHVEIVE−−SANLNTFTSFGQNWNGKGWTNGVAQPGWGPETVTRHVHYY−−−−DNPMYFIRLNFPNN−−−LSVGNKAKGIIKQATTK                                                                                                        
fig|1169274.3.peg.1405   Staphylococcus aureus M1309     LMTKNQAEKWFD−−NSLGKQFNPDGWYGFQCYDYANMFFMLATGERLQGLYAYNIPFD−−−NKAKIEKYGQIIKNYDSFLPQKLDIVVFPSKYGGGAGHVEIVE−−SANLNTFTSFGQNWNGKGWTNGVAQPGWGPETVTRHVHYY−−−−DNPMYFIRLNFPNN−−−LSVGNKAKGIIKQATTK                                                                                                        
fig|904726.3.peg.1458   Staphylococcus aureus subsp. aureus 21193     LMTKNQAEKWFD−−NSLGKQFNPDGWYGFQCYDYANMFFMLATGERLQGLYAYNIPFD−−−NKAKIEKYGQIIKNYDSFLPQKLDIVVFPSKYGGGAGHVEIVE−−SANLNTFTSFGQNWNGKGWTNGVAQPGWGPETVTRHVHYY−−−−DNPMYFIRLNFPNN−−−LSVGNKAKGIIKQATTK                                                                                                        
fig|93062.4.peg.848   Staphylococcus aureus subsp. aureus COL     LMTKNQAEKWFD−−NSLGKQFNPDGWYGFQCYDYANMFFMLATGERLQGLYAYNIPFD−−−NKAKIEKYGQIIKNYDSFLPQKLDIVVFPSKYGGGAGHVEIVE−−SANLNTFTSFGQNWNGKGWTNGVAQPGWGPETVTRHVHYY−−−−DNPMYFIRLNFPNN−−−LSVGNKAKGIIKQATTK                                                                                                        
fig|931439.3.peg.1949   Staphylococcus aureus subsp. aureus CIG1750     LMTKNQAEKWFD−−NSLGKQFNPDGWYGFQCYDYANMFFMLATGERLQGLYAYNIPFD−−−NKAKIEKYGQIIKNYDSFLPQKLDIVVFPSKYGGGAGHVEIVE−−SANLNTFTSFGQNWNGKGWTNGVAQPGWGPETVTRHVHYY−−−−DNPMYFIRLNFPNN−−−LSVGNKAKGIIKQATTK                                                                                                        
fig|426430.6.peg.1713   Staphylococcus aureus subsp. aureus str. Newman     LMTKNQAEKWFD−−NSLGKQFNPDGWYGFQCYDYANMFFMLATGERLQGLYAYNIPFD−−−NKAKIEKYGQIIKNYDSFLPQKLDIVVFPSKYGGGAGHVEIVE−−SANLNTFTSFGQNWNGKGWTNGVAQPGWGPETVTRHVHYY−−−−DNPMYFIRLNFPNN−−−LSVGNKAKGIIKQATTK                                                                                                        
fig|426430.6.peg.314   Staphylococcus aureus subsp. aureus str. Newman     LMTKNQAEKWFD−−NSLGKQFNPDGWYGFQCYDYANMFFMLATGERLQGLYAYNIPFD−−−NKAKIEKYGQIIKNYDSFLPQKLDIVVFPSKYGGGAGHVEIVE−−SANLNTFTSFGQNWNGKGWTNGVAQPGWGPETVTRHVHYY−−−−DNPMYFIRLNFPNN−−−LSVGNKAKGIIKQATTK                                                                                                        
fig|904753.3.peg.1144   Staphylococcus aureus subsp. aureus 21282     LMTKNQAEKWFD−−NSLGKQFNPDGWYGFQCYDYANMFFMLATGERLQGLYAYNIPFD−−−NKAKIEKYGQIIKNYDSFLPQKLDIVVFPSKYGGGAGHVEIVE−−SANLNTFTSFGQNWNGKGWTNGVAQPGWGPETVTRHVHYY−−−−DNPMYFIRLNFPNN−−−LSVGNKAKGIIKQATTK                                                                                                        
fig|1231383.3.peg.1619   Staphylococcus aureus KT/314250       TKNQAEKWFD−−NSLGKQFNPDLFYGFQCYDYANMFFMLATGERLQGLYAYNIPFD−−−NKAKIEKYGQIIKNYDSFLPQKLDIVVFPSKYGGGAGHVEIVE−−SANLNTFTSFGQNWNGKGWTNGVAQPGWGPETVTRHVHYY−−−−DNPMYFIRLNFPNN−−−LSVGNKAKGIIKQATTK                                                                                                        
fig|904776.3.peg.1152   Staphylococcus aureus subsp. aureus IS-24       TKNQAEKWFD−−NSLGKQFNPDLFYGFQCYDYANMFFMLATGERLQGLYAYNIPFD−−−NKAKIEKYGQIIKNYDSFLPQKLDIVVFPSKYGGGAGHVEIVE−−SANLNTFTSFGQNWNGKGWTNGVAQPGWGPETVTRHVHYY−−−−DNPMYFIRLNFPNN−−−LSVGNKAKGIIKQATTK                                                                                                        
fig|553590.4.peg.515   Staphylococcus aureus A9754       TKNQAEKWFD−−NSLGKQFNPDLFYGFQCYDYANMFFMLATGERLQGLYAYNIPFD−−−NKAKIEKYGQIIKNYDSFLPQKLDIVVFPSKYGGGAGHVEIVE−−SANLNTFTSFGQNWNGKGWTNGVAQPGWGPETVTRHVHYY−−−−DNPMYFIRLNFPNN−−−LSVGNKAKGIIKQATTK                                                                                                        
fig|904783.3.peg.1582   Staphylococcus aureus subsp. aureus IS-122     LMTKNQAEKWFD−−NSLGKQFNP