(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00009415

fig|525246.3.peg.1256   Actinomyces urogenitalis DSM 15434     AQTTVSTVT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EDSEQAFETVREETASLPEGVTQVKTAGVNGVVRTTYQVTSQGG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QEASREVLSQVTVTPATQEVI−−LVGTASASSATTS−−−−−−−−−−−−−−−−−−−−−−−−−TTADSSAGAASGDVWAALAQCESGGNPATNTGNGYYGMYQFSLSTWQALGGTGLPSE−−−ASAEA−−−QTAMAQKLQARSGWGQW   
fig|525909.11.peg.190   Acidimicrobium ferrooxidans DSM 10331     SAYEQAGLEIEVTQAALAA−−−−−−−RVRATEAELVQDQAQRAQLSQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RVAATEAELAQVHSQLASAI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AAEAAAPLPAPGGAAQAVQVL−−LAPPPPSPTSLSG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PATAAQLLALRDCESGGNYQADTGNGYYGAYQFAASTWAALGYGGLPNQ−−−APPAV−−−QDQAAEQLLARAGWGQW   
fig|479431.5.peg.2324   Nakamurella multipartita DSM 44233                                                                                                                                       TQQGSAGTDSVTYEVTTTNG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AESAKTEVSRTTVTPAQATVI−−TVGTKKPVSTSSASTGSSSGSSSSSSSNSGSSSSSSSSAAPVSSSGSSGINWEGIAQCESTGNWSINTGNGYYGGLQFDNSTWASGGGTAYAPRADLATKEQ−−−QIAVAENVAASRGSSPWACA
fig|591158.3.peg.6895   Streptomyces sp. AA4     QVDT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NAVTTKELVSDLKLNLGPDDAIEGGLDVSLKNGAEVHVSRMGVS−−−−MVNQEETIDPDVQKVDDPTQLQGQQSVEDPGTPGKKLVTYKVTKKNG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EEIAREQVSEKVLVEAKSKII−−KVGTKKPPAPAIG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DTGAWDRIAQCESGGNWSINTGNGYYGGLQFDRQTWNAYGGQQYAPTADKATREQ−−−QIAIAEKVRDARGGYSAW   
fig|479433.4.peg.7727   Catenulispora acidiphila DSM 44928                                                                                       TFPTNGETITVDRVTGT−−−−QETKQVPIAFSTTEQSDPSAYVGSRTTVSSGTQGVQEVVYAYLTVNG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VKQAPKIVSKTVTKQPVNAVV−−KVGTKPVPTTVA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GADNLNWAGVAQCESGGNPKSVGGGGLYFGLYQFSVSTWAAMGGSGLPSN−−−ATPAE−−−QTYRAKLLYVRSGAGQW   
fig|465541.3.peg.4375   Streptomyces sp. Mg1                                                            NAATVQEALDQAGVTLHDQDTTSVPPGSFPRDGQTVTVLRISGT−−−−REVREERIPYETQRIDDATLFAGTEVVEQAGRPGARRVTYSLRTVNG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHEKARRIAEETVREPVTQRV−−LVGTRTLPASVA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GADGLDWAALAQCESGGRPDATDPSGTYGGLYQFDVRTWQALGGSGRPQD−−−APGQE−−−QTYRAKKLYVQRGATPW   
fig|253839.3.peg.2362   Streptomyces sp. C                                                            NAATVKEALDQAGITLHGQDTTSVPPDSFPRDGQTVTVLRITGT−−−−REVREERIPYATERVEDAGLFAGTEVVDRVGRPGARRVTYALRTVNG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VRQQPRKIAEEVVREPVSQRV−−LVGTKPLPTSVA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GADGLNWSGLAQCESGGRPSATDPSGTYGGLYQFDVSTWQALGGSGRPQD−−−APASE−−−QTYRAKKLYVQRGASPW   
fig|479435.6.peg.6510   Kribbella flavida DSM 17836            SIAGLGAGITAVGAGA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AFATDYTVKSGDTLSEIAQANGTDWHQLAELNGLDNPDLILIGQTLKLDGVNKAAVTERRSTAKTERKTERRSERKVEARSERKTER−−KSERKSERKSERK−−−−−−−−−−−−−−−−−ARTSRSESTRGGNGGSVSMSAAWRKVAQCESGGNPRAVNPTGKYHGLFQFDRQTWRSVGGSGLPSN−−−ASAAE−−−QLMRAKKLYSQRGASPW   
fig|525367.9.peg.2198   Listeria grayi DSM 20601     MKKAFVAVVAGLIIAGASST−−−−−−PTFAAEVKVQ−−−−−−−−−−−−−−−−−−−KGDSLWKVSKTHNVSINDLKKENNLKSNIVFPGQVLKINEGSSN−−−−−−−−−−−−−−−−−−VSKYKVVQGDTLSHIAKKKNVSVANLKSWNKLSSDLIVTGQVLTIGGTNNEAPTVA−−−−−−−ATPAPAPKQQVPAQPAPKQAQ−−PAENKQQASTASE−−−−−−−−−−−−−−−−−−−−−−−−−AKPAASSNNSSAKAW−−IAQRESGGSYSARN−−GRYVGKYQLDAS                                              
fig|458233.11.peg.1891   Macrococcus caseolyticus JCSC5402     MKKLLAVTTVFAVGGTFAAT−−−−−−QADAAQYRVK−−−−−−−−−−−−−−−−−−−SGDSLWKISQIYGTSVQALKHENRLRSNLIHVNQVLNINENTTQRKTYKSAYKPTYTAPVTTGSYYRIVPGDTLGKIASRYGVSVAQLKAWNGLHSDIIIAGRTLKVNGPAVAAAPVRRTAY−−−QAPVKRAVAKSTYQAPVRQTVY−−NASTTKRVTTTRT−−−−−−−−−−−−−−−−−−−−−−−−−−−QAPAVRVNNGLNWAALARCESGGNPSINTGNGYYGMYQFNLQTWRGVGGSGYPHQ−−−ASAAE−−−QTKRAQILYNMRGAQPW   
fig|458233.11.peg.1892   Macrococcus caseolyticus JCSC5402     WNSIETNKALKVGKLI−−−−−−−−−−IVDKDEKRQIVTQTAAQQAPV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TVQQTVAYQAPAVKAPEQAAKPAAQAA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KPAAQKPVQQVAQQPAAQQPQ−−QVAQQPQQAAQKP−−−−−−−−−−−−−−−−−−−−−−−−VAQAAPAGNSSMDAHLRVIAQRESGGNPNAVNPSGYYGLFQFSPSTWASVGGTGNPAN−−−ASVEE−−−QWKRARILYQTAGASQWSTA
fig|1158477.3.peg.1461   Staphylococcus aureus M1216     MKKTLLASSLAVGLGIVAGNAGH−−−EAHASEADLNKASLAQMAQ−−−−−−−−SNDQTLNQKPIEAGAYNYTFDYEGFTYHFESDGTHFAWNYHATG−−−−−−−−−−−−−−ANGANMSAQAPATNNVEPSAVQANQVQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SQEVEAP−−−−−−QNAQTQQPQ−−ASTSNNSQVTATP−−−−−−−−−−−−−−−−−−−−−−−TESKASEGSSVNVNAHLKQIAQRESGGNIHAVNPTSGAAGKYQFLQSTWDSVAPAKYKGVSPANAPESV−−−QDAAAVKLYNTGGAGHWVTA
fig|1158486.3.peg.1591   Staphylococcus aureus M1320     MKKTLLASSLAVGLGIVAGNAGH−−−EAHASEADLNKASLAQMAQ−−−−−−−−SNDQTLNQKPIEAGAYNYTFDYEGFTYHFESDGTHFAWNYHATG−−−−−−−−−−−−−−ANGANMSAQAPATNNVEPSAVQANQVQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SQEVEAP−−−−−−QNAQTQQPQ−−ASTSNNSQVTATP−−−−−−−−−−−−−−−−−−−−−−−TESKASEGSSVNVNAHLKQIAQRESGGNIHAVNPTSGAAGKYQFLQSTWDSVAPAKYKGVSPANAPESV−−−QDAAAVKLYNTGGAGHWVTA
fig|450394.6.peg.2617   Staphylococcus aureus subsp. aureus USA300_TCH959     MKKTLLASSLAVGLGIVAGNAGH−−−EAHASEADLNKASLAQMAQ−−−−−−−−SNDQTLNQKPIEAGAYNYTFDYEGFTYHFESDGTHFAWNYHATG−−−−−−−−−−−−−−ANGANMSAQAPATNNVEPSAVQANQVQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SQEVEAP−−−−−−QNAQTQQPQ−−ASTSNNSQVTATP−−−−−−−−−−−−−−−−−−−−−−−TESKASEGSSVNVNAHLKQIAQRESGGNIHAVNPTSGAAGKYQFLQSTWDSVAPAKYKGVSPANAPESV−−−QDAAAVKLYNTGGAGHWVTA
fig|505321.3.peg.2735   Staphylococcus aureus subsp. aureus str. CF-Marseille     MKKTLLASSLAVGLGIVAGNAGH−−−EAHASEADLNKASLAQMAQ−−−−−−−−SNDQTLNQKPIEAGAYNYTFDYEGFTYHFESDGTHFAWNYHATG−−−−−−−−−−−−−−ANGANMSAQAPATNNVEPSAVQANQVQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SQEVEAP−−−−−−QNAQTQQPQ−−ASTSNNSQVTATP−−−−−−−−−−−−−−−−−−−−−−−TESKASEGSSVNVNAHLKQIAQRESGGNIHAVNPTSGAAGKYQFLQSTWDSVAPAKYKGVSPANAPESV−−−QDAAAVKLYNTGGAGHWVTA
fig|889933.4.peg.1886   Staphylococcus aureus subsp. aureus ECT-R 2     MKKTLLASSLAVGLGIVAGNAGH−−−EAHASEADLNKASLAQMAQ−−−−−−−−SNDQTLNQKPIEAGAYNYTFDYEGFTYHFESDGTHFAWNYHATG−−−−−−−−−−−−−−ANGANMSAQAPATNNVEPSAVQANQVQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SQEVEAP−−−−−−QNAQTQQPQ−−ASTSNNSQVTATP−−−−−−−−−−−−−−−−−−−−−−−TESKASEGSSVNVNAHLKQIAQRESGGNIHAVNPTSGAAGKYQFLQSTWDSVAPAKYKGVSPANAPESV−−−QDAAAVKLYNTGGAGHWVTA
fig|904731.3.peg.1438   Staphylococcus aureus subsp. aureus 21201     MKKTLLASSLAVGLGIVAGNAGH−−−EAHASEADLNKASLAQMAQ−−−−−−−−SNDQTLNQKPIEAGAYNYTFDYEGFTYHFESDGTHFAWNYHATG−−−−−−−−−−−−−−ANGANMSAQAPATNNVEPSAVQANQVQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SQEVEAP−−−−−−QNAQTQQPQ−−ASTSNNSQVTATP−−−−−−−−−−−−−−−−−−−−−−−TESKASEGSSVNVNAHLKQIAQRESGGNIHAVNPTSGAAGKYQFLQSTWDSVAPAKYKGVSPANAPESV−−−QDAAAVKLYNTGGAGHWVTA
fig|553601.3.peg.2389   Staphylococcus aureus A10102     MKKTLLASSLAVGLGIVAGNAGH−−−EAHASEADLNKASLAQMAQ−−−−−−−−SNDQTLNQKPIEAGAYNYTFDYEGFTYHFESDGTHFAWNYHATG−−−−−−−−−−−−−−ANGANMSAQAPATNNVEPSAVQANQVQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SQEVEAP−−−−−−QNAQTQQPQ−−ASTSNNSQVTATP−−−−−−−−−−−−−−−−−−−−−−−TESKASEGSSVNVNAHLKQIAQRESGGNIHAVNPTSGAAGKYQFLQSTWDSVAPAKYKGVSPANAPESV−−−QDAAAVKLYNTGGTGHWVTA
fig|1028799.3.peg.1856   Staphylococcus aureus subsp. aureus VC40     MKKTLLASSLAVGLGIVAGNAGH−−−EAHASEADLNKASLAQMAQ−−−−−−−−SNDQTLNQKPIEAGAYNYTFDYEGFTYHFESDGTHFAWNYHATG−−−−−−−−−−−−−−TNGADMSAQAPATNNVAPSAVQANQVQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SQEVEAP−−−−−−QNAQTQQPQ−−ASTSNNSQVTATP−−−−−−−−−−−−−−−−−−−−−−−TESKSSEGSSVNVNAHLKQIAQRESGGNIHAVNPTSGAAGKYQFLQSTWDSVAPAKYKGVSPANAPESV−−−QDAAAVKLYNTGGAGHWVTA
fig|452948.4.peg.1686   Staphylococcus aureus 930918-3     MKKTLLASSLAVGLGIVAGNAGH−−−EAHASEADLNKASLAQMAQ−−−−−−−−SNDQTLNQKPIEAGAYNYTFDYEGFTYHFESDGTHFAWNYHATG−−−−−−−−−−−−−−TNGADMSAQAPATNNVAPSAVQANQVQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SQEVEAP−−−−−−QNAQTQQPQ−−ASTSNNSQVTATP−−−−−−−−−−−−−−−−−−−−−−−TESKSSEGSSVNVNAHLKQIAQRESGGNIHAVNPTSGAAGKYQFLQSTWDSVAPAKYKGVSPANAPESV−−−QDAAAVKLYNTGGAGHWVTA
fig|455227.3.peg.1283   Staphylococcus aureus D30     MKKTLLASSLAVGLGIVAGNAGH−−−EAHASEADLNKASLAQMAQ−−−−−−−−SNDQTLNQKPIEAGAYNYTFDYEGFTYHFESDGTHFAWNYHATG−−−−−−−−−−−−−−TNGADMSAQAPATNNVAPSAVQANQVQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SQEVEAP−−−−−−QNAQTQQPQ−−ASTSNNSQVTATP−−−−−−−−−−−−−−−−−−−−−−−TESKSSEGSSVNVNAHLKQIAQRESGGNIHAVNPTSGAAGKYQFLQSTWDSVAPAKYKGVSPANAPESV−−−QDAAAVKLYNTGGAGHWVTA
fig|904784.3.peg.418   Staphylococcus aureus subsp. aureus IS-125     MKKTLLASSLAVGLGIVAGNAGH−−−EAHASEADLNKASLAQMAQ−−−−−−−−SNDQTLNQKPIEAGAYNYTFDYEGFTYHFESDGTHFAWNYHATG−−−−−−−−−−−−−−TNGADMSAQAPATNNVAPSAVQANQVQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SQEVEAP−−−−−−QNAQTQQPQ−−ASTSNNSQVTATP−−−−−−−−−−−−−−−−−−−−−−−TESKSSEGSSVNVNAHLKQIAQRESGGNIHAVNPTSGAAGKYQFLQSTWDSVAPAKYKGVSPANAPESV−−−QDAAAVKLYNTGGAGHWVTA
fig|93062.19.peg.2033   Staphylococcus aureus subsp. aureus COL     MKKTLLASSLAVGLGIVAGNAGH−−−EAHASEADLNKASLAQMAQ−−−−−−−−SNDQTLNQKPIEAGAYNYTFDYEGFTYHFESDGTHFAWNYHATG−−−−−−−−−−−−−−TNGADMSAQAPTTNNVAPSAVQANQVQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SQEVEAP−−−−−−QNAQTQQPQ−−ASTSNNSQVTATP−−−−−−−−−−−−−−−−−−−−−−−TESKSSEGSSVNVNAHLKQIAQRESGGNIHAVNPTSGAAGKYQFLQSTWDSVAPAKYKGVSPANAPESV−−−QDAAAVKLYNTGGAGHWVTA
fig|1123523.3.peg.2049   Staphylococcus aureus subsp. aureus 11819-97     MKKTLLASSLAVGLGIVAGNAGH−−−EAHASEADLNKASLAQMAQ−−−−−−−−SNDQTLNQKPIEAGAYNYTFDYEGFTYHFESDGTHFAWNYHATG−−−−−−−−−−−−−−ANGADMSAQAPATNNVAPSAVQANQVQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SQEVEAP−−−−−−QNAQTQQPQ−−ASTSNNSQVTATP−−−−−−−−−−−−−−−−−−−−−−−TESKASEGSSVNVNAHLKQIAQRESGGNIHAVNPTSGAAGKYQFLQSTWDSVAPAKYKGVSPANAPESV−−−QDAAAVKLYNTGGAGHWVTA
fig|904747.3.peg.36   Staphylococcus aureus subsp. aureus 21266     MKKTLLASSLAVGLGIVAGNAGH−−−EAHASEADLNKASLAQMAQ−−−−−−−−SNDQTLNQKPIEAGAYNYTFDYEGFTYHFESDGTHFAWNYHATG−−−−−−−−−−−−−−ANGADMSAQAPATNNVAPSAVQANQVQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SQEVEAP−−−−−−QNAQTQQPQ−−ASTSNNSQVTATP−−−−−−−−−−−−−−−−−−−−−−−TESKASEGSSVNVNAHLKQIAQRESGGNIHAVNPTSGAAGKYQFLQSTWDSVAPAKYKGVSPANAPESV−−−QDAAAVKLYNTGGAGHWVTA
fig|931460.3.peg.2053   Staphylococcus aureus subsp. aureus CIGC93     MKKTLLASSLAVGLGIVAGNAGH−−−EAHASEADLNKASLAQMAQ−−−−−−−−SNDQTLNQKPIEAGAYNYTFDYEGFTYHFESDGTHFAWNYHATG−−−−−−−−−−−−−−ANGADMSAQAPATNNVAPSAVQANQVQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SQEVEAP−−−−−−QNAQTQQPQ−−ASTSNNSQVTATP−−−−−−−−−−−−−−−−−−−−−−−TESKASEGSSVNVNAHLKQIAQRESGGNIHAVNPTSGAAGKYQFLQSTWDSVAPAKYKGVSPANAPESV−−−QDAAAVKLYNTGGAGHWVTA
fig|273036.6.peg.2087   Staphylococcus aureus RF122     MKKTLLASSLAVGLGIVAGNAGH−−−EAHASEADLNKASLAQMAQ−−−−−−−−SNDQTLNQKPIEAGAYNYTFDYEGFTYHFESDGTHFAWNYHATG−−−−−−−−−−−−−−ANGADMSAQAPATNNVAPSADQANQVQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SQEVEAP−−−−−−QNAQTQQPQ−−ASTSNNSQVTATP−−−−−−−−−−−−−−−−−−−−−−−TESKASEGSSVNVNDHLKQIAQRESGGNIHAVNPTSGAAGKYQFLQSTWDSVAPAKYKGVSPANAPESV−−−QDAAAVKLYNTGGAGHWVTA
fig|985006.4.peg.1915   Staphylococcus aureus subsp. aureus LGA251     MKKTLLASSLAVGLGIVAGNAGH−−−EAHASEADLNKASLAQMAQ−−−−−−−−SNDQTLNQKPIEAGAYNYTFDYEGFTYHFESDGTHFAWNYHATG−−−−−−−−−−−−−−ANGADMSAQAPATNNVAPSADQANQVQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SQEVEAP−−−−−−QNAQTQQPQ−−ASTSNNSQVTATP−−−−−−−−−−−−−−−−−−−−−−−TESKASEGSSVNVNDHLKQIAQRESGGNIHAVNPTSGAAGKYQFLQSTWDSVAPAKYKGVSPANAPESV−−−QDAAAVKLYNTGGAGHWVTA
fig|548470.3.peg.2246   Staphylococcus aureus subsp. aureus MN8     MKKTLLASSLAVGLGIVAGNAGH−−−EAQASEADLNKASLAQMAQ−−−−−−−−SNDQTLNQKPIEAGAYNYTFDYEGFTYHFESDGTHFAWNYHATG−−−−−−−−−−−−−−ANGADMSAQAPATNNVAPSADQSNQVQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SQEVEAP−−−−−−QNAQTQQPQ−−ASTSNNSQVTATP−−−−−−−−−−−−−−−−−−−−−−−TESKASEGSSVNVNDHLKQIAQRESGGNIHAVNPTSGAAGKYQFLQSTWDSVAPAKYKGVSPANAPESV−−−QDAAAVKLYNTGGAGHWVTA
fig|548473.3.peg.2472   Staphylococcus aureus subsp. aureus TCH60     MKKTLLASSLAVGLGIVAGNAGH−−−EAQASEADLNKASLAQMAQ−−−−−−−−SNDQTLNQKPIEAGAYNYTFDYEGFTYHFESDGTHFAWNYHATG−−−−−−−−−−−−−−ANGADMSAQAPATNNVAPSADQSNQVQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SQEVEAP−−−−−−QNAQTQQPQ−−ASTSNNSQVTATP−−−−−−−−−−−−−−−−−−−−−−−TESKASEGSSVNVNDHLKQIAQRESGGNIHAVNPTSGAAGKYQFLQSTWDSVAPAKYKGVSPANAPESV−−−QDAAAVKLYNTGGAGHWVTA
fig|548473.6.peg.1068   Staphylococcus aureus subsp. aureus TCH60     MKKTLLASSLAVGLGIVAGNAGH−−−EAQASEADLNKASLAQMAQ−−−−−−−−SNDQTLNQKPIEAGAYNYTFDYEGFTYHFESDGTHFAWNYHATG−−−−−−−−−−−−−−ANGADMSAQAPATNNVAPSADQSNQVQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SQEVEAP−−−−−−QNAQTQQPQ−−ASTSNNSQVTATP−−−−−−−−−−−−−−−−−−−−−−−TESKASEGSSVNVNDHLKQIAQRESGGNIHAVNPTSGAAGKYQFLQSTWDSVAPAKYKGVSPANAPESV−−−QDAAAVKLYNTGGAGHWVTA
fig|585149.6.peg.2265   Staphylococcus aureus subsp. aureus C101     MKKTLLASSLAVGLGIVAGNAGH−−−EAQASEADLNKASLAQMAQ−−−−−−−−SNDQTLNQKPIEAGAYNYTFDYEGFTYHFESDGTHFAWNYHATG−−−−−−−−−−−−−−ANGADMSAQAPATNNVAPSADQSNQVQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SQEVEAP−−−−−−QNAQTQQPQ−−ASTSNNSQVTATP−−−−−−−−−−−−−−−−−−−−−−−TESKASEGSSVNVNDHLKQIAQRESGGNIHAVNPTSGAAGKYQFLQSTWDSVAPAKYKGVSPANAPESV−−−QDAAAVKLYNTGGAGHWVTA
fig|585150.3.peg.2721   Staphylococcus aureus subsp. aureus C160     MKKTLLASSLAVGLGIVAGNAGH−−−EAQASEADLNKASLAQMAQ−−−−−−−−SNDQTLNQKPIEAGAYNYTFDYEGFTYHFESDGTHFAWNYHATG−−−−−−−−−−−−−−ANGADMSAQAPATNNVAPSADQSNQVQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SQEVEAP−−−−−−QNAQTQQPQ−−ASTSNNSQVTATP−−−−−−−−−−−−−−−−−−−−−−−TESKASEGSSVNVNDHLKQIAQRESGGNIHAVNPTSGAAGKYQFLQSTWDSVAPAKYKGVSPANAPESV−−−QDAAAVKLYNTGGAGHWVTA
fig|585151.3.peg.1807   Staphylococcus aureus subsp. aureus C427     MKKTLLASSLAVGLGIVAGNAGH−−−EAQASEADLNKASLAQMAQ−−−−−−−−SNDQTLNQKPIEAGAYNYTFDYEGFTYHFESDGTHFAWNYHATG−−−−−−−−−−−−−−ANGADMSAQAPATNNVAPSADQSNQVQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SQEVEAP−−−−−−QNAQTQQPQ−−ASTSNNSQVTATP−−−−−−−−−−−−−−−−−−−−−−−TESKASEGSSVNVNDHLKQIAQRESGGNIHAVNPTSGAAGKYQFLQSTWDSVAPAKYKGVSPANAPESV−−−QDAAAVKLYNTGGAGHWVTA
fig|585159.3.peg.2193   Staphylococcus aureus subsp. aureus M899     MKKTLLASSLAVGLGIVAGNAGH−−−EAQASEADLNKASLAQMAQ−−−−−−−−SNDQTLNQKPIEAGAYNYTFDYEGFTYHFESDGTHFAWNYHATG−−−−−−−−−−−−−−ANGADMSAQAPATNNVAPSADQSNQVQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SQEVEAP−−−−−−QNAQTQQPQ−−ASTSNNSQVTATP−−−−−−−−−−−−−−−−−−−−−−−TESKASEGSSVNVNDHLKQIAQRESGGNIHAVNPTSGAAGKYQFLQSTWDSVAPAKYKGVSPANAPESV−−−QDAAAVKLYNTGGAGHWVTA
fig|585160.3.peg.1579   Staphylococcus aureus subsp. aureus WBG10049     MKKTLLASSLAVGLGIVAGNAGH−−−EAQASEADLNKASLAQMAQ−−−−−−−−SNDQTLNQKPIEAGAYNYTFDYEGFTYHFESDGTHFAWNYHATG−−−−−−−−−−−−−−ANGADMSAQAPATNNVAPSADQSNQVQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SQEVEAP−−−−−−QNAQTQQPQ−−ASTSNNSQVTATP−−−−−−−−−−−−−−−−−−−−−−−TESKASEGSSVNVNDHLKQIAQRESGGNIHAVNPTSGAAGKYQFLQSTWDSVAPAKYKGVSPANAPESV−−−QDAAAVKLYNTGGAGHWVTA
fig|904728.3.peg.830   Staphylococcus aureus subsp. aureus 21195     MKKTLLASSLAVGLGIVAGNAGH−−−EAQASEADLNKASLAQMAQ−−−−−−−−SNDQTLNQKPIEAGAYNYTFDYEGFTYHFESDGTHFAWNYHATG−−−−−−−−−−−−−−ANGADMSAQAPATNNVAPSADQSNQVQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SQEVEAP−−−−−−QNAQTQQPQ−−ASTSNNSQVTATP−−−−−−−−−−−−−−−−−−−−−−−TESKASEGSSVNVNDHLKQIAQRESGGNIHAVNPTSGAAGKYQFLQSTWDSVAPAKYKGVSPANAPESV−−−QDAAAVKLYNTGGAGHWVTA
fig|931437.3.peg.2860   Staphylococcus aureus subsp. aureus CIG1500     MKKTLLASSLAVGLGIVAGNAGH−−−EAQASEADLNKASLAQMAQ−−−−−−−−SNDQTLNQKPIEAGAYNYTFDYEGFTYHFESDGTHFAWNYHATG−−−−−−−−−−−−−−ANGADMSAQAPATNNVAPSADQSNQVQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SQEVEAP−−−−−−QNAQTQQPQ−−ASTSNNSQVTATP−−−−−−−−−−−−−−−−−−−−−−−TESKASEGSSVNVNDHLKQIAQRESGGNIHAVNPTSGAAGKYQFLQSTWDSVAPAKYKGVSPANAPESV−−−QDAAAVKLYNTGGAGHWVTA
fig|553583.3.peg.421   Staphylococcus aureus A9635     MKKTLLASSLAVGLGIVAGNAGH−−−EAHASESDLNKASLAQMAQ−−−−−−−−SNDQTLNQKPIEAGAYNYTFDYEGFTYHFESDGTYFAWNYHATG−−−−−−−−−−−−−−ANGADMSAQAPATNNVAPSADQANQVQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SQEVEAP−−−−−−QNAQTQQPQ−−ASTSNNSQVTATP−−−−−−−−−−−−−−−−−−−−−−−TESKASEGSSVNVNDHLKQIAQRESGGNIHAVNPTSGAAGKYQFLQSTWDSVAPAKYKGVSPANAPESV−−−QDAAAVKLYNTGGAGHWVTA
fig|629742.3.peg.763   Staphylococcus hominis SK119     MKKTIIASSLAVGLGLVAGNVSH−−−−ADASENQINKEKLAQLAE−−−−−−−−SNDQSLNQHPIQEGAYNYQFNLNGKTYHFWSDGTYFKWEYYPSNGSTVNSANQNVASTQTAQNVSYQNNNYKNINQSASTSNVSQHYANE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AQTQQAP−−−−−−KTTQTKQATQTQQAPANATTNQPK−−−−−−−−−−−−−−−−−−−−−−−−−−QSTSGSSVNVNSHLQQIAQRESGGDIHAINPSSGAAGKYQFLQSTWDSVAPAQYKGVSPAQAPESV−−−QDAAAVKLYNTAGPSQWVTA
fig|1034809.4.peg.959   Staphylococcus lugdunensis N920143     MKKTIIASSLAVGLGLVAGNAGH−−−DADASELNVNTKAELAQLAQ−−−−−−−−SNDQSLNEKPVQSGAYDFTFNYEGTTYHFASDGTYFEWQYYPSN−−−−−−−−−−−−−−GAADDTTMNSQAQQGTMSSSQGAATQQSTSAQP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AQTEQAP−−−−−−QSESTQQPQ−−TQATSHSQSSSAS−−−−−−−−−−−−−−−−−−−−−−−−−−QASSHSSVNVNSHLKAIAQRESGGDIHAVNPSSGAAGKYQFMQSTWDHVAPSEYKGVSPANAPEHV−−−QDAAAQKLYDTEGAGHWTTA
fig|698737.3.peg.909   Staphylococcus lugdunensis HKU09-01     MKKTIIASSLAVGLGLVAGNAGH−−−DADASELNVNTKAELAQLAQ−−−−−−−−SNDQSLNEKPVQSGAYDFTFNYEGTTYHFASDGTYFEWQYYPSN−−−−−−−−−−−−−−GAADDTTMNSQAQQGTMSSSQGAATQQSTSAQP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AQTEQAP−−−−−−QSESTQQPQ−−TQATSHSQSSSAS−−−−−−−−−−−−−−−−−−−−−−−−−−QASSHSSVNVNSHLKAIAQRESGGDIHAVNPSSGAAGKYQFMQSTWDHVAPSEYKGVSPANAPEHV−−−QDAAAQKLYDTEGAGHWTTA
fig|1327991.3.peg.2332   Staphylococcus epidermidis UC7032     MKKTLVASSLAIGLGVVAGNAGH−−−DAHASETTNVDKAELAQKAL−−−−−−−−TNDQSLNESPVQEGAYNINFDYNGNSYHFESDGSTWSWSYESTN−−−−−−−−−−−−−−−−−−−−−−−−−−−−NATQPVQPSQSQVATQQQP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VQVSAP−−−−−−QNEQTAQPQ−−TKSTSASQTSS−−−−−−−−−−−−−−−−−−−−−−−−−−−SKASSGSSVNVNSHLQQIAQRESGGDIHAINPSSGAAGKYQFLQSTWDSVAPSQYKGVSPAKAPESV−−−QDKAAVKLYNTGGPGHWVTA
fig|525376.3.peg.2293   Staphylococcus epidermidis W23144     MKKTLVASSLAIGLGVVAGNAGH−−−DAHASETTNVDKAELAQKAL−−−−−−−−TNDQSLNESPVQEGAYNINFDYNGNSYHFESDGSTWSWSYESTN−−−−−−−−−−−−−−−−−−−−−−−−−−−−NATQPVQPSQSQVATQQQP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VQVSAP−−−−−−QNEQTAQPQ−−TKSTSASQTSS−−−−−−−−−−−−−−−−−−−−−−−−−−−SKASSGSSVNVNSHLQQIAQRESGGDIHAINPSSGAAGKYQFLQSTWDSVAPSQYKGVSPAKAPESV−−−QDKAAVKLYNTGGPGHWVTA
fig|979211.3.peg.2038   Staphylococcus epidermidis NIHLM023     MKKTLVASSLAIGLGVVAGNAGH−−−DAHASETTNVDKAELAQKAL−−−−−−−−TNDQSLNESPVQEGAYNINFDYNGNSYHFESDGSTWSWSYESTN−−−−−−−−−−−−−−−−−−−−−−−−−−−−NATQPVQPSQSQVATQQQP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VQVSAP−−−−−−QNEQTAQPQ−−TKSTSASQTSS−−−−−−−−−−−−−−−−−−−−−−−−−−−SKASSGSSVNVNSHLQQIAQRESGGDIHAINPSSGAAGKYQFLQSTWDSVAPSQYKGVSPAKAPESV−−−QDKAAVKLYNTGGPGHWVTA
fig|176279.3.peg.1950   Staphylococcus epidermidis RP62A     MKKTLVASSLAIGLGVVAGNAGH−−−DAHASETTNVDKAELAQKAL−−−−−−−−TNDQSLNESPVQEGAYNINFDYNGNSYHFESDGSTWSWSYESTN−−−−−−−−−−−−−−−−−−−−−−−−−−−−NATQPVQPSQSQVATQQQP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VQVSAP−−−−−−QNEQTAQPQ−−TKSTSTSQTSS−−−−−−−−−−−−−−−−−−−−−−−−−−−SKASSGSSVNVNSHLQQIAQRESGGDIHAINPSSGAAGKYQFLQSTWDSVAPSQYKGVSPAKAPESV−−−QDRAAVKLYNTGGPGHWVTA
fig|904328.3.peg.2062   Staphylococcus epidermidis VCU105     MKKTLVASSLAIGLGVVAGNAGH−−−DAHASETTNVDKAELAQKAL−−−−−−−−TNDQSLNESPVQEGAYNINFDYNGNSYHFESDGSTWSWSYESTN−−−−−−−−−−−−−−−−−−−−−−−−−−−−NATQPVQPSQSQVATQQQP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VQVSAP−−−−−−QNEQTAQPQ−−TKSTSTSQTSS−−−−−−−−−−−−−−−−−−−−−−−−−−−SKASSGSSVNVNSHLQQIAQRESGGDIHAINPSSGAAGKYQFLQSTWDSVAPSQYKGVSPAKAPESV−−−QDRAAVKLYNTGGPGHWVTA
fig|979217.3.peg.2055   Staphylococcus epidermidis NIHLM008     MKKTLVASSLAIGLGVVAGNAGH−−−DAHASETTNVDKAELAQKAL−−−−−−−−TNDQSLNESPVQEGAYNINFDYNGNSYHFESDGSTWSWSYESTN−−−−−−−−−−−−−−−−−−−−−−−−−−−−NATQPVQPSQSQVATQQQP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VQVSAP−−−−−−QNEQTAQPQ−−TKSTSTSQTSS−−−−−−−−−−−−−−−−−−−−−−−−−−−SKASSGSSVNVNSHLQQIAQRESGGDIHAINPSSGAAGKYQFLQSTWDSVAPSQYKGVSPAKAPESV−−−QDRAAVKLYNTGGPGHWVTA
fig|279808.8.peg.926   Staphylococcus haemolyticus JCSC1435     MKKTIIASSLAVGLGVVAGNAGH−−−−ADASEAQVNKAELAQLAQ−−−−−−−−SNDQSLNDSPIQEGAYNVTFDYEGFTYHFESDGTNWSWNYAQSG−−−−−−−−−−−−QASQQQDVSAQASTVSNQTSAEQVGSQQQSSQAQP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TQTQQAP−−−−−−QTEQTQQPQ−−TEATTSNSSSSNN−−−−−−−−−−−−−−−−−−−−−−−−−−NASSGSSVNVNSHLQQIAQRESGGDITAINPSSGAAGKYQFLQSTWDSVAPDEYKGVSPAQAPEDV−−−QDAAAVKLYNTAGASQWVTA
fig|596319.3.peg.1553   Staphylococcus warneri L37603     MKKTIIASSLAVGLGVVAGNAGH−−−DAHASEANINEAELAQKAQ−−−−−−−−SNDQSLNESPIQEGAYNYTFDYNGFTYHFESDGTNFSWYFHQSG−−−−QSNEASNTQAQPQQDVSEQASASTNQTSAEEVSNQQQSNSAQP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EQVSAP−−−−−−QTEQTQQPQ−−QEATTSNNESSSS−−−−−−−−−−−−−−−−−−−−−−−−−−EASSGSSVNVNDHLKQIAQRESGGDIHATNPSTGASGKYQFLQSTWDSVAPAEYKGQPASSAPEHV−−−QDAAAQKLYDTAGPSQWVTA
fig|525378.3.peg.2383   Staphylococcus epidermidis M23864:W1     MKKTLIASSLAVGLGVVAGNAGH−−−DAHASEATNVDKAELAQKAQ−−−−−−−−SNDQSLNESPIQEGAYNVTFDYNGFTYHFESDGNNWSWNYAQTG−−−−−−−−−−−−QATPQQDVSEQASASNNQTSAEQVSAQQQSNQAQP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EQTAAP−−−−−−QTEQTQQPQ−−AKATTSYSAPSNN−−−−−−−−−−−−−−−−−TSSS−−−−−KASSGSSVNVNSHLQQIAQRESGGDIHAINPSSGAAGKYQFLQSTWDSVAPSQYKGQSPANAPESV−−−QDAAAVKLYNTAGANQWVTA
fig|553212.3.peg.1725   Staphylococcus capitis SK14     MKKTIIASSLAVGLGVVAGNAGH−−−DAHASEATNVDKAELAQKAQ−−−−−−−−SNDQSLNESPIQKGAYNVNFDYNGFNYHFESNGTHWSWNYAQNG−−−−−−−−−−−−QATPQQDVS−−−−−−−NQTSADQVSSQQQTSQAQP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EQTSAP−−−−−−QTEQTQQPQ−−AKATTSYSAPTNN−−−−−−−−−−−−−−−−−TASSQASTNQASSGSSVNLNSHLKQIAQRESGGDIHAINPSTGAAGKFQFLQSTWDSVAPEQYKGQSPANAPESV−−−QDAAAVKLYNTAGASQWVTA
fig|904334.3.peg.950   Staphylococcus epidermidis VCU116     MKKTIIASSLAVGLGVVAGNAGH−−−DAHASEATNVDKAELAQKAQ−−−−−−−−SNDQSLNESPIQKGAYNVNFDYNGFNYHFESNGTHWSWNYAQNG−−−−−−−−−−−−QATPQQDVS−−−−−−−NQTSADQVSSQQQTSQAQP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EQTSAP−−−−−−QTEQTQQPQ−−AKATTSYSAPTNN−−−−−−−−−−−−−−−−−TASSQASTNQASSGSSVNLNSHLKQIAQRESGGDIHAINPSTGAAGKFQFLQSTWDSVAPEQYKGQSPANAPESV−−−QDAAAVKLYNTAGASQWVTA
fig|904334.4.peg.950   Staphylococcus capitis VCU116     MKKTIIASSLAVGLGVVAGNAGH−−−DAHASEATNVDKAELAQKAQ−−−−−−−−SNDQSLNESPIQKGAYNVNFDYNGFNYHFESNGTHWSWNYAQNG−−−−−−−−−−−−QATPQQDVS−−−−−−−NQTSADQVSSQQQTSQAQP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EQTSAP−−−−−−QTEQTQQPQ−−AKATTSYSAPTNN−−−−−−−−−−−−−−−−−TASSQASTNQASSGSSVNLNSHLKQIAQRESGGDIHAINPSTGAAGKFQFLQSTWDSVAPEQYKGQSPANAPESV−−−QDAAAVKLYNTAGASQWVTA
fig|342451.11.peg.122   Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305     MKKTVIASTLAVGLGVTGIAAGN−−−SADASEQGVDKAQLAQQAQ−−−−−−−−SNPESLNAAPIQDGAYNINFNYNNTDYSFQSDGENFSWSYGEGS−−−−−−GEGSNASSEQATDNSSQQTAEQPQQVEQPQQTEQASTEQP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AQEAAP−−−−−−QTEATQQPQ−−QEATTQSASSSNE−−−−−−−−−−−−−−−−−SSSNESSSSEASESSSSGVNAHLQQIAQRESGGDIHATNPSSGASGKFQFLQSTWDSVAPAEYQGQPAASAPESV−−−QDAAAQKLYDTEGASQWVTA
fig|342451.11.peg.790   Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305     MKKTVVASTLAVGLGVTGFAAGN−−−SADASEQGVDKAQLAQQAQ−−−−−−−−SNPESLNEAPVQDGAYNINFNYNNTDYSFQSDGQYWTWSYGQGS−−−−−−−−−−−−−−−−−TNAPAQETAEQPQQVEQPQQTEQASTEQP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AEEAAP−−−−−−QTEETQQPQ−−QEATTQTTSSSNE−−−−−−−−−−−−−−−−−STSNESSSSEASEGSSVNVNSHLQAIAQRESGGDLKAVNPSSGAAGKYQFLQSTWDSVAPSEYQGVSPTEAPEAV−−−QDAAAVKLYNTAGASQWVTA
fig|342451.11.peg.121   Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305     MKKTVVASTLAVGLGVTGFAAGN−−−SADASEQGVDKAQLAQQAQ−−−−−−−−SNPESLNAAPVQDGAYDINFNYNNTDYSFQSDGQYWTWSYGQGS−−−−−−−−−−−−−−−−−TNAPAQETAEQPQLVEQPQQTEQASTEQP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AQEAAP−−−−−−QTEETQQPQ−−QEATTQTTSSSNE−−−−−−−−−−−−−−−−−STSNESSSSEASEGSSVNVNSHLQAIAQRESGGDLKAVNPSSGAAGKYQFLQSTWDSVAPSEYQGVSPTEAPEAV−−−QDAAAVKLYNTAGASQWVTA
fig|458233.11.peg.889   Macrococcus caseolyticus JCSC5402     MKKAIMTSTLALALGVTGVSASQADASTETAETNQINKAELANLAL−−−−−−−−NNPSALNENPVHEGAYHYEFTKDGYHFTFDSNGAYWTWEYNHSG−−−−−−−−−−−−−−−−SADSEAFSSVTNNNFKQEAPAVQAQAPVAKTP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AQTYVAP−−−−−−KAQNYQ−−−−−−−−−TQSTYKAPA−−−−−−−−−−−−−−−−Q−−−−−−−−−TQSATSPVSVNSHLQLIAQRESGGNIRAVNPTSGAAGKYQFLQSTWDSVAPAQWRGVSPASAPEAV−−−QDAAAVKLYNTAGPSQWVTA
fig|396513.4.peg.1596   Staphylococcus carnosus subsp. carnosus TM300                        GVGA−−−NAHAAEDNNVNQDQLAQTAL−−−−−−−−NNTQQLNDAPVQEGAYNIAFDNSGYNFNFNSDGTNWSWSYNADS−−−−−−−−−−−−−−−−SAQQAPAQSTTQEQAPAAQQAPAQSTTQEQA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PAAQQAP−−−−−−AQEQTQQPA−−QQPAQQQTQQPAQ−−−−−−−−−−−−−−−−−−−−−−−−−QSADSGSNVQVNDHLKAIAQRESGGDIHAINSSSGAAGKYQFLQTTWDSVAPAEYQGKPASEAPEAV−−−QDAAAQKLYDTAGPSQWVTA
fig|931437.3.peg.1537   Staphylococcus aureus subsp. aureus CIG1500     KKSIGVASVLVGTLIGFGLLSSK−−−EADASENSMTQTENTSNESKS−−−−−−−−NDPSSVNAAPKTDN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TNVSDSNTTTNTNSDETNVAQNPAQQETTQSASTN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ATTEETPVTGEVTTTATNQAN−−TPATTQSSNTNAEESVNQTSNETTSNDTNTVSSVNSPQNSTNAENVSTTQDISTEATPSNNESAPQSTD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ASNKD−−−VVNQAVNTS            
fig|548473.3.peg.1132   Staphylococcus aureus subsp. aureus TCH60     KKSIGVASVLVGTLIGFGLLSSK−−−EADASENSMTQTENTSNESKS−−−−−−−−NDPSSVNAAPKTDN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TNVSDSNTTTNTNSDETNVAQNPAQQETTQSASTN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ATTEETPVTGEVTTTATNQAN−−TPATTQSSNTNAEESVNQTSNETTSNDTNTVSSVNSPQNSTNAENVSTTQDISTEATPSNNESAPQSTD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ASNKD−−−VVNQAVNTS            
fig|585149.6.peg.925   Staphylococcus aureus subsp. aureus C101     KKSIGVASVLVGTLIGFGLLSSK−−−EADASENSMTQTENTSNESKS−−−−−−−−NDPSSVNAAPKTDN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TNVSDSNTTTNTNSDETNVAQNPAQQETTQSASTN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ATTEETPVTGEVTTTATNQAN−−TPATTQSSNTNAEESVNQTSNETTSNDTNTVSSVNSPQNSTNAENVSTTQDISTEATPSNNESAPQSTD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ASNKD−−−VVNQAVNTS            
fig|585151.3.peg.415   Staphylococcus aureus subsp. aureus C427     KKSIGVASVLVGTLIGFGLLSSK−−−EADASENSMTQTENTSNESKS−−−−−−−−NDPSSVNAAPKTDN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TNVSDSNTTTNTNSDETNVAQNPAQQETTQSASTN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ATTEETPVTGEVTTTATNQAN−−TPATTQSSNTNAEESVNQTSNETTSNDTNTVSSVNSPQNSTNAENVSTTQDISTEATPSNNESAPQSTD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ASNKD−−−VVNQAVNTS            
fig|585160.3.peg.317   Staphylococcus aureus subsp. aureus WBG10049     KKSIGVASVLVGTLIGFGLLSSK−−−EADASENSMTQTENTSNESKS−−−−−−−−NDPSSVNAAPKTDN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TNVSDSNTTTNTNSDETNVAQNPAQQETTQSASTN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ATTEETPVTGEVTTTATNQAN−−TPATTQSSNTNAEESVNQTSNETTSNDTNTVSSVNSPQNSTNAENVSTTQDISTEATPSNNESAPQSTD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ASNKD−−−VVNQAVNTS            
fig|585150.3.peg.1378   Staphylococcus aureus subsp. aureus C160     KKSIGVASVLVGTLIGFGLLSSK−−−EADASENSMTQTENTSNESKS−−−−−−−−NDPSSVNAAPKTDN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TNVSDSNTTTNTNSDETNVAQNPAQQETTQSASTN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ATTEETPVTGEVTTTATNQAN−−TPATTQSSNTNAEESVNQTSNETTSNDTNTVSSVNSPQNSTNAENVSTTQDISTEATPSNNESAPQSTD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ASNKD−−−VVNQAVNTS            
fig|585159.3.peg.909   Staphylococcus aureus subsp. aureus M899     KKSIGVASVLVGTLIGFGLLSSK−−−EADASENSMTQTENTSNESKS−−−−−−−−NDPSSVNAAPKTDN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TNVSDSNTTTNTNSDETNVAQNPAQQETTQSASTN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ATTEETPVTGEVTTTATNQAN−−TPATTQSSNTNAEESVNQTSNETTSNDTNTVSSVNSPQNSTNAENVSTTQDISTEATPSNNESAPQSTD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ASNKD−−−VVNQAVNTS            
fig|548470.3.peg.1693   Staphylococcus aureus subsp. aureus MN8     KKSIGVASVLVGTLIGFGLLSSK−−−EADASENSMTQTENTSNESKS−−−−−−−−NDPSSVNAAPKTDN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TNVSDSNTTTNTNSDETNVAQNPAQQETTQSASTN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ATTEETPVTGEVTTTATNQAN−−TPATTQSSNTNAEESVNQTSNETTSNDTNTVSSVNSPQNSTNAENVSTTQDISTEATPSNNESAPQSTD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ASNKD−−−VVNQAVNTS            
fig|553583.3.peg.950   Staphylococcus aureus A9635     KKSIGVASVLVGTLIGFGLLSSK−−−EADASENSVTQTENTSNESKS−−−−−−−−NDSSSVNAAPKTDN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TNVSDSNTTTNTNSDETNVAQNPAQQETTQSASTN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ATTEETPVTGEVTTTATNQAN−−TPATTQSSNTNAEKSVNQTSNETTSNDTNTVSSVNSPQNSTNAENVSTTQDTSTEAKPSNNESAPQSTD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ASNKD−−−VVNQAVNTS            
fig|176279.3.peg.2083   Staphylococcus epidermidis RP62A     KFTVGTASILLGSTLIFGSSSH−−−EAKAAEEKQVDPITQANQNDSSERSLENTNQPTVNNEAPQMSS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TLQAEEGSNAEAPQSEPTKAEEGGNAEAAQSEPTKAEE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GGNAEAPQS−−EPTKAEEGGN−−AEAAQSEPTKTEEGSNVKAAQSEPTKAEEGSNAEAPQSEPTKTEEGSNAKAAQSEPTKAEEGGNAEA                                                              
fig|684738.3.peg.1831   Lactococcus lactis subsp. lactis KF147                                                                                                           NGNYGNGDTRVTNLQSKGFDVKAIQTEVNNILTGTTTQVS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ATTKTAEEQ−−PTKVTSVAPTQVTQSVSGGLNMSQTSGQVDIQALANYMASNTANAAGYSASEWAYIITHESNGGIDSVNSSSGAYGAFQLLGHGEYAG−−−−−−−−−−−−MTLAE−−−QIAMASKL−−−−−PAGSWV  
fig|1042402.4.peg.809   Lactococcus lactis subsp. cremoris CNCM I-1631                                                                                                           NGNYGNGDTRVTNLQSKGFDVKAIQTEVNNILTGTTTQVS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ATTKTAEEQ−−PTKVTSVAPTQATQSVSGGLNMSQTSGQVDIQALANYMASNTANAAGYSASEWAYIITHESNGGIDSVNSSSGAYGAFQLLGHGEYAG−−−−−−−−−−−−MTLAE−−−QIAMASKL−−−−−PAGSWV  
fig|272622.10.peg.2003   Lactococcus lactis subsp. cremoris SK11                                                                                                           NGNYGNGDARVTNLKTKGFDVKAIQTEVNNILTGTTTQVS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ATAKTTEEQ−−PTKVTSAAPAQAAESVSGGLNMSQTSGQIDIQALANYMASNTANAAGYSASEWAYIITHESNGMADSVNSSSGAYGAFQLLGHGEYAG−−−−−−−−−−−−MTLAE−−−QIAMASKL−−−−−PAGSWV  
fig|1306952.3.peg.824   Pediococcus acidilactici D3                                             YAFNLNG−−−−−−−−NYDAIAQANHIK−−−−DVNFITVGQKLVIKDNGSI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QKATKSEIKSLPEVDKDTNAA−−AAT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KQATPAK−−−−−−TATP−−−−K−−ATSTKTASYS−−−−−−−−−−−−−−−−−−−−GNSSVSSVANEMASRTGVSAAKWQQIIMRESGGNANVSNASSGAYGLFQLLGHGEHAG−−−−−−−−−−−−MSVAE−−−QINMATNVYNAQGLSAW   
fig|342451.11.peg.296   Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305     MKKTILASSLAVALGVTGYAATADHNQAHASEENIDQAHLADLAQ−−−−−−−−NNPEQLNEKPLHAGAYNYDFVLGGNEYTFTSDGQTWSWNYTTAG−−−−−−−−AQSASSNTIQDVTAQATTHTNETSANEVRTQQQSS−−NTE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VAAVEAP−−−−−−KASSN−−−T−−NVQTAQTSTSTKS−−−−−−−−−−TTTTTTTSTSSIDAIANQMAERTGVSASQWKGVIQRESGGNANAVNASSGAYGLFQLLGHGEHAG−−−−−−−−−−−−MSVQD−−−QMDKAVEVYNNQGAGAWV  
fig|279808.8.peg.480   Staphylococcus haemolyticus JCSC1435     MKKTVIASSLAVALGVTGYALTTDNSAHASESTTNYAQLANLAQ−−−−−−−−NNPSELNAHPVQAGAYNITFVKDGFKYNFTSDGQSWSWNYTYVG−−−−GADTVATTQAAPAAQSTDYSASYSNEASTQSVSSNQQSS−−NTN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VEAVSAP−−−−−−−−−−−−−−−−−−−−−KTTSYSAS−−−−−−−−−−−TSSSSSASTGGSVKEQFLA−−NGGTEAAWNAIVMPESGGNPNAVNPAGYRGLGQTKESWGTG−−−−−−−−−−−−SVASQTKGMINYANSRYGS−−−LDAA   
fig|629742.3.peg.1303   Staphylococcus hominis SK119     MKKTVIASSLAVTLGLTGYALTNDHSAHASEQTTNYSHLADLAQ−−−−−−−−NNPSELNAHPVQAGAYNISFVQDGFKYTFTSNGNTWSWNYTYTG−−−−GADTAQS−−−−−−−−TTDYTDSYNQASTQSVSANNQAS−−TSN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VKAVSAPVQ−−KTSSY−−−−S−−NYSARTTSYSAPK−−−−−−−−−−−TTSYSTASTGGSVKAQFLA−−NGGTEAAWNAIVMPESGGNPNAVNPIGYRGLGQT                                                 
fig|396513.4.peg.1595   Staphylococcus carnosus subsp. carnosus TM300     MKKLLVVSSVATAAFLATGAASH−−−NAHAAEVSQS−−QQQLAETAL−−−−−−−−NNPSELNQHPVQAGAYNIDFVYNGNEFHFESDGQHFSWNYTAAG−−−−−−−−−−−−−−−−−−−−−SNASAQPTQATTTQAAPAQQAAPVAQQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TQTYSTTT−−−−−QTTQTTTSY−−SAPVQQQSYSAPA−−−−−−−−−−RSYSTASVSTGGSTKAQFLA−−AGGTEDMWNTIVMPESGGNPNAVSPNGYMGLGQTKEGWGT                                          
fig|596319.3.peg.60   Staphylococcus warneri L37603     MKKTFIASTLALTLGAAGYAVSGHEAHASETTNVDQAHLVDLAH−−−−−−−−NHPEQLNAAPVQEGAYDIHFVSGGFEYNFTSDGTNFSWNYQEAG−−−−−−−STSAQTSNTAVQSADYTTSYNQEAGTQSVSSNQQSS−−NTN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VEAVSAP−−−−−−TTSNNGSSH−−NYSTKTTSYSAPS−−−−−−−−−−−−−−TSSASTGGSTKAQFLA−−NGGTEEAWNAIVMPESGGNPNAVNPAGYRGLGQTMESWGTG−−−−−−−−−−−−SVA                          
fig|525378.3.peg.2225   Staphylococcus epidermidis M23864:W1     MKKTVISTSLALSLGVAGFALTGHEAHASEATNVDQAHLADLAQ−−−−−−−−NHPDQLNAKPVQAGAYDIHFVNNGFEYNFTSNGTNWSWSYQAAG−−−−−−−SQSS−−−−−−−−SADYTQSYNQESSNQSVSSNTQSS−−NTN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VEAVSAP−−−−−−TTSH−−−−H−−NYSTSTTSYSAPS−−−−−−−−−−−−−−SSSASTGGSVKAQFLA−−AGGTEAAWNAIVMPESGGNPNAVNPAGYRGLGQTMESWGTG−−−−−−−−−−−−SVA                          
fig|553212.3.peg.56   Staphylococcus capitis SK14     MKKTVIASSLAVSLGIAGYALTGNEAHASETTNVDQAHLADLAQ−−−−−−−−HNPEQLNSKPVQAGAYDIHFVNNGFQYNFTSNGTNWSWNYAQVG−−−−−−−STTQ−−−−−−−SSADYTESYSQESSNQSVSSNQQSS−−NTS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VKAVSAP−−−−−−TTST−−−−H−−NYSTSTTSYSAPS−−−−−−−−−−−−−−−SSASTGGSTKAQFLA−−AGGTEELWNAIVMPESGGNVNASN−−GQYHGLGQTNQSWGYG−−−−−−−−−−−−SV                           
fig|904334.3.peg.1597   Staphylococcus epidermidis VCU116     MKKTVIASSLAVSLGIAGYALTGNEAHASETTNVDQAHLADLAQ−−−−−−−−HNPEQLNSKPVQAGAYDIHFVNNGFQYNFTSNGTNWSWNYAQVG−−−−−−−STTQ−−−−−−−SSADYTESYSQESSNQSVSSNQQSS−−NTS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VKAVSAP−−−−−−TTST−−−−H−−NYSTSTTSYSAPS−−−−−−−−−−−−−−−SSASTGGSTKAQFLA−−AGGTEELWNAIVMPESGGNVNASN−−GQYHGLGQTNQSWGYG−−−−−−−−−−−−SV                           
fig|904334.4.peg.1595   Staphylococcus capitis VCU116     MKKTVIASSLAVSLGIAGYALTGNEAHASETTNVDQAHLADLAQ−−−−−−−−HNPEQLNSKPVQAGAYDIHFVNNGFQYNFTSNGTNWSWNYAQVG−−−−−−−STTQ−−−−−−−SSADYTESYSQESSNQSVSSNQQSS−−NTS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VKAVSAP−−−−−−TTST−−−−H−−NYSTSTTSYSAPS−−−−−−−−−−−−−−−SSASTGGSTKAQFLA−−AGGTEELWNAIVMPESGGNVNASN−−GQYHGLGQTNQSWGYG−−−−−−−−−−−−SV                           
fig|1158486.3.peg.2077   Staphylococcus aureus M1320     MKKTIMASSLAVALGVTGYAAGTGHQAHAAEVNVDQAHLVDLAH−−−−−−−−NHQDQLNAAPIKDGAYDIHFVKDGFQYNFTSNGTTWSWSYEAAN−−−−−−−−−GQTAGFSNVAGADYTTSYNQGSDVQSVSYNAQSS−−NSN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VEAVSAP−−−−−−TY−−−−−−H−−NYSTSTTS−−−−−−−−−−−−SSVRLSNGNTAGATGSSAAQIMAQRTGVSASTWAAIIARESNGQVNAYNPSGASGLFQTMPGWGPT−−−−−−−−−−−−NTVDQ−−−QINAAVKAYKAQGLGAW   
fig|553601.3.peg.718   Staphylococcus aureus A10102     MKKTIMASSLAVALGVTGYAAGTGHQAHAAEVNVDQAHLVDLAH−−−−−−−−NHQDQLNAAPIKDGAYDIHFVKDGFQYNFTSNGTTWSWSYEAAN−−−−−−−−−GQTAGFSNVAGADYTTSYNQGSDVQSVSYNAQSS−−NSN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VEAVSAP−−−−−−TY−−−−−−H−−NYSTSTTS−−−−−−−−−−−−SSVRLSNGNTAGATGSSAAQIMAQRTGVSASTWAAIIARESNGQVNAYNPSGASGLFQTMPGWGPT−−−−−−−−−−−−NTVDQ−−−QINAAVKAYKAQGLGAW   
fig|889933.4.peg.2348   Staphylococcus aureus subsp. aureus ECT-R 2     MKKTIMASSLAVALGVTGYAAGTGHQAHAAEVNVDQAHLVDLAH−−−−−−−−NHQDQLNAAPIKDGAYDIHFVKDGFQYNFTSNGTTWSWSYEAAN−−−−−−−−−GQTAGFSNVAGADYTTSYNQGSDVQSVSYNAQSS−−NSN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VEAVSAP−−−−−−TY−−−−−−H−−NYSTSTTS−−−−−−−−−−−−SSVRLSNGNTAGATGSSAAQIMAQRTGVSASTWAAIIARESNGQVNAYNPSGASGLFQTMPGWGPT−−−−−−−−−−−−NTVDQ−−−QINAAVKAYKAQGLGAW   
fig|904731.3.peg.789   Staphylococcus aureus subsp. aureus 21201     MKKTIMASSLAVALGVTGYAAGTGHQAHAAEVNVDQAHLVDLAH−−−−−−−−NHQDQLNAAPIKDGAYDIHFVKDGFQYNFTSNGTTWSWSYEAAN−−−−−−−−−GQTAGFSNVAGADYTTSYNQGSDVQSVSYNAQSS−−NSN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VEAVSAP−−−−−−TY−−−−−−H−−NYSTSTTS−−−−−−−−−−−−SSVRLSNGNTAGATGSSAAQIMAQRTGVSASTWAAIIARESNGQVNAYNPSGASGLFQTMPGWGPT−−−−−−−−−−−−NTVDQ−−−QINAAVKAYKAQGLGAW   
fig|505321.3.peg.1512   Staphylococcus aureus subsp. aureus str. CF-Marseille     MKKTIMASSLAVALGVIGYAAGTGHQAHAAEVNVDQAHLVDLAH−−−−−−−−NHQDQLNAAPIKDGAYDIHFVKDGFQYNFTSNGTTWSWSYEAAN−−−−−−−−−GQTAGFSNVAGADYTTSYNQGSDVQSVSYNAQSS−−NSN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VEAVSAP−−−−−−TY−−−−−−H−−NYSTSTTS−−−−−−−−−−−−SSVRLSNGNTAGATGSSAAQIMAQRTGVSASTWAAIIARESNGQVNAYNPSGASGLFQTMPGWGPT−−−−−−−−−−−−NTVDQ−−−QINAAVKAYKAQGLGAW   
fig|548470.3.peg.775   Staphylococcus aureus subsp. aureus MN8     MKKTIMASSLAVALGVTGYAAGTGHQAHAAEVNVDQAHLVDLAH−−−−−−−−NHQDQLNAAPIKDGAYDIHFVKDGFQYNFTSNGTTWSWSYEAAN−−−−−−−−−GQTAGFSNVAGADYTTSYNQGSNVQSVSYNAQSS−−NSN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VEAVSAP−−−−−−TY−−−−−−H−−NYSTSTTS−−−−−−−−−−−−SSVRLSNGNTAGATGSSAAQIMAQRTGVPASTWAAIIARESNGQVNAYNPSGASGLFQTMPGWGPT−−−−−−−−−−−−NTVDQ−−−QINAAVKAYKAQGLGAW   
fig|548473.3.peg.947   Staphylococcus aureus subsp. aureus TCH60     MKKTIMASSLAVALGVTGYAAGTGHQAHAAEVNVDQAHLVDLAH−−−−−−−−NHQDQLNAAPIKDGAYDIHFVKDGFQYNFTSNGTTWSWSYEAAN−−−−−−−−−GQTAGFSNVAGADYTTSYNQGSNVQSVSYNAQSS−−NSN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VEAVSAP−−−−−−TY−−−−−−H−−NYSTSTTS−−−−−−−−−−−−SSVRLSNGNTAGATGSSAAQIMAQRTGVPASTWAAIIARESNGQVNAYNPSGASGLFQTMPGWGPT−−−−−−−−−−−−NTVDQ−−−QINAAVKAYKAQGLGAW   
fig|548473.6.peg.606   Staphylococcus aureus subsp. aureus TCH60     MKKTIMASSLAVALGVTGYAAGTGHQAHAAEVNVDQAHLVDLAH−−−−−−−−NHQDQLNAAPIKDGAYDIHFVKDGFQYNFTSNGTTWSWSYEAAN−−−−−−−−−GQTAGFSNVAGADYTTSYNQGSNVQSVSYNAQSS−−NSN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VEAVSAP−−−−−−TY−−−−−−H−−NYSTSTTS−−−−−−−−−−−−SSVRLSNGNTAGATGSSAAQIMAQRTGVPASTWAAIIARESNGQVNAYNPSGASGLFQTMPGWGPT−−−−−−−−−−−−NTVDQ−−−QINAAVKAYKAQGLGAW   
fig|585149.6.peg.47   Staphylococcus aureus subsp. aureus C101     MKKTIMASSLAVALGVTGYAAGTGHQAHAAEVNVDQAHLVDLAH−−−−−−−−NHQDQLNAAPIKDGAYDIHFVKDGFQYNFTSNGTTWSWSYEAAN−−−−−−−−−GQTAGFSNVAGADYTTSYNQGSNVQSVSYNAQSS−−NSN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VEAVSAP−−−−−−TY−−−−−−H−−NYSTSTTS−−−−−−−−−−−−SSVRLSNGNTAGATGSSAAQIMAQRTGVPASTWAAIIARESNGQVNAYNPSGASGLFQTMPGWGPT−−−−−−−−−−−−NTVDQ−−−QINAAVKAYKAQGLGAW   
fig|585150.3.peg.966   Staphylococcus aureus subsp. aureus C160     MKKTIMASSLAVALGVTGYAAGTGHQAHAAEVNVDQAHLVDLAH−−−−−−−−NHQDQLNAAPIKDGAYDIHFVKDGFQYNFTSNGTTWSWSYEAAN−−−−−−−−−GQTAGFSNVAGADYTTSYNQGSNVQSVSYNAQSS−−NSN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VEAVSAP−−−−−−TY−−−−−−H−−NYSTSTTS−−−−−−−−−−−−SSVRLSNGNTAGATGSSAAQIMAQRTGVPASTWAAIIARESNGQVNAYNPSGASGLFQTMPGWGPT−−−−−−−−−−−−NTVDQ−−−QINAAVKAYKAQGLGAW   
fig|585151.3.peg.2560   Staphylococcus aureus subsp. aureus C427     MKKTIMASSLAVALGVTGYAAGTGHQAHAAEVNVDQAHLVDLAH−−−−−−−−NHQDQLNAAPIKDGAYDIHFVKDGFQYNFTSNGTTWSWSYEAAN−−−−−−−−−GQTAGFSNVAGADYTTSYNQGSNVQSVSYNAQSS−−NSN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VEAVSAP−−−−−−TY−−−−−−H−−NYSTSTTS−−−−−−−−−−−−SSVRLSNGNTAGATGSSAAQIMAQRTGVPASTWAAIIARESNGQVNAYNPSGASGLFQTMPGWGPT−−−−−−−−−−−−NTVDQ−−−QINAAVKAYKAQGLGAW   
fig|585159.3.peg.45   Staphylococcus aureus subsp. aureus M899     MKKTIMASSLAVALGVTGYAAGTGHQAHAAEVNVDQAHLVDLAH−−−−−−−−NHQDQLNAAPIKDGAYDIHFVKDGFQYNFTSNGTTWSWSYEAAN−−−−−−−−−GQTAGFSNVAGADYTTSYNQGSNVQSVSYNAQSS−−NSN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VEAVSAP−−−−−−TY−−−−−−H−−NYSTSTTS−−−−−−−−−−−−SSVRLSNGNTAGATGSSAAQIMAQRTGVPASTWAAIIARESNGQVNAYNPSGASGLFQTMPGWGPT−−−−−−−−−−−−NTVDQ−−−QINAAVKAYKAQGLGAW   
fig|585160.3.peg.2391   Staphylococcus aureus subsp. aureus WBG10049     MKKTIMASSLAVALGVTGYAAGTGHQAHAAEVNVDQAHLVDLAH−−−−−−−−NHQDQLNAAPIKDGAYDIHFVKDGFQYNFTSNGTTWSWSYEAAN−−−−−−−−−GQTAGFSNVAGADYTTSYNQGSNVQSVSYNAQSS−−NSN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VEAVSAP−−−−−−TY−−−−−−H−−NYSTSTTS−−−−−−−−−−−−SSVRLSNGNTAGATGSSAAQIMAQRTGVPASTWAAIIARESNGQVNAYNPSGASGLFQTMPGWGPT−−−−−−−−−−−−NTVDQ−−−QINAAVKAYKAQGLGAW   
fig|904728.3.peg.1860   Staphylococcus aureus subsp. aureus 21195     MKKTIMASSLAVALGVTGYAAGTGHQAHAAEVNVDQAHLVDLAH−−−−−−−−NHQDQLNAAPIKDGAYDIHFVKDGFQYNFTSNGTTWSWSYEAAN−−−−−−−−−GQTAGFSNVAGADYTTSYNQGSNVQSVSYNAQSS−−NSN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VEAVSAP−−−−−−TY−−−−−−H−−NYSTSTTS−−−−−−−−−−−−SSVRLSNGNTAGATGSSAAQIMAQRTGVPASTWAAIIARESNGQVNAYNPSGASGLFQTMPGWGPT−−−−−−−−−−−−NTVDQ−−−QINAAVKAYKAQGLGAW   
fig|904784.3.peg.1816   Staphylococcus aureus subsp. aureus IS-125     MKKTIMASSLAVALGVTGYAAGTGHQAHAAEVNVDQAHLVDLAH−−−−−−−−NHQDQLNAAPIKDGAYDIHFVKDGFQYNFTSNGTTWSWSYEAAN−−−−−−−−−GQTAGFSNVAGADYTTSYNQGSNVQSVSYNAQSS−−NSN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VEAVSAP−−−−−−TY−−−−−−H−−NYSTSTTS−−−−−−−−−−−−SSVRLSNGNTAGATGSSAAQIMAQRTGVPASTWAAIIARESNGQVNAYNPSGASGLFQTMPGWGPT−−−−−−−−−−−−NTVDQ−−−QINAAVKAYKAQGLGAW   
fig|931437.3.peg.565   Staphylococcus aureus subsp. aureus CIG1500     MKKTIMASSLAVALGVTGYAAGTGHQAHAAEVNVDQAHLVDLAH−−−−−−−−NHQDQLNAAPIKDGAYDIHFVKDGFQYNFTSNGTTWSWSYEAAN−−−−−−−−−GQTAGFSNVAGADYTTSYNQGSNVQSVSYNAQSS−−NSN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VEAVSAP−−−−−−TY−−−−−−H−−NYSTSTTS−−−−−−−−−−−−SSVRLSNGNTAGATGSSAAQIMAQRTGVPASTWAAIIARESNGQVNAYNPSGASGLFQTMPGWGPT−−−−−−−−−−−−NTVDQ−−−QINAAVKAYKAQGLGAW   
fig|452948.4.peg.439   Staphylococcus aureus 930918-3          MASSLAVALGVTGYAAGTGHQAHAAEVNVDQAHLVDLAH−−−−−−−−NHQDQLNAAPIKDGAYDIHFVKDGFQYNFTSNGTTWSWSYEAAN−−−−−−−−−GQTAGFSNVAGADYTTSYNQGSNVQSVSYNAQSS−−NSN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VEAVSAP−−−−−−TY−−−−−−H−−NYSTSTTS−−−−−−−−−−−−SSVRLSNGNTAGATGSSAAQIMAQRTGVSASTWAAIIARESNGQVNAYNPSGASGLFQTMPGWGPT−−−−−−−−−−−−NTVDQ−−−QINAAVKAYKAQGLGAW   
fig|1028799.3.peg.2330   Staphylococcus aureus subsp. aureus VC40     MKKTIMASSLAVALGVTGYAAGTGHQAHAAEVNVDQAHLVDLAH−−−−−−−−NHQDQLNAAPIKDGAYDIHFVKDGFQYNFTSNGTTWSWSYEAAN−−−−−−−−−GQTAGFSNVAGADYTTSYNQGSNVQSVSYNAQSS−−NSN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VEAVSAP−−−−−−TY−−−−−−H−−NYSTSTTS−−−−−−−−−−−−SSVRLSNGNTAGATGSSAAQIMAQRTGVSASTWAAIIARESNGQVNAYNPSGASGLFQTMPGWGPT−−−−−−−−−−−−NTVDQ−−−QINAAVKAYKAQGLGAW   
fig|455227.3.peg.1183   Staphylococcus aureus D30     MKKTIMASSLAVALGVTGYAAGTGHQAHAAEVNVDQAHLVDLAH−−−−−−−−NHQDQLNAAPIKDGAYDIHFVKDGFQYNFTSNGTTWSWSYEAAN−−−−−−−−−GQTAGFSNVAGADYTTSYNQGSNVQSVSYNAQSS−−NSN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VEAVSAP−−−−−−TY−−−−−−H−−NYSTSTTS−−−−−−−−−−−−SSVRLSNGNTAGATGSSAAQIMAQRTGVSASTWAAIIARESNGQVNAYNPSGASGLFQTMPGWGPT−−−−−−−−−−−−NTVDQ−−−QINAAVKAYKAQGLGAW   
fig|904747.3.peg.302   Staphylococcus aureus subsp. aureus 21266     MKKTIMASSLAVALGVTGYAAGTGHQAHAAEVNVDQAHLVDLAH−−−−−−−−NHQDQLNAAPIKDGAYDIHFVKDGFQYNFTSNGTTWSWSYEAAN−−−−−−−−−GQTAGFSNVAGADYTTSYNQGSNVQSVSYNAQSS−−NSN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VEAVSAP−−−−−−TY−−−−−−H−−NYSTSTTS−−−−−−−−−−−−SSVRLSNGNTAGATGSSAAQIMAQRTGVSASTWAAIIARESNGQVNAYNPSGASGLFQTMPGWGPT−−−−−−−−−−−−NTVDQ−−−QINAAVKAYKAQGLGAW   
fig|93062.19.peg.2515   Staphylococcus aureus subsp. aureus COL     MKKTIMASSLAVALGVTGYAAGTGHQAHAAEVNVDQAHLVDLAH−−−−−−−−NHQDQLNAAPIKDGAYDIHFVKDGFQYNFTSNGTTWSWSYEAAN−−−−−−−−−GQTAGFSNVAGADYTTSYNQGSNVQSVSYNAQSS−−NSN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VEAVSAP−−−−−−TY−−−−−−H−−NYSTSTTS−−−−−−−−−−−−SSVRLSNGNTAGATGSSAAQIMAQRTGVSASTWAAIIARESNGQVNAYNPSGASGLFQTMPGWGPT−−−−−−−−−−−−NTVDQ−−−QINAAVKAYKAQGLGAW   
fig|931460.3.peg.71   Staphylococcus aureus subsp. aureus CIGC93     MKKTIMASSLAVALGVTGYAAGTGHQAHAAEVNVDQAHLVDLAH−−−−−−−−NHQDQLNAAPIKDGAYDIHFVKDGFQYNFTSNGTTWSWSYEAAN−−−−−−−−−GQTAGFSNVAGADYTTSYNQGSNVQSVSYNAQSS−−NSN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VEAVSAP−−−−−−TY−−−−−−H−−NYSTSTTS−−−−−−−−−−−−SSVRLSNGNTAGATGSSAAQIMAQRTGVSASTWAAIIARESNGQVNAYNPSGASGLFQTMPGWGPT−−−−−−−−−−−−NTVDQ−−−QINAAVKAYKAQGLGAW   
fig|450394.6.peg.1571   Staphylococcus aureus subsp. aureus USA300_TCH959     MKKTIMASSLAVALGVTGYAAGTGHQAHAAEVNVDQAHLVDLAH−−−−−−−−NHQDQLNAAPIKDGAYDIHFVKDGFQYNFTSNGTTWSWSYEAAN−−−−−−−−−GQTTGFSNVAGADYTTSYNQGSNVQSVSYNAQSS−−NSN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VEAVSAP−−−−−−TY−−−−−−H−−NYSTSTTS−−−−−−−−−−−−SSVRLSNGNTAGATGSSAAQIMAQRTGVSASTWAAIIARESNGQVNAYNPSGASGLFQTMPGWGPT−−−−−−−−−−−−NTVDQ−−−QINAAVKAYKAQGLGAW   
fig|1158485.3.peg.659   Staphylococcus aureus M1311     MKKTIMASSLAVALGVTGYAAGTGHQAHAAEVNVDQAHLVDLAH−−−−−−−−NHQDQLNAAPIKDGAYDIHFVKDGFQYNFTSNGTTWS