(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00009377

fig|575603.3.peg.925   Lactobacillus gasseri SJ-9E-US                                           KYTRLGKDTVDPNVASELFTSQ−−ASS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YNTVAQ−−−−−−−−−−−−−−−−−−TQTTQGSYSAPKTSVGSYSSA−−−−−−QNTQTQQAPVQKAQ−−PAQS−−−−−−−−−−QSSYTS−−−−−NVSGSEAAAKAWIAGRESGGSYSARN−−GQYIGKYQLSASYLGGDYSAANQ−−−−−−−−ERVADNYVKSRYGSWSNAQSFWQANGWY
fig|630527.3.peg.1634   Lactobacillus gasseri 202-4                                           KYTRLGKDTVDPNVASELFTSQ−−ASS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YNTVAQ−−−−−−−−−−−−−−−−−−TQTTQGSYSAPKTSVGSYSSA−−−−−−QNTQTQQAPVQKAQ−−PAQS−−−−−−−−−−QSSYTS−−−−−NVSGSEAAAKAWIAGRESGGSYSARN−−GQYIGKYQLSASYLGGDYSAANQ−−−−−−−−ERVADNYVKSRYGSWSNAQSFWQANGWY
fig|679196.3.peg.501   Lactobacillus gasseri 224-1                                           KYTRLGKDTVDPNVASELFTSQ−−ASS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YNTVAQ−−−−−−−−−−−−−−−−−−TQTTQGSYSAPKTSVGSYSSA−−−−−−QNTQTQQAPVQKAQ−−PAQS−−−−−−−−−−QSSYTS−−−−−NVSGSEAAAKAWIAGRESGGSYSARN−−GQYIGKYQLSASYLGGDYSAANQ−−−−−−−−ERVADNYVKSRYGSWSNAQSFWQANGWY
fig|559301.5.peg.901   Lactobacillus gasseri MV-22                                           KYTRLGKDTVDPNVASELFTSQ−−ASS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YNTVAQ−−−−−−−−−−−−−−−−−−TQTTQGSYSAPKTSVGSYSSA−−−−−−QNTQTQQAPVQKAQ−−PAQS−−−−−−−−−−QSSYTS−−−−−NVSGSEAAAKAWIAGRESGGSYSARN−−GQYIGKYQLSASYLGGDYSAANQ−−−−−−−−ERVADNYVKSRYGSWSNAQSFWQANGWY
fig|324831.10.peg.1451   Lactobacillus gasseri ATCC 33323                                           KYTRLGKDTVDPNVASELFTSQ−−ASS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YNTVAQ−−−−−−−−−−−−−−−−−−TQTTQGSYSAPKTSVGSYSSA−−−−−−QNTQTQQAPVQKAQ−−PAQS−−−−−−−−−−QSSYTS−−−−−NVSGSEAAAKAWIAGRESGGSYSARN−−GQYIGKYQLSASYLGGDYSAANQ−−−−−−−−ERVADNYVKSRYGSWSNAQSFWQANGWY
fig|525326.3.peg.43   Lactobacillus gasseri JV-V03                                           KYTRLGKDTVDPNVASDLFTSQ−−ASS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YNTAAQ−−−−−−−−−−−−−−−−−−TQTTQGSYSAPKTSVGSYSSV−−−−−−QSTQTQQAPVQKAQ−−PSQS−−−−−−−−−−QSSYTS−−−−−NVSGSEAAAKAWIAGRESGGSYSARN−−GQYVGKYQLSASYLGGDYSAANQ−−−−−−−−ERVADNYVKSRYGSWTNAQSFWQANGWY
fig|257314.6.peg.1569   Lactobacillus johnsonii NCC 533                                           KYTRLGKDTVDPNVASELFTSQ−−ASS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YNTAAQ−−−−−−−−−−−−−−−−−−TQTTQGSYSAPKTSVGTYSSVQSTQPAQSTQQTQPVQQQAQ−−PAQS−−−−−−−−−−QSSYTS−−−−−NVSGSEAAAKAWIAGRESGGSYSARN−−GQYIGKYQLSASYLGGDYSAANQ−−−−−−−−ERVADNYVKSRYGSWSNAQSFWQANGWY
fig|525330.3.peg.16   Lactobacillus johnsonii ATCC 33200                                           KYTRLGKDTVDPNVASELFTSQ−−ASS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YNTAAQ−−−−−−−−−−−−−−−−−−TQTTQGSYSAPKTSVGTYSSV−−−−−−QSTQQTQPVQQAQ−−PAQS−−−−−−−−−−QSSYTS−−−−−NVSSSEAAAKAWIAGRESGGSYSARN−−GQYIGKYQLSASYLGGDYSAANQ−−−−−−−−ERVADNYVKSRYGSWSNAQSFWQANGWY
fig|633699.4.peg.1463   Lactobacillus johnsonii FI9785                                           KYTRLGKDTVDPNVASELFTSQ−−ASS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YNTAAQ−−−−−−−−−−−−−−−−−−TQTTQGSYSAPKTSVGTYSSV−−−−−−QSTQQTQPVQQAQ−−PAQS−−−−−−−−−−QSSYTS−−−−−NVSGSEAAAKAWIAGRESGGSYSARN−−GQYIGKYQLSASYLGGDYSAANQ−−−−−−−−ERVADNYVKSRYGSWSNAQSFWQANGWY
fig|525330.3.peg.17   Lactobacillus johnsonii ATCC 33200                                     TTVQAPVQKQETTQVQQAKPATPAASQQ−−ASA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QQTTQVQAPAQKQQTVVQAPKTNY−−−−−−−−−−−−NYNVQRTYSAPVQQQRTYSYA−−−−−−PAQKQTA−−−−−−−−−−QTQA−−−−−−−−−−TTSYTS−−−−−NTSGSEAAAKAWIAGRESGGSYSARN−−GQYIGKYQLSASYLGGDYSAENQ−−−−−−−−ERVADNYVKSRYGSWTGAQKFWQTNGWY
fig|633699.4.peg.1462   Lactobacillus johnsonii FI9785                                                  QQVSAQPAQAQTKQAPVASA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QQTTQVQAPVQKQQTAVQAPKTNY−−−−−−−−−−−−NYNVQRTYSAPVQQQRTYSYA−−−−−−PAQKQTT−−−−RVAQPAQTQA−−−−−−−−−−TTSYTS−−−−−NASGSEAAAKAWIAGRESGGSYSARN−−GQYIGKYQLSASYLGGDYSAENQ−−−−−−−−ERVADNYVKSRYGSWTGAQKFWQTNGWY
fig|679196.3.peg.502   Lactobacillus gasseri 224-1                                           KYTVEGGNTATASVATQAPVQT−−ATA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VQHQVQTQAPVQHQTVAQAPKTNY−−−−−−−−−−−−NYNVQRTYSAPV−−QRRTYSYA−−−−−−PAQKQTT−−−−QVAQ−−KTQS−−−−−−−−−−TTSYTS−−−−−NASGSEAAAKAWIAGRESGGSYSARN−−GQYIGKYQLSASYLGGDYSAANQ−−−−−−−−ERVADNYVKSRYGSWTGAQKFWQTNGWY
fig|575603.3.peg.924   Lactobacillus gasseri SJ-9E-US                                                          AQASTQT−−KQA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PVQHQVQTQAPVQHQTVAQAPKTNY−−−−−−−−−−−−NYNVQRTYSAPV−−QRRTYSYA−−−−−−PAQKQTT−−−−QVAQ−−KTQS−−−−−−−−−−TTSYTS−−−−−NASGSEAAAKAWIAGRESGGSYSARN−−GQYIGKYQLSASYLGGDYSAANQ−−−−−−−−ERVADNYVKSRYGSWTGAQKFWQTNGWY
fig|324831.10.peg.1450   Lactobacillus gasseri ATCC 33323                                                          AQASTQT−−KQA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PVQHQVQTQAPVQHQTVAQAPKTNY−−−−−−−−−−−−NYNVQRTYSAPV−−QRRTYSYA−−−−−−PAQKQTT−−−−QVAQ−−KTQS−−−−−−−−−−TTSYTS−−−−−NASGSEAAAKAWIAGRESGGSYSARN−−GQYIGKYQLSASYLGGDYSAANQ−−−−−−−−ERVADNYVKSRYGSWTGAQKFWQTNGWY
fig|630527.3.peg.1633   Lactobacillus gasseri 202-4                                                          AQASTQT−−KQA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PVQHQVQTQAPVQHQTVAQAPKTNY−−−−−−−−−−−−NYNVQRTYSAPV−−QRRTYSYA−−−−−−PAQKQTT−−−−QVAQ−−KTQS−−−−−−−−−−TTSYTS−−−−−NASGSEAAAKAWIAGRESGGSYSARN−−GQYIGKYQLSASYLGGDYSAANQ−−−−−−−−ERVADNYVKSRYGSWTGAQKFWQTNGWY
fig|491077.3.peg.1333   Lactobacillus reuteri SD2112                                    NLIYVGQQLVIKDDGEVAPATQEEVATLP−−AAN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VAPQATPAENQAQQ−−−−−−−−−−−−−−−−−−NQQVQSNQEAPVAQQ−−−−−−−−−−−−−QVQTPQT−−−−QNVQQSSAQA−−−−−−−−−−STGYNS−−−−−NVAGNDDAAKAWIAARESGGSYSARN−−GQYIGKYQLSASYLNGDYSEANQ−−−−−−−−ERVADQYVASRYGSWSAAQSFWQSHGWY
fig|491077.3.peg.1331   Lactobacillus reuteri SD2112                                          EASQAPASASVESQQPSQAPVVA−−SQA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PVATSQVQSSAAPV−−−−−−−−−−−−SAPAQSQAPV−−−−−−−−−−−−−−−−QSVAPQH−−−−STVSAAAQQSYSAPVQAQATSSNYSS−−−−−NVSGNDAAAKAWIAARESGGSYSARN−−GQYVGKYQLSASYLNGDYSEANQ−−−−−−−−ERVADQYVANRYGSWSAAQSFWQSHGWY
fig|349123.6.peg.446   Lactobacillus reuteri 100-23                                                ASASVESQQPSQAPVVA−−SQA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PVATSQVQSSAAPVSAPAQSQAPVQSQAPVQQQAPV−−−−−−−−−−−−−−−−QSVAPQQ−−−−STASAAQQSYSAPVQTQATSSNYSS−−−−−SVSGNDAAAKAWIAARESGGSYSARN−−GQYVGKYQLSSSYLNGDYSEANQ−−−−−−−−ERVADQYVTNRYGSWSAAQSFWQSHGWY
fig|585517.3.peg.1659   Lactobacillus reuteri MM2-3                                           ASQVPASASVESQQPSQAPVVA−−SQA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PVATSQVQS−−−−−−−−−−−−−−−−−QAPVQQQAPV−−−−−−−−−−−−−−−−QSVAPQQ−−−−STVSAAAQQSYSAPVQAQATSSNYSS−−−−−NVSGNDAAAKAWIAARESGGSYSARN−−GQYVGKYQLSASYLNGDYSEANQ−−−−−−−−ERVADQYVANRYGSWSAAQSFWQSHGWY
fig|1074160.3.peg.1721   Streptococcus mutans TCI-219         TTTAPVQESQ−−−−−−−−−−−−−−−−−−−−−−−−TSEVITSAPAETSQTSEVPTEA−−NQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TNEVSSAVSVET−−−−−−−−−−−−SQTSEATTSAPVETSQTSEATTAEPTETKTSQT−−−−NEVAASAEEN−−−−−−−−−QTTSNTS−−−−−GLSTSDAAAKEFIAQKESGGNYNAKN−−GQYYGRYQLSDSYLNGDLSEENQ−−−−−−−−ERVADAYVSSRYGSWTAAQAFWNANGWY
fig|210007.7.peg.1909   Streptococcus mutans UA159         TTTAPVQESQ−−−−−−−−−−−−−−−−−−−−−−−−TSEVITSAPAETSQTSEVPTEA−−NQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TNEVSSAVSVET−−−−−−−−−−−−SQTSEATTSAPVETSQTSEATTAEPTETKTSQT−−−−NEVAASAEEN−−−−−−−−−QTTSNTS−−−−−GLSTSDAAAKEFIAQKESGGNYNAKN−−GQYYGRYQLSDSYLNGDLSEENQ−−−−−−−−ERVADAYVSSRYGSWTAAQAFWNANGWY
fig|857108.3.peg.656   Streptococcus mutans SM1         TTTAPVQESQ−−−−−−−−−−−−−−−−−−−−−−−−TSEVITSAPAETSQTSEVPTEA−−NQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TNEVSSAVSVET−−−−−−−−−−−−SQTSEATTSAPVETSQTSEATTAEPTETKTSQT−−−−NEVAASAEEN−−−−−−−−−QTTSNTS−−−−−GLSTSDAAAKEFIAQKESGGNYNAKN−−GQYYGRYQLSDSYLNGDLSEENQ−−−−−−−−ERVADAYVSSRYGSWTAAQAFWNANGWY
fig|592026.3.peg.307   Catonella morbi ATCC 51271                                             AEPASAQEQASQSSESQVQA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ASEVNAPVSVEE−−−−−−−−−−−−SSSPVAESTAPVAETPAPVQEAPATPAAPALAES−−−−SEEAAPAAEE−−−−SKTEETSNSSSS−−−−−GYQGIQSAAKEWIAQKESGGDYNAVNPSGRYIGRYQLTAEYLNGDYSIENQ−−−−−−−−ERVADEYVKNRYGSWEAAKVFWEANGWY
fig|655812.3.peg.630   Aerococcus viridans ATCC 11563                                                     PGTKLSFTKDET−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TGEVNEVTVEDSVSEEATTYDVAEEEVTETTYEAPA−−−−−−−−−−−−−−−EETYVAEE−−−−TTYKAPAAET−−−−−−−TASTTSYSS−−−−−−−−−−−NSAKEIIAQRESGGSYTAYNAAGGYYGRYQLNPTLVAYGASPAEQ−−−−−−−−EVAADKYVAERYGSWNAALAFWNANGWY
fig|349519.10.peg.513   Leuconostoc citreum KM20                                         GIDDAVKSLSDVNSIQLSASKSHQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PERTQQLTAEASVKQNE−−−−−−−−−−AKAEPAP−−−−−−−−−−−−AVQTQTLNHIDMNEQQVAVEPKTNDQLSVPSSQSANVVATAA−−−−−PKPVTNTGDIQWLITRESHGDAHATN−−GAYYGIGQLAESYYDKYVPGQNYRGNYDVQLEAMQKYIAERYGTVDNAISHWQSNNWY
fig|1158477.3.peg.1461   Staphylococcus aureus M1216     MKKTLLASSLAVGLGIVAGNA−−GHEAHASEADLNKASLAQMAQSNDQTLNQKPIEA−−GAY−−NYTFDYEGFTYHFESDGTHFAWNYHATG−−−−−−−−−−−−−−ANGANMSAQAPATNNVEPSAVQANQVQ−−−−−−−−−−−−SQEVEAP−−−QNAQ−−TQQPQ−−ASTSNNS−−−−QVTATPTES−−−−−−−−−KASEGSSVN−−−−−−−−−−VNAHLKQIAQRESGGNIHAVNPTSGAAGKYQFLQSTWDSVAPAKYKGVSPANAPESVQDAAAVKLYNTGGA           
fig|1158486.3.peg.1591   Staphylococcus aureus M1320     MKKTLLASSLAVGLGIVAGNA−−GHEAHASEADLNKASLAQMAQSNDQTLNQKPIEA−−GAY−−NYTFDYEGFTYHFESDGTHFAWNYHATG−−−−−−−−−−−−−−ANGANMSAQAPATNNVEPSAVQANQVQ−−−−−−−−−−−−SQEVEAP−−−QNAQ−−TQQPQ−−ASTSNNS−−−−QVTATPTES−−−−−−−−−KASEGSSVN−−−−−−−−−−VNAHLKQIAQRESGGNIHAVNPTSGAAGKYQFLQSTWDSVAPAKYKGVSPANAPESVQDAAAVKLYNTGGA           
fig|450394.6.peg.2617   Staphylococcus aureus subsp. aureus USA300_TCH959     MKKTLLASSLAVGLGIVAGNA−−GHEAHASEADLNKASLAQMAQSNDQTLNQKPIEA−−GAY−−NYTFDYEGFTYHFESDGTHFAWNYHATG−−−−−−−−−−−−−−ANGANMSAQAPATNNVEPSAVQANQVQ−−−−−−−−−−−−SQEVEAP−−−QNAQ−−TQQPQ−−ASTSNNS−−−−QVTATPTES−−−−−−−−−KASEGSSVN−−−−−−−−−−VNAHLKQIAQRESGGNIHAVNPTSGAAGKYQFLQSTWDSVAPAKYKGVSPANAPESVQDAAAVKLYNTGGA           
fig|505321.3.peg.2735   Staphylococcus aureus subsp. aureus str. CF-Marseille     MKKTLLASSLAVGLGIVAGNA−−GHEAHASEADLNKASLAQMAQSNDQTLNQKPIEA−−GAY−−NYTFDYEGFTYHFESDGTHFAWNYHATG−−−−−−−−−−−−−−ANGANMSAQAPATNNVEPSAVQANQVQ−−−−−−−−−−−−SQEVEAP−−−QNAQ−−TQQPQ−−ASTSNNS−−−−QVTATPTES−−−−−−−−−KASEGSSVN−−−−−−−−−−VNAHLKQIAQRESGGNIHAVNPTSGAAGKYQFLQSTWDSVAPAKYKGVSPANAPESVQDAAAVKLYNTGGA           
fig|889933.4.peg.1886   Staphylococcus aureus subsp. aureus ECT-R 2     MKKTLLASSLAVGLGIVAGNA−−GHEAHASEADLNKASLAQMAQSNDQTLNQKPIEA−−GAY−−NYTFDYEGFTYHFESDGTHFAWNYHATG−−−−−−−−−−−−−−ANGANMSAQAPATNNVEPSAVQANQVQ−−−−−−−−−−−−SQEVEAP−−−QNAQ−−TQQPQ−−ASTSNNS−−−−QVTATPTES−−−−−−−−−KASEGSSVN−−−−−−−−−−VNAHLKQIAQRESGGNIHAVNPTSGAAGKYQFLQSTWDSVAPAKYKGVSPANAPESVQDAAAVKLYNTGGA           
fig|904731.3.peg.1438   Staphylococcus aureus subsp. aureus 21201     MKKTLLASSLAVGLGIVAGNA−−GHEAHASEADLNKASLAQMAQSNDQTLNQKPIEA−−GAY−−NYTFDYEGFTYHFESDGTHFAWNYHATG−−−−−−−−−−−−−−ANGANMSAQAPATNNVEPSAVQANQVQ−−−−−−−−−−−−SQEVEAP−−−QNAQ−−TQQPQ−−ASTSNNS−−−−QVTATPTES−−−−−−−−−KASEGSSVN−−−−−−−−−−VNAHLKQIAQRESGGNIHAVNPTSGAAGKYQFLQSTWDSVAPAKYKGVSPANAPESVQDAAAVKLYNTGGA           
fig|553601.3.peg.2389   Staphylococcus aureus A10102     MKKTLLASSLAVGLGIVAGNA−−GHEAHASEADLNKASLAQMAQSNDQTLNQKPIEA−−GAY−−NYTFDYEGFTYHFESDGTHFAWNYHATG−−−−−−−−−−−−−−ANGANMSAQAPATNNVEPSAVQANQVQ−−−−−−−−−−−−SQEVEAP−−−QNAQ−−TQQPQ−−ASTSNNS−−−−QVTATPTES−−−−−−−−−KASEGSSVN−−−−−−−−−−VNAHLKQIAQRESGGNIHAVNPTSGAAGKYQFLQSTWDSVAPAKYKGVSPANAPESVQDAAAVKLYNT              
fig|1123523.3.peg.2049   Staphylococcus aureus subsp. aureus 11819-97     MKKTLLASSLAVGLGIVAGNA−−GHEAHASEADLNKASLAQMAQSNDQTLNQKPIEA−−GAY−−NYTFDYEGFTYHFESDGTHFAWNYHATG−−−−−−−−−−−−−−ANGADMSAQAPATNNVAPSAVQANQVQ−−−−−−−−−−−−SQEVEAP−−−QNAQ−−TQQPQ−−ASTSNNS−−−−QVTATPTES−−−−−−−−−KASEGSSVN−−−−−−−−−−VNAHLKQIAQRESGGNIHAVNPTSGAAGKYQFLQSTWDSVAPAKYKGVSPANAPESVQDAAAVKLYNTGGA           
fig|904747.3.peg.36   Staphylococcus aureus subsp. aureus 21266     MKKTLLASSLAVGLGIVAGNA−−GHEAHASEADLNKASLAQMAQSNDQTLNQKPIEA−−GAY−−NYTFDYEGFTYHFESDGTHFAWNYHATG−−−−−−−−−−−−−−ANGADMSAQAPATNNVAPSAVQANQVQ−−−−−−−−−−−−SQEVEAP−−−QNAQ−−TQQPQ−−ASTSNNS−−−−QVTATPTES−−−−−−−−−KASEGSSVN−−−−−−−−−−VNAHLKQIAQRESGGNIHAVNPTSGAAGKYQFLQSTWDSVAPAKYKGVSPANAPESVQDAAAVKLYNTGGA           
fig|931460.3.peg.2053   Staphylococcus aureus subsp. aureus CIGC93     MKKTLLASSLAVGLGIVAGNA−−GHEAHASEADLNKASLAQMAQSNDQTLNQKPIEA−−GAY−−NYTFDYEGFTYHFESDGTHFAWNYHATG−−−−−−−−−−−−−−ANGADMSAQAPATNNVAPSAVQANQVQ−−−−−−−−−−−−SQEVEAP−−−QNAQ−−TQQPQ−−ASTSNNS−−−−QVTATPTES−−−−−−−−−KASEGSSVN−−−−−−−−−−VNAHLKQIAQRESGGNIHAVNPTSGAAGKYQFLQSTWDSVAPAKYKGVSPANAPESVQDAAAVKLYNTGGA           
fig|1028799.3.peg.1856   Staphylococcus aureus subsp. aureus VC40     MKKTLLASSLAVGLGIVAGNA−−GHEAHASEADLNKASLAQMAQSNDQTLNQKPIEA−−GAY−−NYTFDYEGFTYHFESDGTHFAWNYHATG−−−−−−−−−−−−−−TNGADMSAQAPATNNVAPSAVQANQVQ−−−−−−−−−−−−SQEVEAP−−−QNAQ−−TQQPQ−−ASTSNNS−−−−QVTATPTES−−−−−−−−−KSSEGSSVN−−−−−−−−−−VNAHLKQIAQRESGGNIHAVNPTSGAAGKYQFLQSTWDSVAPAKYKGVSPANAPESVQDAAAVKLYNTGGA           
fig|452948.4.peg.1686   Staphylococcus aureus 930918-3     MKKTLLASSLAVGLGIVAGNA−−GHEAHASEADLNKASLAQMAQSNDQTLNQKPIEA−−GAY−−NYTFDYEGFTYHFESDGTHFAWNYHATG−−−−−−−−−−−−−−TNGADMSAQAPATNNVAPSAVQANQVQ−−−−−−−−−−−−SQEVEAP−−−QNAQ−−TQQPQ−−ASTSNNS−−−−QVTATPTES−−−−−−−−−KSSEGSSVN−−−−−−−−−−VNAHLKQIAQRESGGNIHAVNPTSGAAGKYQFLQSTWDSVAPAKYKGVSPANAPESVQDAAAVKLYNTGGA           
fig|455227.3.peg.1283   Staphylococcus aureus D30     MKKTLLASSLAVGLGIVAGNA−−GHEAHASEADLNKASLAQMAQSNDQTLNQKPIEA−−GAY−−NYTFDYEGFTYHFESDGTHFAWNYHATG−−−−−−−−−−−−−−TNGADMSAQAPATNNVAPSAVQANQVQ−−−−−−−−−−−−SQEVEAP−−−QNAQ−−TQQPQ−−ASTSNNS−−−−QVTATPTES−−−−−−−−−KSSEGSSVN−−−−−−−−−−VNAHLKQIAQRESGGNIHAVNPTSGAAGKYQFLQSTWDSVAPAKYKGVSPANAPESVQDAAAVKLYNTGGA           
fig|904784.3.peg.418   Staphylococcus aureus subsp. aureus IS-125     MKKTLLASSLAVGLGIVAGNA−−GHEAHASEADLNKASLAQMAQSNDQTLNQKPIEA−−GAY−−NYTFDYEGFTYHFESDGTHFAWNYHATG−−−−−−−−−−−−−−TNGADMSAQAPATNNVAPSAVQANQVQ−−−−−−−−−−−−SQEVEAP−−−QNAQ−−TQQPQ−−ASTSNNS−−−−QVTATPTES−−−−−−−−−KSSEGSSVN−−−−−−−−−−VNAHLKQIAQRESGGNIHAVNPTSGAAGKYQFLQSTWDSVAPAKYKGVSPANAPESVQDAAAVKLYNTGGA           
fig|93062.19.peg.2033   Staphylococcus aureus subsp. aureus COL     MKKTLLASSLAVGLGIVAGNA−−GHEAHASEADLNKASLAQMAQSNDQTLNQKPIEA−−GAY−−NYTFDYEGFTYHFESDGTHFAWNYHATG−−−−−−−−−−−−−−TNGADMSAQAPTTNNVAPSAVQANQVQ−−−−−−−−−−−−SQEVEAP−−−QNAQ−−TQQPQ−−ASTSNNS−−−−QVTATPTES−−−−−−−−−KSSEGSSVN−−−−−−−−−−VNAHLKQIAQRESGGNIHAVNPTSGAAGKYQFLQSTWDSVAPAKYKGVSPANAPESVQDAAAVKLYNTGGA           
fig|273036.6.peg.2087   Staphylococcus aureus RF122     MKKTLLASSLAVGLGIVAGNA−−GHEAHASEADLNKASLAQMAQSNDQTLNQKPIEA−−GAY−−NYTFDYEGFTYHFESDGTHFAWNYHATG−−−−−−−−−−−−−−ANGADMSAQAPATNNVAPSADQANQVQ−−−−−−−−−−−−SQEVEAP−−−QNAQ−−TQQPQ−−ASTSNNS−−−−QVTATPTES−−−−−−−−−KASEGSSVN−−−−−−−−−−VNDHLKQIAQRESGGNIHAVNPTSGAAGKYQFLQSTWDSVAPAKYKGVSPANAPESVQDAAAVKLYNTGGA           
fig|985006.4.peg.1915   Staphylococcus aureus subsp. aureus LGA251     MKKTLLASSLAVGLGIVAGNA−−GHEAHASEADLNKASLAQMAQSNDQTLNQKPIEA−−GAY−−NYTFDYEGFTYHFESDGTHFAWNYHATG−−−−−−−−−−−−−−ANGADMSAQAPATNNVAPSADQANQVQ−−−−−−−−−−−−SQEVEAP−−−QNAQ−−TQQPQ−−ASTSNNS−−−−QVTATPTES−−−−−−−−−KASEGSSVN−−−−−−−−−−VNDHLKQIAQRESGGNIHAVNPTSGAAGKYQFLQSTWDSVAPAKYKGVSPANAPESVQDAAAVKLYNTGGA           
fig|553583.3.peg.421   Staphylococcus aureus A9635     MKKTLLASSLAVGLGIVAGNA−−GHEAHASESDLNKASLAQMAQSNDQTLNQKPIEA−−GAY−−NYTFDYEGFTYHFESDGTYFAWNYHATG−−−−−−−−−−−−−−ANGADMSAQAPATNNVAPSADQANQVQ−−−−−−−−−−−−SQEVEAP−−−QNAQ−−TQQPQ−−ASTSNNS−−−−QVTATPTES−−−−−−−−−KASEGSSVN−−−−−−−−−−VNDHLKQIAQRESGGNIHAVNPTSGAAGKYQFLQSTWDSVAPAKYKGVSPANAPESVQDAAAVKLYNTGGA           
fig|548473.6.peg.1068   Staphylococcus aureus subsp. aureus TCH60     MKKTLLASSLAVGLGIVAGNA−−GHEAQASEADLNKASLAQMAQSNDQTLNQKPIEA−−GAY−−NYTFDYEGFTYHFESDGTHFAWNYHATG−−−−−−−−−−−−−−ANGADMSAQAPATNNVAPSADQSNQVQ−−−−−−−−−−−−SQEVEAP−−−QNAQ−−TQQPQ−−ASTSNNS−−−−QVTATPTES−−−−−−−−−KASEGSSVN−−−−−−−−−−VNDHLKQIAQRESGGNIHAVNPTSGAAGKYQFLQSTWDSVAPAKYKGVSPANAPESVQDAAAVKLYNTGGA           
fig|904728.3.peg.830   Staphylococcus aureus subsp. aureus 21195     MKKTLLASSLAVGLGIVAGNA−−GHEAQASEADLNKASLAQMAQSNDQTLNQKPIEA−−GAY−−NYTFDYEGFTYHFESDGTHFAWNYHATG−−−−−−−−−−−−−−ANGADMSAQAPATNNVAPSADQSNQVQ−−−−−−−−−−−−SQEVEAP−−−QNAQ−−TQQPQ−−ASTSNNS−−−−QVTATPTES−−−−−−−−−KASEGSSVN−−−−−−−−−−VNDHLKQIAQRESGGNIHAVNPTSGAAGKYQFLQSTWDSVAPAKYKGVSPANAPESVQDAAAVKLYNTGGA           
fig|931452.3.peg.2810   Staphylococcus aureus subsp. aureus CIG1267     MKKTLLASSLAVGLGIVAGNA−−GHEAQASEADLNKASLAQMAQSNDQTLNQKPIEA−−GAY−−NYTFDYEGFTYHFESDGTHFAWNYHATG−−−−−−−−−−−−−−ANGADMSAQAPATNNVAPSADQSNQVQ−−−−−−−−−−−−SQEVEAP−−−QNAQ−−TQQPQ−−ASTSNNS−−−−QVTATPTES−−−−−−−−−KASEGSSVN−−−−−−−−−−VNDHLKQIAQRESGGNIHAVNPTSGAAGKYQFLQSTWDSVAPAKYKGVSPANAPESVQDAAAVKLYNTGGA           
fig|1034809.4.peg.959   Staphylococcus lugdunensis N920143     MKKTIIASSLAVGLGLVAGNA−−GHDADASELNVNTKAELAQLAQSNDQSLNEKPVQS−−GAY−−DFTFNYEGTTYHFASDGTYFEWQYYPSN−−−−−−−−−−−−−−GAADDTTMNSQAQQGTMSSSQGAATQQST−−−−−−SAQPAQTEQAP−−−QSES−−TQQPQTQATSHSQS−−−−−−−−−SSAS−−−−−−−−−QASSHSSVN−−−−−−−−−−VNSHLKAIAQRESGGDIHAVNPSSGAAGKYQFMQSTWDHVAPSEYKGVSPANAPEHVQDAAAQKLYDTEG            
fig|698737.3.peg.909   Staphylococcus lugdunensis HKU09-01     MKKTIIASSLAVGLGLVAGNA−−GHDADASELNVNTKAELAQLAQSNDQSLNEKPVQS−−GAY−−DFTFNYEGTTYHFASDGTYFEWQYYPSN−−−−−−−−−−−−−−GAADDTTMNSQAQQGTMSSSQGAATQQST−−−−−−SAQPAQTEQAP−−−QSES−−TQQPQTQATSHSQS−−−−−−−−−SSAS−−−−−−−−−QASSHSSVN−−−−−−−−−−VNSHLKAIAQRESGGDIHAVNPSSGAAGKYQFMQSTWDHVAPSEYKGVSPANAPEHVQDAAAQKLYDTEG            
fig|629742.3.peg.763   Staphylococcus hominis SK119     MKKTIIASSLAVGLGLVAGNV−−SH−−ADASENQINKEKLAQLAESNDQSLNQHPIQE−−GAY−−NYQFNLNGKTYHFWSDGTYFKWEYYPSNGSTVNSANQNVASTQTAQNVSYQNNNYKNINQSASTSNVSQHY−−−−−−ANEAQTQQAP−−−KTTQ−−TKQ−−−−ATQTQQA−−−−PANATTNQPK−−−−−−−−QSTSGSSVN−−−−−−−−−−VNSHLQQIAQRESGGDIHAINPSSGAAGKYQFLQSTWDSVAPAQYKGVSPAQAPESVQDAAAVKLYNTAGPSQ         
fig|279808.8.peg.926   Staphylococcus haemolyticus JCSC1435     MKKTIIASSLAVGLGVVAGNA−−GH−−ADASEAQVNKAELAQLAQSNDQSLNDSPIQE−−GAY−−NVTFDYEGFTYHFESDGTNWSWNYAQSG−−−−−−−−−−−−QASQQQDVSAQASTVSNQTSAEQVGSQQQSS−−−−−−QAQPTQTQQAP−−−QTEQ−−TQQPQTEATTSNSS−−−−−−−−−SSNN−−−−−−−−−NASSGSSVN−−−−−−−−−−VNSHLQQIAQRESGGDITAINPSSGAAGKYQFLQSTWDSVAPDEYKGVSPAQAPEDVQDAAAVKLYNTAGASQ         
fig|525378.3.peg.2383   Staphylococcus epidermidis M23864:W1     MKKTLIASSLAVGLGVVAGNA−−GHDAHASEATNVDKAELAQKAQSNDQSLNESPIQE−−GAY−−NVTFDYNGFTYHFESDGNNWSWNYAQTG−−−−−−−−−−−−QATPQQDVSEQASASNNQTSAEQVSAQQQSN−−−−−−QAQPEQTAAP−−−QTEQ−−TQQPQAKATTSYSAPSNN−−−−−TSSS−−−−−−−−−KASSGSSVN−−−−−−−−−−VNSHLQQIAQRESGGDIHAINPSSGAAGKYQFLQSTWDSVAPSQYKGQSPANAPESVQDAAAVKLYNTAGANQ         
fig|553212.3.peg.1725   Staphylococcus capitis SK14     MKKTIIASSLAVGLGVVAGNA−−GHDAHASEATNVDKAELAQKAQSNDQSLNESPIQK−−GAY−−NVNFDYNGFNYHFESNGTHWSWNYAQNG−−−−−−−−−−−−QATPQQDVS−−−−−−−NQTSADQVSSQQQTS−−−−−−QAQPEQTSAP−−−QTEQ−−TQQPQAKATTSYSAPTNNTASSQASTN−−−−−−−−−QASSGSSVN−−−−−−−−−−LNSHLKQIAQRESGGDIHAINPSTGAAGKFQFLQSTWDSVAPEQYKGQSPANAPESVQDAAAVKLYNTAGASQ         
fig|904334.3.peg.950   Staphylococcus epidermidis VCU116     MKKTIIASSLAVGLGVVAGNA−−GHDAHASEATNVDKAELAQKAQSNDQSLNESPIQK−−GAY−−NVNFDYNGFNYHFESNGTHWSWNYAQNG−−−−−−−−−−−−QATPQQDVS−−−−−−−NQTSADQVSSQQQTS−−−−−−QAQPEQTSAP−−−QTEQ−−TQQPQAKATTSYSAPTNNTASSQASTN−−−−−−−−−QASSGSSVN−−−−−−−−−−LNSHLKQIAQRESGGDIHAINPSTGAAGKFQFLQSTWDSVAPEQYKGQSPANAPESVQDAAAVKLYNTAGASQ         
fig|904334.4.peg.950   Staphylococcus capitis VCU116     MKKTIIASSLAVGLGVVAGNA−−GHDAHASEATNVDKAELAQKAQSNDQSLNESPIQK−−GAY−−NVNFDYNGFNYHFESNGTHWSWNYAQNG−−−−−−−−−−−−QATPQQDVS−−−−−−−NQTSADQVSSQQQTS−−−−−−QAQPEQTSAP−−−QTEQ−−TQQPQAKATTSYSAPTNNTASSQASTN−−−−−−−−−QASSGSSVN−−−−−−−−−−LNSHLKQIAQRESGGDIHAINPSTGAAGKFQFLQSTWDSVAPEQYKGQSPANAPESVQDAAAVKLYNTAGASQ         
fig|596319.3.peg.1553   Staphylococcus warneri L37603     MKKTIIASSLAVGLGVVAGNA−−GHDAHASEANINEAELAQKAQSNDQSLNESPIQE−−GAY−−NYTFDYNGFTYHFESDGTNFSWYFHQSGQSNEASNT−−−−QAQPQQDVSEQASASTNQTSAEEVSNQQQSN−−−−−−SAQPEQVSAP−−−QTEQ−−TQQPQQEATTSNNE−−−−−−−−−SSSS−−−−−−−−−EASSGSSVN−−−−−−−−−−VNDHLKQIAQRESGGDIHATNPSTGASGKYQFLQSTWDSVAPAEYKG                                   
fig|1327991.3.peg.2332   Staphylococcus epidermidis UC7032     MKKTLVASSLAIGLGVVAGNA−−GHDAHASETTNVDKAELAQKALTNDQSLNESPVQE−−GAY−−NINFDYNGNSYHFESDGSTWSWSYESTN−−−−−−−−−−−−−−−−−−−−−−−−−−−−NATQPVQPSQSQVAT−−−−−−QQQPVQVSAP−−−QNEQ−−TAQPQTKSTS−−−−−−−−−−ASQTSSS−−−−−−−−−KASSGSSVN−−−−−−−−−−VNSHLQQIAQRESGGDIHAINPSSGAAGKYQFLQSTWDSVAPSQYKGVSPAKAPESVQDKAAVKLYNT              
fig|525376.3.peg.2293   Staphylococcus epidermidis W23144     MKKTLVASSLAIGLGVVAGNA−−GHDAHASETTNVDKAELAQKALTNDQSLNESPVQE−−GAY−−NINFDYNGNSYHFESDGSTWSWSYESTN−−−−−−−−−−−−−−−−−−−−−−−−−−−−NATQPVQPSQSQVAT−−−−−−QQQPVQVSAP−−−QNEQ−−TAQPQTKSTS−−−−−−−−−−ASQTSSS−−−−−−−−−KASSGSSVN−−−−−−−−−−VNSHLQQIAQRESGGDIHAINPSSGAAGKYQFLQSTWDSVAPSQYKGVSPAKAPESVQDKAAVKLYNT              
fig|979211.3.peg.2038   Staphylococcus epidermidis NIHLM023     MKKTLVASSLAIGLGVVAGNA−−GHDAHASETTNVDKAELAQKALTNDQSLNESPVQE−−GAY−−NINFDYNGNSYHFESDGSTWSWSYESTN−−−−−−−−−−−−−−−−−−−−−−−−−−−−NATQPVQPSQSQVAT−−−−−−QQQPVQVSAP−−−QNEQ−−TAQPQTKSTS−−−−−−−−−−ASQTSSS−−−−−−−−−KASSGSSVN−−−−−−−−−−VNSHLQQIAQRESGGDIHAINPSSGAAGKYQFLQSTWDSVAPSQYKGVSPAKAPESVQDKAAVKLYNT              
fig|1155130.3.peg.2220   Staphylococcus epidermidis NIH051475     MKKTLVASSLAIGLGVVAGNA−−GHDAHASETTNVDKAELAQKALTNDQSLNESPVQE−−GAY−−NINFDYNGNSYHFESDGSTWSWSYESTN−−−−−−−−−−−−−−−−−−−−−−−−−−−−NATQPVQPSQSQVAT−−−−−−QQQPVQVSAP−−−QNEQ−−TAQPQTKSTS−−−−−−−−−−TSQTSSS−−−−−−−−−KASSGSSVN−−−−−−−−−−VNSHLQQIAQRESGGDIHAINPSSGAAGKYQFLQSTWDSVAPSQYKGVSPAKAPESVQDRAAVKLYNT              
fig|176279.9.peg.1662   Staphylococcus epidermidis RP62A     MKKTLVASSLAIGLGVVAGNA−−GHDAHASETTNVDKAELAQKALTNDQSLNESPVQE−−GAY−−NINFDYNGNSYHFESDGSTWSWSYESTN−−−−−−−−−−−−−−−−−−−−−−−−−−−−NATQPVQPSQSQVAT−−−−−−QQQPVQVSAP−−−QNEQ−−TAQPQTKSTS−−−−−−−−−−TSQTSSS−−−−−−−−−KASSGSSVN−−−−−−−−−−VNSHLQQIAQRESGGDIHAINPSSGAAGKYQFLQSTWDSVAPSQYKGVSPAKAPESVQDRAAVKLYNT              
fig|904328.3.peg.2062   Staphylococcus epidermidis VCU105     MKKTLVASSLAIGLGVVAGNA−−GHDAHASETTNVDKAELAQKALTNDQSLNESPVQE−−GAY−−NINFDYNGNSYHFESDGSTWSWSYESTN−−−−−−−−−−−−−−−−−−−−−−−−−−−−NATQPVQPSQSQVAT−−−−−−QQQPVQVSAP−−−QNEQ−−TAQPQTKSTS−−−−−−−−−−TSQTSSS−−−−−−−−−KASSGSSVN−−−−−−−−−−VNSHLQQIAQRESGGDIHAINPSSGAAGKYQFLQSTWDSVAPSQYKGVSPAKAPESVQDRAAVKLYNT              
fig|458233.11.peg.889   Macrococcus caseolyticus JCSC5402     MKKAIMTSTLALALGVTGVSASQADASTETAETNQINKAELANLALNNPSALNENPVHE−−GAY−−HYEFTKDGYHFTFDSNGAYWTWEYNHSG−−−−−−−−−−−−−−−−SADSEAFSSVTNNNFKQEAPAVQAQAP−−−−−−VAKTPAQTYVAP−−−−−−−−−−−−−−−−KAQNYQT−−−−QSTYKAPAQ−−−−−−−−−TQSATSPVS−−−−−−−−−−VNSHLQLIAQRESGGNIRAVNPTSGAAGKYQFLQSTWDSVAPAQWRGVSPASAPEAVQDAAAVKLYNTAGPSQ         
fig|396513.4.peg.1596   Staphylococcus carnosus subsp. carnosus TM300                        GV−−GANAHAAEDNNVNQDQLAQTALNNTQQLNDAPVQE−−GAY−−NIAFDNSGYNFNFNSDGTNWSWSYNADS−−−−−−−−−−−−−−−−SAQQAPAQSTTQEQAPAAQQAPAQSTT−−−−−−QEQAPAAQQAP−−−AQEQ−−TQQPAQQPAQ−−−−−−−−QQTQQPAQQ−−−−−−−−−SADSGSNVQ−−−−−−−−−−VNDHLKAIAQRESGGDIHAINSSSGAAGKYQFLQTTWDSVAPAEYQG                                   
fig|342451.4.peg.319   Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305     MKKTVIASTLAVGLGVTGIAA−−GNSADASEQGVDKAQLAQQAQSNPESLNAAPIQD−−GAY−−NINFNYNNTDYSFQSDGENFSWSYGEGSGEGSNASSEQATDNSSQQTAEQP−−−−−−−QQVEQPQQTEQAS−−−−−−TEQPAQEAAP−−−QTEA−−TQQPQQEATTQSASSSNESSSNESSSS−−−−−−−−−EASESSSSG−−−−−−−−−−VNAHLQQIAQRESGGDIHATNPSSGASGKFQFLQSTWDSVAPAEYQGQPAASAPESVQDAAAQKLYDTEG            
fig|342451.4.peg.1441   Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305     MKKTVVASTLAVGLGVTGFAA−−GNSADASEQGVDKAQLAQQAQSNPESLNEAPVQD−−GAY−−NINFNYNNTDYSFQSDGQYWTWSYGQGS−−−−−−−−−−−−TNAPAQETAEQP−−−−−−−QQVEQPQQTEQAS−−−−−−TEQPAEEAAP−−−QTEE−−TQQPQQEATTQTTSSSNESTSNESSSS−−−−−−−−−EASEGSSVN−−−−−−−−−−VNSHLQAIAQRESGGDLKAVNPSSGAAGKYQFLQSTWDSVAPSEYQGVSPTEAPEAVQDAAAVKLYNTAGASQ         
fig|342451.4.peg.318   Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305     MKKTVVASTLAVGLGVTGFAA−−GNSADASEQGVDKAQLAQQAQSNPESLNAAPVQD−−GAY−−DINFNYNNTDYSFQSDGQYWTWSYGQGS−−−−−−−−−−−−TNAPAQETAEQP−−−−−−−QLVEQPQQTEQAS−−−−−−TEQPAQEAAP−−−QTEE−−TQQPQQEATTQTTSSSNESTSNESSSS−−−−−−−−−EASEGSSVN−−−−−−−−−−VNSHLQAIAQRESGGDLKAVNPSSGAAGKYQFLQSTWDSVAPSEYQGVSPTEAPEAVQDAAAVKLYNTAGASQ         
fig|342451.4.peg.69   Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305     MKKTILASSLAVALGVTGYAATADHNQAHASEENIDQAHLADLAQNNPEQLNEKPLHA−−GAY−−NYDFVLGGNEYTFTSDGQTWSWNYTTAG−−−−−−−−AQSASSNTIQDVTAQATTHTNETSANEVRTQQQSS−−−−−−NTEVAAVEAP−−−KASS−−−NTNVQTAQTSTST−−−−−−−−−−−−−−KSTTTTTTTSTSSIDAIANQMAERTGVSASQWKGVIQRESGGNANAVNASSGAYGLFQLLGHGEHAGMSVQDQ−−−−−−−−−−−−MDKAVEVYNNQGAGA         
fig|1306952.3.peg.824   Pediococcus acidilactici D3                                ANADEIYTVKSGDTLSEISYAFNLNGNYDAIAQ−−ANHIKDVNFITVGQKLVIKDNGS−−−−−−−−−−−−−−−−−−−−−−−−IQKATKSEIKSLPEVDKDTNAAAATKQAT−−−−−−−−−−PAKTATP−−−KATS−−−−−−−−TKTASYSG−−−−−−−−−−−−−−−−−−−−−−−−NSSVSSVANEMASRTGVSAAKWQQIIMRESGGNANVSNASSGAYGLFQLLGHGEHAGMSVAEQ−−−−IN−−−−−−−−MATNVYNAQG            
fig|629742.3.peg.1303   Staphylococcus hominis SK119     MKKTVIASSLAVTLGLTGYALTNDHSAHASEQTTNYSHLADLAQNNPSELNAHPVQA−−GAY−−NISFVQDGFKYTFTSNGNTWSWNYTYTG−−−−−GADTAQS−−−−−−−−TTDYTDSYNQASTQSVSANNQAS−−−−−−TSNVKAVSAPVQKTSSY−−−−SNYSARTTSYSA−−−−−−−−−−−−−−−PKTTSYSTASTGGSVKAQFLA−−NGGTEAAWNAIVMPESGGNPNAVNPIGYRGLGQTKEAWGTGSVATQ−−−−−−−−TQGMVNYAKSRYGSWDAAIAFRQGHGWW
fig|279808.8.peg.480   Staphylococcus haemolyticus JCSC1435     MKKTVIASSLAVALGVTGYALTTDNSAHASESTTNYAQLANLAQNNPSELNAHPVQA−−GAY−−NITFVKDGFKYNFTSDGQSWSWNYTYVG−−−−−GADTVATTQAAPAAQSTDYSASYSNEASTQSVSSNQQSS−−−−−−NTNVEAVSAP−−−−−−−−−−−−−−−−KTTSYSA−−−−−−−−−−−−−−−−STSSSSSASTGGSVKEQFLA−−NGGTEAAWNAIVMPESGGNPNAVNPAGYRGLGQTKESWGTGSVASQ−−−−−−−−TKGMINYANSRYGSLDAAIAFRDNHGWW
fig|396513.4.peg.1595   Staphylococcus carnosus subsp. carnosus TM300     MKKLLVVSSVATAAFLATGAA−−SHNAHAAEVSQS−−QQQLAETALNNPSELNQHPVQA−−GAY−−NIDFVYNGNEFHFESDGQHFSWNYTAAG−−−−−−−−−−−−−−−−−−−−−SNASAQPTQATTTQAAPAQQAAP−−−−−−VAQQTQTYSTTTQTTQTT−−TSYSAPVQQQSYSA−−−−−−−−−−−−−−PARSYSTASVSTGGSTKAQFLA−−AGGTEDMWNTIVMPESGGNPNAVSPNGYMGLGQTKEGWGTGSVSAQ−−−−−−−−TKGMINYANSRYGSLSNATAFRASHGWW
fig|596319.3.peg.60   Staphylococcus warneri L37603     MKKTFIASTLALTLGAAGYAVSGHEAHASETTNVDQAHLVDLAHNHPEQLNAAPVQE−−GAY−−DIHFVSGGFEYNFTSDGTNFSWNYQEAG−−−−−−−−STSAQTSNTAVQSADYTTSYNQEAGTQSVSSNQQSS−−−−−−NTNVEAVSAP−−−TTSNNGSSHNYSTKTTSYSA−−−−−−−−−−−−−−−−−−PSTSSASTGGSTKAQFLA−−NGGTEEAWNAIVMPESGGNPNAVNPAGYRGLGQTMESWGTGSVASQ−−−−−−−−TKGMINYANSRYGSLSNAIAFRQSHGWW
fig|525378.3.peg.2225   Staphylococcus epidermidis M23864:W1     MKKTVISTSLALSLGVAGFALTGHEAHASEATNVDQAHLADLAQNHPDQLNAKPVQA−−GAY−−DIHFVNNGFEYNFTSNGTNWSWSYQAAG−−−−−−−−SQSS−−−−−−−−SADYTQSYNQESSNQSVSSNTQSS−−−−−−NTNVEAVSAP−−−TTSH−−−−HNYSTSTTSYSA−−−−−−−−−−−−−−−−−−PSSSSASTGGSVKAQFLA−−AGGTEAAWNAIVMPESGGNPNAVNPAGYRGLGQTMESWGTGSVASQ−−−−−−−−TKGMINYANSRYGSLSNAIDFRASHGWW
fig|553212.3.peg.56   Staphylococcus capitis SK14     MKKTVIASSLAVSLGIAGYALTGNEAHASETTNVDQAHLADLAQHNPEQLNSKPVQA−−GAY−−DIHFVNNGFQYNFTSNGTNWSWNYAQVG−−−−−−−−STTQ−−−−−−−SSADYTESYSQESSNQSVSSNQQSS−−−−−−NTSVKAVSAP−−−TTST−−−−HNYSTSTTSYSA−−−−−−−−−−−−−−−−−−PSSSASTGGSTKAQFLA−−AGGTEELWNAIVMPESGGNVNASN−−GQYHGLGQTNQSWGYGSVSNQ−−−−−−−−TKGMINYAKERYGSIGNAISFREANGWW
fig|904334.3.peg.1597   Staphylococcus epidermidis VCU116     MKKTVIASSLAVSLGIAGYALTGNEAHASETTNVDQAHLADLAQHNPEQLNSKPVQA−−GAY−−DIHFVNNGFQYNFTSNGTNWSWNYAQVG−−−−−−−−STTQ−−−−−−−SSADYTESYSQESSNQSVSSNQQSS−−−−−−NTSVKAVSAP−−−TTST−−−−HNYSTSTTSYSA−−−−−−−−−−−−−−−−−−PSSSASTGGSTKAQFLA−−AGGTEELWNAIVMPESGGNVNASN−−GQYHGLGQTNQSWGYGSVSNQ−−−−−−−−TKGMINYAKERYGSIGNAISFREANGWW
fig|904334.4.peg.1595   Staphylococcus capitis VCU116     MKKTVIASSLAVSLGIAGYALTGNEAHASETTNVDQAHLADLAQHNPEQLNSKPVQA−−GAY−−DIHFVNNGFQYNFTSNGTNWSWNYAQVG−−−−−−−−STTQ−−−−−−−SSADYTESYSQESSNQSVSSNQQSS−−−−−−NTSVKAVSAP−−−TTST−−−−HNYSTSTTSYSA−−−−−−−−−−−−−−−−−−PSSSASTGGSTKAQFLA−−AGGTEELWNAIVMPESGGNVNASN−−GQYHGLGQTNQSWGYGSVSNQ−−−−−−−−TKGMINYAKERYGSIGNAISFREANGWW
fig|525376.3.peg.1825   Staphylococcus epidermidis W23144     MKKTVIASTLAVSLGIAGYGLSGHEAHASETTNVDKAHLVDLAQHNPEELNAKPVQA−−GAY−−DIHFVDNGYQYNFTSNGSEWSWSYTVAG−−−−−−−−−−−−−−−−−−−−−−−SDADYTESSSNQEVSSNAQSS−−−−−−NTNVQAVSAP−−−TSSE−−−SRSYSTSTTSYSA−−−−PSHNYSSHSSSVRLSNGNTAGSVGSYAAAQMAARTGVSASTWEHIIARESNGQLHARNASGAAGLFQTMPGWGSTGSVNDQ−−−−−−−−−−−−INAAYKAYKAQG            
fig|979211.3.peg.371   Staphylococcus epidermidis NIHLM023     MKKTVIASTLAVSLGIAGYGLSGHEAHASETTNVDKAHLVDLAQHNPEELNAKPVQA−−GAY−−DIHFVDNGYQYNFTSNGSEWSWSYTVAG−−−−−−−−−−−−−−−−−−−−−−−SDADYTESSSNQEVSSNAQSS−−−−−−NTNVQAVSAP−−−TSSE−−−SRSYSTSTTSYSA−−−−PSHNYSSHSSSVRLSNGNTAGSVGSYAAAQMAARTGVSASTWEHIIARESNGQLHARNASGAAGLFQTMPGWGSTGSVNDQ−−−−−−−−−−−−INAAYKAYKAQG            
fig|1155130.3.peg.1622   Staphylococcus epidermidis NIH051475     MKKTVIASTLAVSLGIAGYGLSGHEAHASETTNVDKAHLVDLAQHNPEELNAKPVQA−−GAY−−DIHFVDNGYQYNFTSNGSEWSWSYAVAG−−−−−−−−−−−−−−−−−−−−−−−SDADYTESSSNQEVSANTQSS−−−−−−NTNVQAVSAP−−−TSSE−−−SRSYSTSTTSYSA−−−−PSHNYSSHSSSVRLSNGNTAGSVGSYAAAQMAARTGVSASTWEHIIARESNGQLHARNASGAAGLFQTMPGWGSTGSVNDQ−−−−−−−−−−−−INAAYKAYKAQG            
fig|176279.9.peg.2080   Staphylococcus epidermidis RP62A     MKKTVIASTLAVSLGIAGYGLSGHEAHASETTNVDKAHLVDLAQHNPEELNAKPVQA−−GAY−−DIHFVDNGYQYNFTSNGSEWSWSYAVAG−−−−−−−−−−−−−−−−−−−−−−−SDADYTESSSNQEVSANTQSS−−−−−−NTNVQAVSAP−−−TSSE−−−SRSYSTSTTSYSA−−−−PSHNYSSHSSSVRLSNGNTAGSVGSYAAAQMAARTGVSASTWEHIIARESNGQLHARNASGAAGLFQTMPGWGSTGSVNDQ−−−−−−−−−−−−INAAYKAYKAQG            
fig|904328.3.peg.503   Staphylococcus epidermidis VCU105     MKKTVIASTLAVSLGIAGYGLSGHEAHASETTNVDKAHLVDLAQHNPEELNAKPVQA−−GAY−−DIHFVDNGYQYNFTSNGSEWSWSYAVAG−−−−−−−−−−−−−−−−−−−−−−−SDADYTESSSNQEVSANTQSS−−−−−−NTNVQAVSAP−−−TSSE−−−SRSYSTSTTSYSA−−−−PSHNYSSHSSSVRLSNGNTAGSVGSYAAAQMAARTGVSASTWEHIIARESNGQLHARNASGAAGLFQTMPGWGSTGSVNDQ−−−−−−−−−−−−INAAYKAYKAQG            
fig|1154911.3.peg.320   Streptococcus agalactiae GB00245                                                       QASNEAPKSS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SQSTEANSQQQVTASEEAA−−−−−−VEQAVVTENTP−−−ATSQ−−AQQAYAVTETTYRP−−−−−−−−AQHQTSGQVLSNGNTAGAIGSAAAAQMAAATGVPQSTWEHIIARESNGNPNVANASGASGLFQTMPGWGSTATVQDQ−−−−−−−−−−−−VNSAIKAYRAQG            
fig|211110.1.peg.2066   Streptococcus agalactiae NEM316                                                       QASNEAPKSS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SQSTEANSQQQVTASEEAA−−−−−−VEQAVVTENTP−−−ATSQ−−AQQAYAVTETTYRP−−−−−−−−AQHQTSGQVLSNGNTAGAIGSAAAAQMAAATGVPQSTWEHIIARESNGNPNVANASGASGLFQTMPGWGSTATVQDQ−−−−−−−−−−−−VNSAIKAYRAQG            
fig|1154843.3.peg.1224   Streptococcus agalactiae MRI Z1-206                                                       QASNEAPKSS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SQSTEANSQQQVTASEEAA−−−−−−VEQAVVTENTP−−−ATSQ−−AQQAYAVTETTYRP−−−−−−−−AQHQTSGQVLSNGNTAGAIGSAAAAQMAAATGVPQSTWEHIIARESNGNPNVANASGASGLFQTMPGWGSTATVQNQ−−−−−−−−−−−−VNSAIKAYRA              
fig|1156939.3.peg.44   Streptococcus agalactiae ZQ0910                                                       QASNEAPKSS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SQSTEANSQQQVTASEEAA−−−−−−VEQAVVTENTP−−−ATSQ−−AQQAYAVTETTYRP−−−−−−−−AQHQTSGQVLSNGNTAGAIGSAAAAQMAAATGVPQSTWEHIIARESNGNPNVANASGASGLFQTMPGWGSTATVQNQ−−−−−−−−−−−−VNSAIKAYRA              
fig|1154829.3.peg.1141   Streptococcus agalactiae BSU178                                                       QASNEAPKSS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SQSTEANSQQQVTASEEAA−−−−−−VEQAVVTENTP−−−ATSQ−−AQQAYAVTETTYRP−−−−−−−−AQHQTSGQVLSNGNTAGAIGSAAAAQMAAATGVPQSTWEHIIARESNGNPNVANASGASGLFQTMPGWGSTATVQNQ−−−−−−−−−−−−VNSAIKAYRAQG            
fig|1074160.3.peg.1720   Streptococcus mutans TCI-219                                                                               GFASLFTGESVNTEAHIKKSE−−−−−SVLAHTA−−QAQEVSQDQQTTS−−−−AELTSAPSEAASS−−−−−−EAITEVAATE−−−PTDN−−−−VNYNTAYASQAA−−−−Q−−−VANVNHNGNLANGNTAGATGSEAAAQMAAATGVSQSTWEYIIARESNGQVTAANGSGASGLFQTMPGWGSTATVQDQ−−−−−−−−−−−−VNSAINA                 
fig|857108.3.peg.657   Streptococcus mutans SM1                                                                               GFASLFTGESVNTEAHIKKSE−−−−−SVLAHTA−−QAQEVSQDQQTTS−−−−AELTSAPSEAASS−−−−−−EAITEVAATE−−−PTDN−−−−VNYNTAYASQAA−−−−Q−−−VANVNHNGNLANGNTAGATGSEAAAQMAAATGVSQSTWEYIIARESNGQVTAANGSGASGLFQTMPGWGSTATVQDQ−−−−−−−−−−−−VNSAINA                 
fig|210007.7.peg.1908   Streptococcus mutans UA159                                                                               GFASFFTGESVNTEAHIKKSE−−−−−SVLAHTA−−QAQEVSQDQQTTS−−−−AELTSAPSEAASS−−−−−−EAITEVAATE−−−PTDN−−−−VNYNTAYASQAA−−−−Q−−−VANVNHNGNLANGNTAGATGSEAAAQMAAATGVSQSTWEYIIARESNGQVTAANGSGASGLFQTMPGWGSTATVQDQ−−−−−−−−−−−−VNSAINA                 
fig|1034809.4.peg.418   Staphylococcus lugdunensis N920143     MKKTVLASSLAVTLGVTGYALTSGHEAHAAETTNYDQ−−LANLAQHNPSELNAHPVKA−−GAY−−DFSFVKDGFRYTFTSNGQNFTWKYIYTG−−−−−EADSQPS−−−−−−−−−−−−TQGYTEGSTQAVSSNAQAS−−−−−−NTNVQAVSAP−−−RS−−−−−−−SYQTSTTSYSA−−−−PA−−TSSYSSSVRLSNGNTAGATGSSAAAIMAQRTGVPASTWSAIIARESNGQANARNASGASGLFQTMPGWGSTATVNDQ−−−−−−−−−−−−INAAVRAYKAQG            
fig|698737.3.peg.416   Staphylococcus lugdunensis HKU09-01     MKKTVLASSLAVTLGVTGYALTSGHEAHAAETTNYDQ−−LANLAQHNPSELNAHPVKA−−GAY−−DFSFVKDGFRYTFTSNGQNFTWKYIYTG−−−−−EADSQPS−−−−−−−−−−−−TQGYTEGSTQAVSSNAQAS−−−−−−NTNVQAVSAP−−−RS−−−−−−−SYQTSTTSYSA−−−−PA−−TSSYSSSVRLSNGNTAGATGSSAAAIMAQRTGVPASTWSAIIARESNGQANARNASGASGLFQTMPGWGSTATVNDQ−−−−−−−−−−−−INAAVRAYKAQG            
fig|1118959.3.peg.2439   Staphylococcus aureus subsp. aureus M013     MKKTIMASSLAVALGVTGYAASTGHEAHAAEMNVDQAHLVDLAHNHQDQLNAAPIKD−−GAY−−DIHFVKDGFQYNFTSNGTTWSWSYEAAN−−−−−−−−GQTA−−GFSNVAGADYTTSYNQGSNVQSVSYNAQSS−−−−−−NSNVEAVSAP−−−−−−−−−TYHNYSTSTTSSSV−−−−−−−−−−−−−−−−RLSNGNTAGATGSSAAQIMAQRTGVSASTWAAIIARESNGQVNAYNPSGASGLFQTMPGWGPTNTVDQQ−−−−−−−−−−−−INAAVKAYKAQG            
fig|273036.6.peg.2571   Staphylococcus aureus RF122     MKKTIMASSLAVALGVTGYAASTGHEAHAAEMNVDQAHLVDLAHNHQDQLNAAPIKD−−GAY−−DIHFVKDGFQYNFTSNGTTWSWSYEAAN−−−−−−−−GQTA−−GFSNVAGADYTTSYNQGSNVQSVSYNAQSS−−−−−−NSNVEAVSAP−−−−−−−−−TYHNYSTSTTSSSV−−−−−−−−−−−−−−−−RLSNGNTAGATGSSAAQIMAQRTGVSASTWAAIIARESNGQVNAYNPSGASGLFQTMPGWGPTNTVDQQ−−−−−−−−−−−−INAAVKAYKAQG            
fig|904738.3.peg.1043   Staphylococcus aureus subsp. aureus 21235     MKKTIMASSLAVALGVTGYAASTGHEAHAAEMNVDQAHLVDLAHNHQDQLNAAPIKD−−GAY−−DIHFVKDGFQYNFTSNGTTWSWSYEAAN−−−−−−−−GQTA−−GFSNVAGADYTTSYNQGSNVQSVSYNAQSS−−−−−−NSNVEAVSAP−−−−−−−−−TYHNYSTSTTSSSV−−−−−−−−−−−−−−−−RLSNGNTAGATGSSAAQIMAQRTGVSASTWAAIIARESNGQVNAYNPSGASGLFQTMPGWGPTNTVDQQ−−−−−−−−−−−−INAAVKAYKAQG            
fig|1158477.3.peg.1921   Staphylococcus aureus M1216     MKKTIMASSLAVALGVTGYAASTGHEAHAAEVNVDQAHLVDLAHNHQDQLNAAPIKD−−GAY−−DIHFVKDGFQYNFTSNGTTWSWSYEAAN−−−−−−−−GQTA−−GFSNVAGADYTTSYNQGSNVQSVSYNAQSS−−−−−−NSNVEAVSAP−−−−−−−−−TYHNYSTSTTSSSV−−−−−−−−−−−−−−−−RLSNGNTAGATGSSAAQIMAQRTGVSASTWAAIIARESNGQVNAYNPSGASGLFQTMPGWGPTNTVDQQ−−−−−−−−−−−−INAAVKAYKAQG            
fig|450394.6.peg.1571   Staphylococcus aureus subsp. aureus USA300_TCH959     MKKTIMASSLAVALGVTGYAAGTGHQAHAAEVNVDQAHLVDLAHNHQDQLNAAPIKD−−GAY−−DIHFVKDGFQYNFTSNGTTWSWSYEAAN−−−−−−−−GQTT−−GFSNVAGADYTTSYNQGSNVQSVSYNAQSS−−−−−−NSNVEAVSAP−−−−−−−−−TYHNYSTSTTSSSV−−−−−−−−−−−−−−−−RLSNGNTAGATGSSAAQIMAQRTGVSASTWAAIIARESNGQVNAYNPSGASGLFQTMPGWGPTNTVDQQ−−−−−−−−−−−−INAAVKAYKAQG            
fig|1158485.3.peg.659   Staphylococcus aureus M1311     MKKTIMASSLAVALGVTGYAAGTGHQAHAAEVNVDQAHLVDLAHNHQDQLNAAPIKD−−GAY−−DIHFVKDGFQYNFTSNGTTWSWSYEAAN−−−−−−−−GQTA−−GFSNVAGADYTTSYNQGSNVQSVSYNAQSS−−−−−−NSNVEAVSAP−−−−−−−−−TYHNYSTSTTSSSV−−−−−−−−−−−−−−−−RLSNGNTAGATGSSAAQIMAQRTGVSAATWAAIIARESNGQVNAYNPSGASGLFQTMPGWGPTNTVDQQ−−−−−−−−−−−−INAAVKAYKAQG            
fig|553583.3.peg.2436   Staphylococcus aureus A9635     MKKTIMASSLAVALGVTGYAAGTGHQAHAAEVNVDQAHLVDLAHNHQDQLNAAPIKD−−GAY−−DIHFVKDGFQYNFTSNGTTWSWSYEAAN−−−−−−−−GQTA−−GFSNVAGADYTTSYNQGSNVQSVSYNAQSS−−−−−−NSNVEAVSAP−−−−−−−−−TYHNYSTSTTSSSV−−−−−−−−−−−−−−−−RLSNGNTAGATGSSAAQIMAQRTGVSAATWAAIIARESNGQVNAYNPSGASGLFQTMPGWGPTNTVDQQ−−−−−−−−−−−−INAAVKAYKAQG            
fig|904730.3.peg.75   Staphylococcus aureus subsp. aureus 21200     MKKTIMASSLAVALGVTGYAAGTGHQAHAAEVNVDQAHLVDLAHNHQDQLNAAPIKD−−GAY−−DIHFVKDGFQYNFTSNGTTWSWSYEAAN−−−−−−−−GQTA−−GFSNVAGADYTTSYNQGSNVQSVSYNAQSS−−−−−−NSNVEAVSAP−−−−−−−−−TYHNYSTSTTSSSV−−−−−−−−−−−−−−−−RLSNGNTAGATGSSAAQIMAQRTGVSAATWAAIIARESNGQVNAYNPSGASGLFQTMPGWGPTNTVDQQ−−−−−−−−−−−−INAAVKAYKAQG            
fig|452948.4.peg.439   Staphylococcus aureus 930918-3          MASSLAVALGVTGYAAGTGHQAHAAEVNVDQAHLVDLAHNHQDQLNAAPIKD−−GAY−−DIHFVKDGFQYNFTSNGTTWSWSYEAAN−−−−−−−−GQTA−−GFSNVAGADYTTSYNQGSNVQSVSYNAQSS−−−−−−NSNVEAVSAP−−−−−−−−−TYHNYSTSTTSSSV−−−−−−−−−−−−−−−−RLSNGNTAGATGSSAAQIMAQRTGVSASTWAAIIARESNGQVNAYNPSGASGLFQTMPGWGPTNTVDQQ−−−−−−−−−−−−INAAVKAYKAQG            
fig|548473.6.peg.606   Staphylococcus aureus subsp. aureus TCH60     MKKTIMASSLAVALGVTGYAAGTGHQAHAAEVNVDQAHLVDLAHNHQDQLNAAPIKD−−GAY−−DIHFVKDGFQYNFTSNGTTWSWSYEAAN−−−−−−−−GQTA−−GFSNVAGADYTTSYNQGSNVQSVSYNAQSS−−−−−−NSNVEAVSAP−−−−−−−−−TYHNYSTSTTSSSV−−−−−−−−−−−−−−−−RLSNGNTAGATGSSAAQIMAQRTGVPASTWAAIIARESNGQVNAYNPSGASGLFQTMPGWGPTNTVDQQ−−−−−−−−−−−−INAAVKAYKA              
fig|904728.3.peg.1860   Staphylococcus aureus subsp. aureus 21195     MKKTIMASSLAVALGVTGYAAGTGHQAHAAEVNVDQAHLVDLAHNHQDQLNAAPIKD−−GAY−−DIHFVKDGFQYNFTSNGTTWSWSYEAAN−−−−−−−−GQTA−−GFSNVAGADYTTSYNQGSNVQSVSYNAQSS−−−−−−NSNVEAVSAP−−−−−−−−−TYHNYSTSTTSSSV−−−−−−−−−−−−−−−−RLSNGNTAGATGSSAAQIMAQRTGVPASTWAAIIARESNGQVNAYNPSGASGLFQTMPGWGPTNTVDQQ−−−−−−−−−−−−INAAVKAYKA              
fig|904784.3.peg.1816   Staphylococcus aureus subsp. aureus IS-125     MKKTIMASSLAVALGVTGYAAGTGHQAHAAEVNVDQAHLVDLAHNHQDQLNAAPIKD−−GAY−−DIHFVKDGFQYNFTSNGTTWSWSYEAAN−−−−−−−−GQTA−−GFSNVAGADYTTSYNQGSNVQSVSYNAQSS−−−−−−NSNVEAVSAP−−−−−−−−−TYHNYSTSTTSSSV−−−−−−−−−−−−−−−−RLSNGNTAGATGSSAAQIMAQRTGVPASTWAAIIARESNGQVNAYNPSGASGLFQTMPGWGPTNTVDQQ−−−−−−−−−−−−INAAVKAYKA              
fig|931452.3.peg.397   Staphylococcus aureus subsp. aureus CIG1267     MKKTIMASSLAVALGVTGYAAGTGHQAHAAEVNVDQAHLVDLAHNHQDQLNAAPIKD−−GAY−−DIHFVKDGFQYNFTSNGTTWSWSYEAAN−−−−−−−−GQTA−−GFSNVAGADYTTSYNQGSNVQSVSYNAQSS−−−−−−NSNVEAVSAP−−−−−−−−−TYHNYSTSTTSSSV−−−−−−−−−−−−−−−−RLSNGNTAGATGSSAAQIMAQRTGVPASTWAAIIARESNGQVNAYNPSGASGLFQTMPGWGPTNTVDQQ−−−−−−−−−−−−INAAVKAYKA              
fig|1028799.3.peg.2330   Staphylococcus aureus subsp. aureus VC40     MKKTIMASSLAVALGVTGYAAGTGHQAHAAEVNVDQAHLVDLAHNHQDQLNAAPIKD−−GAY−−DIHFVKDGFQYNFTSNGTTWSWSYEAAN−−−−−−−−GQTA−−GFSNVAGADYTTSYNQGSNVQSVSYNAQSS−−−−−−NSNVEAVSAP−−−−−−−−−TYHNYSTSTTSSSV−−−−−−−−−−−−−−−−RLSNGNTAGATGSSAAQIMAQRTGVSASTWAAIIARESNGQVNAYNPSGASGLFQTMPGWGPTNTVDQQ−−−−−−−−−−−−INAAVKAYKAQG            
fig|455227.3.peg.1183   Staphylococcus aureus D30     MKKTIMASSLAVALGVTGYAAGTGHQAHAAEVNVDQAHLVDLAHNHQDQLNAAPIKD−−GAY−−DIHFVKDGFQYNFTSNGTTWSWSYEAAN−−−−−−−−GQTA−−GFSNVAGADYTTSYNQGSNVQSVSYNAQSS−−−−−−NSNVEAVSAP−−−−−−−−−TYHNYSTSTTSSSV−−−−−−−−−−−−−−−−RLSNGNTAGATGSSAAQIMAQRTGVSASTWAAIIARESNGQVNAYNPSGASGLFQTMPGWGPTNTVDQQ−−−−−−−−−−−−INAAVKAYKAQG            
fig|904747.3.peg.302   Staphylococcus aureus subsp. aureus 21266     MKKTIMASSLAVALGVTGYAAGTGHQAHAAEVNVDQAHLVDLAHNHQDQLNAAPIKD−−GAY−−DIHFVKDGFQYNFTSNGTTWSWSYEAAN−−−−−−−−GQTA−−GFSNVAGADYTTSYNQGSNVQSVSYNAQSS−−−−−−NSNVEAVSAP−−−−−−−−−TYHNYSTSTTSSSV−−−−−−−−−−−−−−−−RLSNGNTAGATGSSAAQIMAQRTGVSASTWAAIIARESNGQVNAYNPSGASGLFQTMPGWGPTNTVDQQ−−−−−−−−−−−−INAAVKAYKAQG            
fig|93062.19.peg.2515   Staphylococcus aureus subsp. aureus COL     MKKTIMASSLAVALGVTGYAAGTGHQAHAAEVNVDQAHLVDLAHNHQDQLNAAPIKD−−GAY−−DIHFVKDGFQYNFTSNGTTWSWSYEAAN−−−−−−−−GQTA−−GFSNVAGADYTTSYNQGSNVQSVSYNAQSS−−−−−−NSNVEAVSAP−−−−−−−−−TYHNYSTSTTSSSV−−−−−−−−−−−−−−−−RLSNGNTAGATGSSAAQIMAQRTGVSASTWAAIIARESNGQVNAYNPSGASGLFQTMPGWGPTNTVDQQ−−−−−−−−−−−−INAAVKAYKAQG            
fig|931460.3.peg.71   Staphylococcus aureus subsp. aureus CIGC93     MKKTIMASSLAVALGVTGYAAGTGHQAHAAEVNVDQAHLVDLAHNHQDQLNAAPIKD−−GAY−−DIHFVKDGFQYNFTSNGTTWSWSYEAAN−−−−−−−−GQTA−−GFSNVAGADYTTSYNQGSNVQSVSYNAQSS−−−−−−NSNVEAVSAP−−−−−−−−−TYHNYSTSTTSSSV−−−−−−−−−−−−−−−−RLSNGNTAGATGSSAAQIMAQRTGVSASTWAAIIARESNGQVNAYNPSGASGLFQTMPGWGPTNTVDQQ−−−−−−−−−−−−INAAVKAYKAQG            
fig|505321.3.peg.1512   Staphylococcus aureus subsp. aureus str. CF-Marseille     MKKTIMASSLAVALGVIGYAAGTGHQAHAAEVNVDQAHLVDLAHNHQDQLNAAPIKD−−GAY−−DIHFVKDGFQYNFTSNGTTWSWSYEAAN−−−−−−−−GQTA−−GFSNVAGADYTTSYNQGSDVQSVSYNAQSS−−−−−−NSNVEAVSAP−−−−−−−−−TYHNYSTSTTSSSV−−−−−−−−−−−−−−−−RLSNGNTAGATGSSAAQIMAQRTGVSASTWAAIIARESNGQVNAYNPSGASGLFQTMPGWGPTNTVDQQ−−−−−−−−−−−−INAAVKAYKAQG            
fig|1158486.3.peg.2077   Staphylococcus aureus M1320     MKKTIMASSLAVALGVTGYAAGTGHQAHAAEVNVDQAHLVDLAHNHQDQLNAAPIKD−−GAY−−DIHFVKDGFQYNFTSNGTTWSWSYEAAN−−−−−−−−GQTA−−GFSNVAGADYTTSYNQGSDVQSVSYNAQSS−−−−−−NSNVEAVSAP−−−−−−−−−TYHNYSTSTTSSSV−−−−−−−−−−−−−−−−RLSNGNTAGATGSSAAQIMAQRTGVSASTWAAIIARESNGQVNAYNPSGASGLFQTMPGWGPTNTVDQQ−−−−−−−−−−−−INAAVKAYKA              
fig|553601.3.peg.718   Staphylococcus aureus A10102     MKKTIMASSLAVALGVTGYAAGTGHQAHAAEVNVDQAHLVDLAH