(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00008754

fig|176280.10.peg.722   Staphylococcus epidermidis ATCC 12228                                          DDQTALKQAEKAKSEVTQSTTNVSGTQTYQDPTQV−−−QPKQDTQSTTY−−DASLDEMSTYNEISS−−−−−−−−−−−NQKQQSLSTDDANQNQTN−−−−SVTKNQQEE−−−−−−−TNDLTQE−−−−−−DKTSTDT−−−−−−−−−NQLQETQSVAKENEKDLGANAN−−−NEQQDKKMTASQPSENQAIETQTASNDNESQQKSQQVTSEQNETATPKVSNTNASGYN                                             
fig|904323.3.peg.1294   Staphylococcus epidermidis VCU057                                          DDQTALKQAEKAKSEVTQSTTNVSGTQTYQDPTQV−−−QPKQDTQSTTY−−DASLDEMSTYNEISS−−−−−−−−−−−NQKQQSLSTDDANQNQTN−−−−SVTKNQQEE−−−−−−−TNDLTQE−−−−−−DKTSTDT−−−−−−−−−NQLQETQSVAKENEKDLGANAN−−−NEQQDKKMTASQPSENQAIETQTASNDNESQQKSQQVTSEQNETATPKVSNTNASGYN                                             
fig|979219.3.peg.299   Staphylococcus epidermidis NIHLM001                                          DDQTALKQAEKAKSEVTQSTTNVSGTQTYQDPTQV−−−QPKQDTQSTTY−−DASLDEMSTYNEISS−−−−−−−−−−−NQKQQSLSTDDANQNQTN−−−−SVTKNQQEE−−−−−−−TNDLTQE−−−−−−DKTSTDT−−−−−−−−−NQLQETQSVAKENEKDLGANAN−−−NEQQDKKMTASQPSENQAIETQTASNDNESQQKSQQVTSEQNETATPKVSNTNASGYN                                             
fig|1336.3.peg.173   Streptococcus equi     MKPMRNVALVISAML−−LLSSQAFVSA−−−−−VAAQDNQPTIAVQAQAAAEANVSARMRSDQPVIEANIATSQPVSQSTEATILLKDAKGNAINSTAYTMQ−−−−−−−−−−−AGQSRFSVWFDLTNLKVSDYSISVSVPDKEKAFSGSSAPIHFDGK−−−−−−PTKNTPE−−−−−−−−−TEQKNSNPVPANNQPKPAASGRVTSTEQ−−−−−−−−−−PQNVPSATASANHMTRTNHRSDKVLK−−−ASSSNTPSAAKSIDSAEKGKGMLSDSTAQDKEQKGFPWLLSSLIAITAAALLALVIKAVHRK
fig|148942.4.peg.1811   Streptococcus equi subsp. equi                                                                MRSDQPVIEANIATSQPVSQSTEATILLKDAKGNAINSTAYTMQ−−−−−−−−−−−AGQSRFSVWFDLTNLKVSDYSISVSVPDKEKAFSGSSAPIHFDGK−−−−−−PTKNTPE−−−−−−−−−TEQKNSNPVPANNQPKPAASGRVTSTEQ−−−−−−−−−−PQNVPSATASANHMTRTNHRSDKVLK−−−ASSSNTPSAAKSIDSAEKGKGMLSDSTAQDKEQKGFPWLLSSLIAITAAALLALVIKAVHRK
fig|552526.7.peg.1773   Streptococcus equi subsp. zooepidemicus MGCS10565     MKPMRNVALVISAML−−LLSSQAFVSA−−−−−VAAQDNQPTIAVQAQAAAEANVSARMRSEQSVIEANIATSQPVSQSTEATILLKDAKGNTINSTAYTMQ−−−−−−−−−−−AGQSRFSVWFDLTNLKVSDYSISVSVPDKEKAFSGSSAPIHFDGK−−−−−−PTKNTPE−−−−−−−−−TEQKSSNPAPANNQPKPAASSRVTSTEQ−−−−−−−−−−VQSVPSEATSANHMTRSNHRSDKALKASQASSSGTPSAAKSIDSDEKDKGMLSDSAVQDKEQKGFPWLLSSLIALTAAALLALIVKAVHRK
fig|40041.11.peg.239   Streptococcus equi subsp. zooepidemicus     MKPMRNVALVISAMV−−LLSSQSFVSA−−−−−VAAQDNQPTIAVQAQAAAEANVSARMRSDQSVIEANIATSQPVSQSTEATILLKDAKGNTINSTAYTMQ−−−−−−−−−−−AGQSRFSVWFDLTNLKVSDYSISVSVPDKEKAFSGSSAPIHFDGK−−−−−−PTKNTPE−−−−−−−−−TEQKNSNPVPANNQPKPAASGRVTSTEQ−−−−−−−−−−PQNVPSETASANHMTRTNHRSDKVLK−−−ASSSNTPSAAKSIDSAEKDKGMLSDSTAQDKEQKGFPWLLSSLIAITAAALLALVIKAVHRK
fig|486410.3.peg.229   Streptococcus dysgalactiae subsp. equisimilis GGS_124     MTSIKKSLGLISTTLLIASVLSVSSPYA−−−−−VYAEDSQPDKVTAETKTNQVNVDASMRGNEPYIDATIATEQPVSQSAQATVMLQDANGNTITSWVYTMT−−−−−−−−−−−PGQRRFTAWFDLTGLKSNDYRVAVSVQDKEAVASGQSTAVHFDQT−−−−−−KAKKSPTSNDKKTTTPNQNNQSTASTTTDGQQSDLASG−−−TNG−−−−−−−−−−NANQQITRTT−−−QGNTSQKAASAK−−−−−−−−−−VTSGTHEDKNQGTKMLADREEEKTEPKKDF                          
fig|395495.5.peg.1604   Leptothrix cholodnii SP-6          NLVARDAIARLDEYLATTGKAVSNAQAGVYDSAKAVDRVLERSKVLMVGVVKNVAEIQQIVEAEAVATQAEIEASTRTALMLFAASLALVVVLVTPMTLINSRSIVRPIDEARRFAA−−−−−SIAQGDLSVRLAVTGRDEAAELMRALVEMQQSLQTMVGSIRSSAE−−−−−−−−−SISVASTEIASGNQ−−−DLSGR−−−TEQT−−−−−−−−−ASNLQHAASSMEHLTGTVRQTADSARTANQLAVSAAEAAQRGGSVVSQVVTNMEEINASSKK                            
fig|395495.3.peg.1536   Leptothrix cholodni SP-6          NLVARDAIARLDEYLATTGKAVSNAQAGVYDSAKAVDRVLERSKVLMVGVVKNVAEIQQIVEAEAVATQAEIEASTRTALMLFAASLALVVVLVTPMTLINSRSIVRPIDEARRFAA−−−−−SIAQGDLSVRLAVTGRDEAAELMRALVEMQQSLQTMVGSIRSSAE−−−−−−−−−SISVASTEIASGNQ−−−DLSGR−−−TEQT−−−−−−−−−ASNLQHAASSMEHLTGTVRQTADSARTANQLAVSAAEAAQRGGSVVSQVVTNMEEINASSKK                            
fig|160490.1.peg.1493   Streptococcus pyogenes M1 GAS     MTTMQKTISLLSLALLIGLLGTSGKAIS−−−−−VYAQDQHTDNVIAESTISQVSVEASMRGTEPYIDATVTTDQPVRQPTQATITLKDASDNTINSWVYTMA−−−−−−−−−−−AQQRRFTAWFDLTGQKSGDYHVTVTVHTQEKAVTGQSGTVHFDQN−−−−−−KARKTPT−−−−−−−−−NMQQKDTSKAMTNSVDVDTKAQ−−−TNQ−−−−−−−−−−SANQEIDSTSNPFRSATNHRSTSLKRSTKNEKLTPTASNSQKNGSNKTKMLVDKEEVKPTSKRGFPWVLLGLVVSLAAGLFIAIQKVSRRK
fig|370553.4.peg.1724   Streptococcus pyogenes MGAS2096     MTTMQKTVSLLSLALLIGLLGTSGKAIS−−−−−VYAQDQHTDNVIAESTISQVSVEASMRGTEPYIDATVTTDQPVRQPTQATITLKDASDNTINSWVYTMA−−−−−−−−−−−AQQRRFTAWFDLTGQKSGDYHVTVTVHTQEKAVTGQSGTVHFDQN−−−−−−KARKTPT−−−−−−−−−NMQQKDTSKATTNSVDVDTKAQ−−−TNQ−−−−−−−−−−SANQEIDSTSNPFRSATNHRSTSLKRSTKNEKLTPTASNSQKNGSNKTKMLVDKEEVKPTSKRGFPWVLLGLVVSLAAGLFIAIQKVSRRK
fig|471876.6.peg.1654   Streptococcus pyogenes NZ131     MTTMQKTVSLLSLALLIGLLGTSGKAIS−−−−−VYAQDQHTDNVIAESTISQVSVEASMRGTEPYIDATVTTDQPVRQPTQATITLKDASDNTINSWVYTMV−−−−−−−−−−−AQQRRFTAWFDLTGQKSGDYHVTVTVHTQEKAVTGQSGTVHFDQN−−−−−−KARKTPT−−−−−−−−−NMQQKDTSKATTNSVDVDTKAQ−−−TNQ−−−−−−−−−−SANQEIDSTSNPFRSATSHRSTSLKRSTKNEKLTPTASNSQKNGSNKTKMLVDKEEVKPTSKRGFPWVLSGLVVSLAAGLFIAIQKVSRRK
fig|286636.1.peg.1661   Streptococcus pyogenes MGAS10394     MTTMQKTVSLLSLALLIGLLGTSGKAIS−−−−−VYAQDQHTDNVIAESTISQVSVEASMRGTEPYIDATVTTDQPVRQPTQATITLKDASDNTINSWVYTMA−−−−−−−−−−−AQQRRFTAWFDLTGQKSGDYHVTVTVHTQEKAVTGQSGTVHFDQN−−−−−−KARKTPT−−−−−−−−−NMQQKDTSKATTNSVDVDTKAQ−−−ANQ−−−−−−−−−−SANQEIDSTSNPFKSATNHRSTSLKRSTKNEKLTPTASNSQKNGSNKTKMLVDKEEVKPTSKRGFPWVLSGLVVSLAAGLFIAIQKVSRRK
fig|319701.6.peg.1687   Streptococcus pyogenes MGAS6180     MTTMQKTVSLLSLALLIGLLGTSGKAIS−−−−−VYAQDQHTDNVIAESTISQVSVEASIRGTEPYIDATVTTDQPVRQPTQATITLKDASDNTINSWVYTMA−−−−−−−−−−−AQQRRFTAWFDLTGQKSGDYHVTVTVHTQEKAVTGQSGTVHFDQN−−−−−−KARKTPT−−−−−−−−−NMQQKDTSKATTNSVDVDTKAQ−−−TNQ−−−−−−−−−−SANQEIDSTSNPFKSATNHRSTSLKRSTKNEKLTPTASNSQKNGSNKTKMLVDKEEVKPTSKRGFPWVLSGLVVSLAAGLFIAIQKVSRRK
fig|160491.19.peg.1702   Streptococcus pyogenes str. Manfredo     MTTMQKTVSLLSLALLIGLLGTSGKAIS−−−−−VYAQDQHTDNVIAESTISQVSVEASMRGTEPYIDATVTTDQPVRQPTQATITLKDASDNTINSWVYTMA−−−−−−−−−−−AQQRRFTAWFDLTGQKSGDYHVTVTVHTQEKAVTGQSGTVHFDQN−−−−−−KARKTPT−−−−−−−−−NMQQKDTSKAMTNSVDVDTKAQ−−−TNQ−−−−−−−−−−SANQEIDSTSNPFKSATNHRSTSLKRSTKNEKLTPTASNSQKNGSNKTKMLVDKEEVKPTSKRGFPWVLSGLVVSLAAGLFIAIQKVSRRK
fig|193567.1.peg.1671   Streptococcus pyogenes SSI-1     MTTMQKTVSLLSLALLIGLLGTSGKAIS−−−−−VYAQDQHTDNVIAESTISQVSVEASMRGTEPYIDATVTTDQPVRQPTQATITLKDASDNTINSWVYTMA−−−−−−−−−−−VQQRRFTAWFDLTGQKSGDYHVTVTVHTQEKAVTGQSGTVHFDQN−−−−−−KSRKTLT−−−−−−−−−NMQQKDTSKAMTNSVDVDTKAQ−−−TNQ−−−−−−−−−−SANQEIDSTSNPFKSATNHRSTSLKRSTKNEKLTPTASNSQKNGSNKTKMLVDKEEVKPTSKRGFPWVLSGLVVSLAAGLFIAIQKVSRRK
fig|186103.3.peg.1794   Streptococcus pyogenes MGAS8232     MTTMQKTVSLLSLALLIGLLGTSGKAIS−−−−−VYAQDQHTDNVIAESTISQVSVEASMRGTEPYIDATVTTDQPVRQPTQATITLKDASDNTINSWVYTMA−−−−−−−−−−−AQQRRFTAWFDLTGQKSGDYHVTVTVHTQEKAVTGQSGTVHFDQN−−−−−−KARKTLT−−−−−−−−−NMQQKDTFKAMTNSVDVDTKAQ−−−TNQ−−−−−−−−−−SANQEIDSTSNPFKSATNHRSTSLKRSTKNEKLTPTASNSQKNGSNKTKMLVDKEEVKPTSKRGFPWVLSGLVVSLAAGLFIAIQKVSRRK