(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00008780

fig|565665.3.peg.2565   Enterococcus faecium D344SRF                                                                FSDEI−−−−−−AQYAVGAAV−−−KYK−−LLPSVILSQYGYESA−−−−−−FGTS−−−−−ASARN−−−−−−−DLNYFGITWFDGCLFPKGTARGI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GGI−−−−EGGWYM−−−−KFP−−−−NSKAAFSYYGFMVA−−−−−−−−T−−−−−QSNFNA−−−−−−−−−−−−−−−−−CVGNK−−−−−−−−SPGASLLILGR−−−−−−−−−−GG−−Y−−−−−−−−−−−−−−−AAAGITEDSPYYTG−−−−−−−CMSI−−−−−−−−−−ITSNKLT−−−−EYDE                                                   
fig|565665.3.peg.2612   Enterococcus faecium D344SRF                                                                FSDEI−−−−−−AQYAVGAAV−−−KYK−−LLPSVILSQYGYESA−−−−−−FGTS−−−−−ASARN−−−−−−−DLNYFGITWFDGCLFPKGTARGI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GGI−−−−EGGWYM−−−−KFP−−−−NSKAAFSYYGFMVA−−−−−−−−T−−−−−QSNFNA−−−−−−−−−−−−−−−−−CVGNK−−−−−−−−SPGASLLILGR−−−−−−−−−−GG−−Y−−−−−−−−−−−−−−−AAAGITEDSPYYTG−−−−−−−CMSI−−−−−−−−−−ITSNKLT−−−−EYDE                                                   
fig|1138916.3.peg.2854   Enterococcus faecium E1972                                                                FSDEI−−−−−−AQYAVGAAV−−−KYK−−LLPSVILSQYGYESA−−−−−−FGTS−−−−−ASARN−−−−−−−DLNYFGITWFDGCLFPKGTARGI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GGI−−−−EGGWYM−−−−KFP−−−−NSKAAFSYYGFMVA−−−−−−−−T−−−−−QSNFNA−−−−−−−−−−−−−−−−−CVGNK−−−−−−−−SPGASLLILGR−−−−−−−−−−GG−−Y−−−−−−−−−−−−−−−AAAGITEDSPYYTG−−−−−−−CMSI−−−−−−−−−−ITSNKLT−−−−EYDE                                                   
fig|529885.3.peg.2646   Enterococcus faecium E980                                                                FSDEI−−−−−−AQYAVGAAV−−−KYK−−LLPSVILSQYGYESA−−−−−−FGTS−−−−−ASARN−−−−−−−DLNYFGITWFDGCLFPKGTARGI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GGI−−−−EGGWYM−−−−KFP−−−−NSKAAFSYYGFMVA−−−−−−−−T−−−−−QSNFNA−−−−−−−−−−−−−−−−−CVGNK−−−−−−−−SPGASLLILGR−−−−−−−−−−GG−−Y−−−−−−−−−−−−−−−AAAGITEDSPYYTG−−−−−−−CMSI−−−−−−−−−−ITSNKLT−−−−EYDE                                                   
fig|565663.4.peg.2563   Enterococcus faecium Com15                                                                FSDEI−−−−−−AQYAVGAAV−−−KYK−−LLPSVILSQYGYESA−−−−−−FGTS−−−−−ASARN−−−−−−−DLNYFGITWFDGCLFPKGTARGI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GGI−−−−EGGWYM−−−−KFP−−−−NSKAAFSYYGFMVA−−−−−−−−T−−−−−QSNFNA−−−−−−−−−−−−−−−−−CVGNK−−−−−−−−SPGASLLILGR−−−−−−−−−−GG−−Y−−−−−−−−−−−−−−−AAAGITEDSPYYTG−−−−−−−CMSI−−−−−−−−−−ITSNKLT−−−−EYDE                                                   
fig|535205.4.peg.2053   Enterococcus faecium E1071                                                                FSDEI−−−−−−AQYAVGAAV−−−KYK−−LLPSVILSQYGYESA−−−−−−FGTS−−−−−ASARN−−−−−−−DLNYFGITWFDGCLFPKGTARGI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GGI−−−−EGGWYM−−−−KFP−−−−NSKAAFSYYGFMVA−−−−−−−−T−−−−−QSNFNA−−−−−−−−−−−−−−−−−CVGNK−−−−−−−−SPGASLLILGR−−−−−−−−−−GG−−Y−−−−−−−−−−−−−−−AAAGITEDSPYYTG−−−−−−−CMSI−−−−−−−−−−ITSNKLT−−−−EYDE                                                   
fig|1158641.3.peg.1951   Enterococcus faecium EnGen0305                                                                FSDEI−−−−−−AQYAVGAAV−−−KYK−−LLPSVILSQYGYESA−−−−−−FGTS−−−−−ASARN−−−−−−−DLNYFGITWFDGCLFPKGTARGI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GGI−−−−EGGWYM−−−−KFP−−−−NSKAAFSYYGFMVA−−−−−−−−T−−−−−QSNFNA−−−−−−−−−−−−−−−−−CVGNK−−−−−−−−SPGASLLILGR−−−−−−−−−−GG−−Y−−−−−−−−−−−−−−−AAAGITEDSPYYTG−−−−−−−CMSI−−−−−−−−−−ITSNKLT−−−−EYDE                                                   
fig|1134824.3.peg.279   Enterococcus faecium ERV26                                                                FSDEI−−−−−−AQYAVGAAV−−−KYK−−LLPSVILSQYGYESA−−−−−−FGTS−−−−−ASARN−−−−−−−DLNYFGITWFDGCLFPKGTARGI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GGI−−−−EGGWYM−−−−KFP−−−−NSKAAFSYYGFMVA−−−−−−−−T−−−−−QSNFNA−−−−−−−−−−−−−−−−−CVGNK−−−−−−−−SPGASLLILGR−−−−−−−−−−GG−−Y−−−−−−−−−−−−−−−AAAGITEDSPYYTG−−−−−−−CMSI−−−−−−−−−−ITSNKLT−−−−EYDE                                                   
fig|565661.4.peg.2443   Enterococcus faecium 1,231,408                                                                FSDEI−−−−−−AQYAVGAAV−−−KYK−−LLPSVILSQYGYESA−−−−−−FGTS−−−−−ASARN−−−−−−−DLNYFGITWFDGCLFPKGTARGI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GGI−−−−EGGWYM−−−−KFP−−−−NSKAAFSYYGFMVA−−−−−−−−T−−−−−QSNFNA−−−−−−−−−−−−−−−−−CVGNK−−−−−−−−SPGASLLILGR−−−−−−−−−−GG−−Y−−−−−−−−−−−−−−−AAAGITEDSPYYTG−−−−−−−CMSI−−−−−−−−−−ITSNKLT−−−−EYDE                                                   
fig|565662.4.peg.2425   Enterococcus faecium Com12                                                                FSDEI−−−−−−AQYAVGAAV−−−KYK−−LLPSVILSQYGYESA−−−−−−FGTS−−−−−ASARN−−−−−−−DLNYFGITWFDGCLFPKGTARGI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GGI−−−−EGGWYM−−−−KFP−−−−NSKAAFSYYGFMVA−−−−−−−−T−−−−−QSNFNA−−−−−−−−−−−−−−−−−CVGNK−−−−−−−−SPGASLLILGR−−−−−−−−−−GG−−Y−−−−−−−−−−−−−−−AAAGITEDSPYYTG−−−−−−−CMSI−−−−−−−−−−ITSNKLT−−−−EYDE                                                   
fig|544875.4.peg.218   Enterococcus faecium E1636                                                                FSDEI−−−−−−AQYAVGAAV−−−KYK−−LLPSVILSQYGYESA−−−−−−FGTS−−−−−ASARN−−−−−−−DLNYFGITWFDGCLFPKGTARGI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GGI−−−−EGGWYM−−−−KFP−−−−NSKAAFSYYGFMVA−−−−−−−−T−−−−−QSNFNA−−−−−−−−−−−−−−−−−CVGNK−−−−−−−−SPGASLLILGR−−−−−−−−−−GG−−Y−−−−−−−−−−−−−−−AAAGITEDSPYYTG−−−−−−−CMSI−−−−−−−−−−ITSNKLT−−−−EYDE                                                   
fig|565659.3.peg.2642   Enterococcus faecium 1,141,733                                                                FSDEI−−−−−−AQYAVGAAV−−−KYK−−LLPSVILSQYGYESA−−−−−−FGTS−−−−−ASARN−−−−−−−DLNYFGITWFDGCLFPKGTARGI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GGI−−−−EGGWYM−−−−KFP−−−−NSKAAFSYYGFMVA−−−−−−−−T−−−−−QSNFNA−−−−−−−−−−−−−−−−−CVGNK−−−−−−−−SPGASLLILGR−−−−−−−−−−GG−−Y−−−−−−−−−−−−−−−AASGITEDSPYYTG−−−−−−−CMSI−−−−−−−−−−ITSNKLT−−−−EYDE                                                   
fig|1158544.3.peg.2168   Enterococcus faecium UAA952                                                                FSDEI−−−−−−AQYAVGAAV−−−KYK−−LLPSVILSQYGYESA−−−−−−FGTS−−−−−ASARN−−−−−−−DLNYFGITWFDGCLFPKGTARGI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GGI−−−−EGGWYM−−−−NFP−−−−NSKAAFSYYGFMVA−−−−−−−−T−−−−−QSNFNA−−−−−−−−−−−−−−−−−CVGNK−−−−−−−−SPGASLLILGR−−−−−−−−−−GG−−Y−−−−−−−−−−−−−−−AAAGITEDSPYYTG−−−−−−−CMSI−−−−−−−−−−ITSNKLT−−−−EYDEFAMKHWGEG−−GNDNGTITGEWTNPFPGSSLDKSTFS              
fig|565664.3.peg.2743   Enterococcus faecium C68                                                                FSDEI−−−−−−AQYAVGAAV−−−KYK−−LLPSVILSQYGYESA−−−−−−FGTS−−−−−ASARN−−−−−−−DLNYFGITWFDGCLFPKGTARGI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GGI−−−−EGGWYM−−−−NFP−−−−NSKAAFSYYGFMVA−−−−−−−−T−−−−−QSNFNA−−−−−−−−−−−−−−−−−CVGNK−−−−−−−−SPGASLLILGR−−−−−−−−−−GG−−Y−−−−−−−−−−−−−−−AAAGITEDSPYYTG−−−−−−−CMSI−−−−−−−−−−ITSNKLT−−−−EYDEFAMKHWGEG−−GNDNGTITGEWTNPFPGSSLDKSTFS              
fig|1158541.3.peg.1271   Enterococcus faecium UAA947                                                                FSDEI−−−−−−AQYAVGAAV−−−KYK−−LLPSVILSQYGYESA−−−−−−FGTS−−−−−ASARN−−−−−−−DLNYFGITWFDGCLFPKGTARGI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GGI−−−−EGGWYM−−−−KFP−−−−NSKAAFSYYGFMVA−−−−−−−−T−−−−−QSNFNA−−−−−−−−−−−−−−−−−CVGNK−−−−−−−−SPGASLLILGR−−−−−−−−−−GG−−Y−−−−−−−−−−−−−−−AAAGITEDSPYYTG−−−−−−−CMSI−−−−−−−−−−ITSNKLT−−−−EYDEFAMKHWGEG−−GNDNGTITGEWTNPFPGSSLDKSTFS              
fig|702448.3.peg.2134   Enterococcus faecalis PC1.1                                                                FSDEI−−−−−−AQYAVGAAV−−−KYK−−LLPSVILSQYGYESA−−−−−−FGTS−−−−−ASARN−−−−−−−DLNYFGITWFDGCLFPKGTARGI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GGI−−−−EGGWYM−−−−KFP−−−−NSKAAFSYYGFMVA−−−−−−−−T−−−−−QSNFNA−−−−−−−−−−−−−−−−−CVGNK−−−−−−−−SPGASLLILGR−−−−−−−−−−GG−−Y−−−−−−−−−−−−−−−AAAGITEDSPYYTG−−−−−−−CMSI−−−−−−−−−−ITSNKLT−−−−EYDEFAMKHWGEG−−GNDNGTITGEWTNPFPGSSLDKSTFS              
fig|1138933.3.peg.2886   Enterococcus faecium E2560                                                                FSDEI−−−−−−AQYAVGAAV−−−KYK−−LLPSVILSQYGYESA−−−−−−FGTS−−−−−ASARN−−−−−−−DLNYFGITWFDGCLFPKGTARGI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GGI−−−−EGGWYM−−−−KFP−−−−NSKAAFSYYGFMVA−−−−−−−−T−−−−−QSNFNA−−−−−−−−−−−−−−−−−CVGNK−−−−−−−−SPGASLLILGR−−−−−−−−−−GG−−Y−−−−−−−−−−−−−−−AAAGITEDSAYYKN−−−−−−−CMSI−−−−−−−−−−INTNKLM−−−−EYDE                                                   
fig|1138938.4.peg.3067   Enterococcus faecium EnGen0376                                                                FSDEI−−−−−−AQYAVGAAV−−−KYK−−LLPSVILSQYGYESA−−−−−−FGTS−−−−−ASARN−−−−−−−DLNYFGITWFDGCLFPKGTARGI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GGI−−−−EGGWYM−−−−KFP−−−−NSKAAFSYYGFMVA−−−−−−−−T−−−−−QSNFNA−−−−−−−−−−−−−−−−−CVGNK−−−−−−−−SPGASLLILGR−−−−−−−−−−GG−−Y−−−−−−−−−−−−−−−AAAGITEDSAYYKN−−−−−−−CMSI−−−−−−−−−−INTNKLM−−−−EYDE                                                   
fig|547468.4.peg.617   Enterococcus faecium U0317                                                                FSDEI−−−−−−AQYAVGAAV−−−KYK−−LLPSVILSQYGYESA−−−−−−FGTS−−−−−ASARN−−−−−−−DLNYFGITWFDGCLFPKGTARGI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GGI−−−−EGGWYM−−−−KFP−−−−NSKAAFSYYGFMVA−−−−−−−−T−−−−−QSNFNA−−−−−−−−−−−−−−−−−CVGNK−−−−−−−−SPGASLLILGR−−−−−−−−−−GG−−Y−−−−−−−−−−−−−−−AAAGITEDSAYYKN−−−−−−−CMSI−−−−−−−−−−INTNKLM−−−−EYDE                                                   
fig|565657.5.peg.2525   Enterococcus faecium 1,231,502                                                                FSDEI−−−−−−AQYAVGAAV−−−KYK−−LLPSVILSQYGYESA−−−−−−FGTS−−−−−ASARN−−−−−−−DLNYFGITWFDGCLFPKGTARGI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GGI−−−−EGGWYM−−−−KFP−−−−NSKAAFSYYGFMVA−−−−−−−−T−−−−−QSNFNA−−−−−−−−−−−−−−−−−CVGNK−−−−−−−−SPGASLLILGR−−−−−−−−−−GG−−Y−−−−−−−−−−−−−−−AAAGITEDSAYYKN−−−−−−−CMSI−−−−−−−−−−INTNKLM−−−−EYDE                                                   
fig|565658.4.peg.2222   Enterococcus faecium 1,231,501                                                                FSDEI−−−−−−AQYAVGAAV−−−KYK−−LLPSVILSQYGYESA−−−−−−FGTS−−−−−ASARN−−−−−−−DLNYFGITWFDGCLFPKGTARGI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GGI−−−−EGGWYT−−−−KFP−−−−NSKAAFSYYGFMVA−−−−−−−−T−−−−−QSNFNA−−−−−−−−−−−−−−−−−CVGNK−−−−−−−−SPGASLLILGR−−−−−−−−−−GG−−Y−−−−−−−−−−−−−−−AAAGITEDSPYYTG−−−−−−−CMSI−−−−−−−−−−ITSNKLT−−−−EYDE                                                   
fig|645663.4.peg.63   Enterococcus faecium E1039                                                                FSDEI−−−−−−AQYAVGAAV−−−KYK−−LLPSVILSQYGYESA−−−−−−FGTS−−−−−LSAKN−−−−−−−DLNFFGITWFDGCLFPKGTARGI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GGI−−−−EGGWYM−−−−KFP−−−−NSKAAFSYYGFMVA−−−−−−−−T−−−−−QSNFNA−−−−−−−−−−−−−−−−−SVGNK−−−−−−−−SPGASLLILGR−−−−−−−−−−GG−−Y−−−−−−−−−−−−−−−AAAGITEDSPYYTG−−−−−−−CMSI−−−−−−−−−−ITSNKLT−−−−EYDE                                                   
fig|525271.4.peg.2567   Enterococcus faecalis ATCC 29200                                                                  DEI−−−−−−AQLAVGAAV−−−KYR−−LLPSVILSQWAYESE−−−−−−WGRS−−−−−LSAKN−−−−−−−DNNFFGITWFDGCPFPRGTARGI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GGS−−−−EGGNYM−−−−KFP−−−−NKKAAFSYYGFMVA−−−−−−−−S−−−−−QQNFNA−−−−−−−−−−−−−−−−−SVGNK−−−−−−−−SPNEVLLILGR−−−−−−−−−−GG−−Y−−−−−−−−−−−−−−−AAAGINETSPYFTG−−−−−−−AMGI−−−−−−−−−−IQSNNLT−−−−QYDNFAVQRWQTL−−PAVQIGNGKGDISVLQPILGQ                   
fig|749512.3.peg.2489   Enterococcus faecalis TX0860                                                                  DEI−−−−−−AQYAVGVGV−−−KYR−−ILPSLAIGQWAYESA−−−−−−WGKS−−−−−AASQS−−−−−−−DNNYFGITWYVGSPFPRGTPRGI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GGN−−−−EGGNYM−−−−RFP−−−−SKMESFNYYGYMLA−−−−−−−−K−−−−−QPNFNK−−−−−−−−−−−−−−−−−VVGTK−−−−−−−−ELGMDLDIIHA−−−−−−−−−−GG−−Y−−−−−−−−−−−−−−−ATAGTGKGTAYYQA−−−−−−−MMDI−−−−−−−−−−YQKNDLK−−−−GLDDFAISKWGTQLPNNQSIGNGKGDISVLNNVLGTTVNG               
fig|592026.3.peg.316   Catonella morbi ATCC 51271                             SPATGSLPRLTSRYYQALSGAQK−−−−−−−−−−−QFLNKI−−−−−−TPAAVNGWD−−−QYK−−ILPSVTLGQAIIESA−−−−−−WGSS−−−−−−−−−P−−−GAIYKNNYFGVM−−−−−−−−−−−−−DS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NGS−−−−−−−−LR−−−−RYA−−−−SVEEGFKHRFEFLQ−−−−−−−−−−−−−−−−HYRG−−−−−−−−−−−−−−−−−VAGNR−−−−−−−−DYRSTLRNIHA−−−−−−−−−−GG−−Y−−−−−−−−−−−−−−−AEAPD−−−−−−YAQS−−−−−−−LINL−−−−−−−−−−IEQYGLQ−−−−VYDT                                                   
fig|339854.4.peg.1118   Bacillus thuringiensis serovar israelensis ATCC 35646                                                   E−−−−−−−−−−−EYINKN−−−−−−KQAAIDVGR−−−KYG−−IFPSQILAQGGFESN−−−−−−WGRS−−−−−SVAKN−−−−−−−NNNFYGIK−−−GS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GAYR−−−−KYA−−−−SPAECMEDFVTNFY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VTKLK−−−−−−−−SYEDIIKATSP−−−−−−−−−−−−−−YGIGKLLYIDYAPPGDGTNAE−−−−−−YLTS−−−−−−−YESI−−−−−−−−−−VANYDVV−−−−QYDKIAFPDGVKRHPKISEVRAGKRDNFTYEEAGKIDYSGKEVVVTDKD      
fig|388919.8.peg.148   Streptococcus sanguinis SK36                               PSGQTSPNTTEETTSANSSIE−−−−−−−−−−−EFVKQH−−−−−−EKAYLDSWK−−−VGG−−FLPSASIVQTQIETS−−−−−−FDQS−−−VPSFGKA−−−−−−−−HNMGGVK−−−−−−−−−−−−−−−−WNKRSDFTQTISLYGNSS−−−−−−−−−−−−−−−−−VAESGPGTNVGDGT−−−−−GGEYA−−−−FFS−−−−TFDSGIVGKAEFMK−−−−−−−−N−−−−−QTLYKG−−−−−−−−−−−−−−−−−AINNT−−−−−−−−DGISTLSAIAD