(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00008614

fig|536229.4.peg.3930   Bacillus pumilus ATCC 7061                                                                   TTDQTVGALLKN−−−−−−−−−−−−−−−−−EKIDIGKHDQ−−−VTPGKNDKIKKDMDLV−−−VE−−−−−−QAF−−−−−QVSVND−−−−−−−−−G−−−GKEKKVWTTSTT−−−−−−−−−−−−−VA−−−−−−−−−DFL−−−−−KQQEL−−KLKKHDKIKPALHS−−HISKKSADIQITR−−−−VEKVTDV−−−−VEEK−−−−−−−−−IAF−−−−−D−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TKHKKDRSLEKGKEKVLK−−KGEEGKLKKHYAIVKE−−−−−−−−−−−−−−−−−NGKVVSKELIKEVTEKDSKDRLVAIGTQESQKEP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KATPA−−−−−−−−−VSRSNE−−SSGKEFYVASTAYTASCAGCTGR−−−−−−−−TSTGYNLKSN−−−PGAKVIAVDPSVIPLGSKVYVE−−−−−−−GYGYAVASDTGSAIKGNK−−−−−I−−DVFVPNKSAAYQ−−−−WGNKRVKIRVLK                                         
fig|315750.8.peg.25   Bacillus pumilus SAFR-032                                                                   TTDQTVGALLKN−−−−−−−−−−−−−−−−−EKIDIGKHDQ−−−VTPGKNDKIKKDMDLV−−−VE−−−−−−QAF−−−−−EVSVND−−−−−−−−−G−−−GKEKKVWTTSTT−−−−−−−−−−−−−VA−−−−−−−−−DFL−−−−−KQQEL−−KLKKHDKIKPALHS−−HITKKSADIQITR−−−−VEKVTDV−−−−VEEK−−−−−−−−−IAF−−−−−D−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TKHKKDRSLEKGKEKVLK−−KGEEGKLKKHYAIVKE−−−−−−−−−−−−−−−−−NGKVVSKELIKEVTEKDSKDRLVAVGTQESQEEP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KATPA−−−−−−−−−VSRSNE−−SSGKEFYVTSTAYTASCAGCTGR−−−−−−−−TSTGYNLKSN−−−PGAKVIAVDPSVIPLGSKVYVE−−−−−−−GYGYAVASDTGSAIKGNK−−−−−I−−DVFVPNKSAAYQ−−−−WGNKRVKIRVLK                                         
fig|1147161.3.peg.41   Bacillus subtilis subsp. subtilis 6051-HGW                                                                     AKTVGALLDE−−−−−−−−−−−−−−−−−QDVDVKEQDQ−−−IDPAIDTDISKDMKIN−−−IE−−−−−−PAF−−−−−QVTVND−−−−−−−−−A−−−GKQKKIWTTSTT−−−−−−−−−−−−−VA−−−−−−−−−DFL−−−−−KQQKM−−NIKDEDKIKPALDA−−KLTKGKADITITR−−−−IEKVTDV−−−−VEEK−−−−−−−−−IAF−−−−−D−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VKKQEDASLEKGKEKVVQ−−KGKEGKLKKHFEVVKE−−−−−−−−−−−−−−−−−NGKEVSRELVKEETAEQSKDKVIAVGTKQSSPKF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ETVSASGDSKT−−VVSRSNE−−STGKVMTVSSTAYTASCSGCSGH−−−−−−−−TATGVNLKNN−−−PNAKVIAVDPNVIPLGSKVHVE−−−−−−−GYGYAIAADTGSAIKGNK−−−−−I−−DVFFPEKSSAYR−−−−WGNKTVKIKIL                                          
fig|1206104.4.peg.3935   Paenibacillus polymyxa ATCC 12321                                                                     AKTVGAFLNE−−−−−−−−−−−−−−−−−QHTPVNQHDK−−−IDPAADTKVTNGMKVT−−−VD−−−−−−PAF−−−−−QVTVND−−−−−−−−−A−−−GKKKKIWTTSTT−−−−−−−−−−−−−VA−−−−−−−−−DFL−−−−−TQHKM−−DMKDEDKVKPALHE−−KLTKNQAGIQITR−−−−IEKVTDV−−−−VEEK−−−−−−−−−IAY−−−−−Q−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VKEKEDASLDSGKEKIVQ−−KGKEGKLKKHFHVVKE−−−−−−−−−−−−−−−−−NGKEVSRKLVKEETSEKSKDQIIAVGTKRHSPKI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EQLSAPVKAS−−−−−SGETG−−SSGKVITVSSTAYTASCSGCSGH−−−−−−−−TATGVNLTSN−−−PNAKVIAVDPSVIPLGTRVHVD−−−−−−−GYGDAVAADTGSAIKGRR−−−−−I−−DVFFPEKSSAYR−−−−WGKKQVKIKIL                                          
fig|326423.3.peg.44   Bacillus amyloliquefaciens FZB42                                                                     AKTVGAFLNE−−−−−−−−−−−−−−−−−QHTPVNQHDK−−−IDPAADTKVTNGMKVT−−−VD−−−−−−PAF−−−−−QVTVND−−−−−−−−−A−−−GKKKKIWTTSTT−−−−−−−−−−−−−VA−−−−−−−−−DFL−−−−−TQHKM−−DMKDEDKVKPALHE−−KLTKNQAGIQITR−−−−IEKVTDV−−−−VEEK−−−−−−−−−IAY−−−−−Q−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VKEKEDASLDSGKEKIVQ−−KGKEGKLKKHFHVVKE−−−−−−−−−−−−−−−−−NGKEVSRKLVKEETSEKSKDQIIAVGTKRHSPKI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EQLSAPVKAS−−−−−SGETG−−SSGKVITVSSTAYTASCSGCSGH−−−−−−−−TATGVNLTSN−−−PNAKVIAVDPSVIPLGTRVHVD−−−−−−−GYGDAVAADTGSAIKGRR−−−−−I−−DVFFPEKSSAYR−−−−WGKKQVKIKIL                                          
fig|702450.3.peg.1990   Turicibacter sp. PC909                                                                                                                    RVYDGMEID−−−ITRAQPVVIND−−−−−−−−−−−−−−−−−−−−−−−GGIKTLVMTTEPT−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDDVLKARSIELSTNDEISVART−−−−SHVEGDMEIEITR−−−−VEKEYES−−−−VYEE−−−−−−−−−I−−−−−−−−NLDTEYVYTDE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LPSNEQEVWN−−EGSPKVVEHVYEKVYK−−−−−−−−−−−−−−−−−NGDHVEQTKVATNVVDEGQPRTIAVGTG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AITSFVANMTAYDVQSAGGGSR−−VACKPYTDVSNTIYYNDSEYGQLRIVAAGKDYPCGTIVDID−−−−−−−GIGKAIVLDRGSAITGND−−−−−L−−DLLVNTNAWD−−−−−−FGRKYKQTKVLR                                         
fig|481743.5.peg.27   Geobacillus sp. Y412MC10                                                                                                                                                  NVTV−−−−−−−−−G−−−SKTKTIFTSQDT−−−−−−−−−−−−−VD−−−−−−−−−HVL−−−−−KEAGV−−TIQGEDIVQPSQDT−−KLTSNMNINVVR−−−−VTKQKVK−−−−ETED−−−−−−−−−REF−−−−−R−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VIKTADPSLEKGDNRVIQ−−RGESGLMVNHYEKVYH−−−−−−−−−−−−−−−−−NGKLVSKTKVSQQIERRTKDKIIAVGTKKVEKPVIVQAAATDVKATPAKLSGTKKVTTAKAVENNVVS−−−−−R−−−−−AGVDF−−KYKKVLNNVSMTAYSAEQQGIGTR−−−−−−−−TASGTRVTEG−−−−−−−RTIAVDPNIIPIGWWVYIE−−−−−−−GIGFRRAEDTGGAIKGNK−−−−−I−−DVYYDSLKSAMN−−−−FGRKSGRTVYVI                                          
fig|543302.3.peg.2488   Alicyclobacillus acidocaldarius LAA1                                                                                                                      VNGEIVT−−−IE−−−−−−SPK−−−−−EVTLDV−−−−−−−−−E−−−GKTETVFTFAKT−−−−−−−−−−−−−VG−−−−−−−−−ELL−−−−−KGEHI−−ELTPHDRMNVKATD−−AIRQGETIEIHS−−−−YVTETTT−−−−ETQD−−−−−−−−−IPF−−−−−Q−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TIRRTTSELLRGHVQYVT−−HGVKGLLQVQTTRVYR−−−−−−−−−−−−−−−−−DGKCIATRVVKRIVREPIDAVVEVGTAEP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KPVQATLATR−−−−−SANPDPGLIREALTVVATAYVA−−−−−GGT−−−−−−−−TATGVPAEP−−−−−−−−GVIAVDPRVIPLGSRVYIP−−−−−−−GIGVCIAADTGSAIVGDR−−−−−I−−DICMASLSQADA−−−−WGARTITIYVL                                          
fig|521098.4.peg.777   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446                                                                                                                                                EVTLDV−−−−−−−−−E−−−GKTETVFTFAKT−−−−−−−−−−−−−VG−−−−−−−−−ELL−−−−−KGEHI−−ELTPHDRMNVKATD−−AIRQGETIEIHS−−−−YVTETTT−−−−ETQD−−−−−−−−−IPF−−−−−Q−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TIRRTTIELLRGHVQYVT−−HGVKGLLQVQTTRVYR−−−−−−−−−−−−−−−−−DGKCIATRVVKRIVREPIDAVVEVGTAEP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KPVQATLATR−−−−−SANPDPGLIREALTVVATAYVA−−−−−GGT−−−−−−−−TATGVPAEP−−−−−−−−GVIAVDPRVIPLGSRVYIP−−−−−−−GIGVCIAADTGSAIVGDR−−−−−I−−DICMASLSQADA−−−−WGARTITIYVL                                          
fig|521098.5.peg.1777   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446                                                                                                                                                EVTLDV−−−−−−−−−E−−−GKTETVFTFAKT−−−−−−−−−−−−−VG−−−−−−−−−ELL−−−−−KGEHI−−ELTPHDRMNVKATD−−AIRQGETIEIHS−−−−YVTETTT−−−−ETQD−−−−−−−−−IPF−−−−−Q−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TIRRTTIELLRGHVQYVT−−HGVKGLLQVQTTRVYR−−−−−−−−−−−−−−−−−DGKCIATRVVKRIVREPIDAVVEVGTAEP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KPVQATLATR−−−−−SANPDPGLIREALTVVATAYVA−−−−−GGT−−−−−−−−TATGVPAEP−−−−−−−−GVIAVDPRVIPLGSRVYIP−−−−−−−GIGVCIAADTGSAIVGDR−−−−−I−−DICMASLSQADA−−−−WGARTITIYVL                                          
fig|386415.6.peg.2190   Clostridium novyi NT                                                                                                                                                  TVGN−−−−−−−−−D−−−VKT−−ILTAANT−−−−−−−−−−−−−VG−−−−−−−−−DML−−−−−SQEKI−−TLGKEDKISVPQQT−−EIKDGDKISITR−−−−VSTKVEK−−−−KLQP−−−−−−−−−IDF−−−−−V−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TEVKKDNSLKNGTRKVVQ−−EGKAGQREINEKVIYE−−−−−−−−−−−−−−−−−NGKIVSREVVNQAIIQQPTKKVIAMGTLQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EQAAQPQRLS−−−−−RGGSI−−NHSKVYRMRATAYTESYNDTGKRPGDSDFGITASGTRVRRN−−−ANGYSTVAVDPRIIPLGTKLYVE−−−−−−−GYGYAIAEDTGGAIKGNK−−−−−I−−DLYFNSDSQVSN−−−−WGVRYVNVYIV                                          
fig|573061.4.peg.1963   Clostridium cellulovorans 743B                                                                                                                    KIKDGQIVD−−−IK−−−−−−KAV−−−−−NITINV−−−−−−−−−D−−−GKQVKIKSAQDD−−−−−−−−−−−−−IDTLLKSEECLDTF−−−−−KNANISSIRSNDRIIPDIKE−−PLEEGSIVNITR−−−−MDTRVET−−−−KSQQ−−−−−−−−−LDY−−−−−Q−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VVTENDPNVYVGERRVVQ−−DGQVGHKDVEELVSLE−−−−−−−−−−−−−−−−−DGVEVSRKVVAEKITLQPVNQVISEGSKPK−−QV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QVVS−−−−−S−−−−−RGETIPYAFSRVLTMRATAYSKQQEGLTDR−−−−−−−−TATGEYVVHD−−−ESGYSTIAVDPRVIPLGTKLYIS−−−−−−−GYGLAIASDTGGAIVDDR−−−−−I−−DVYFDTIAECTS−−−−WGIRSVEVYVLE                                         
fig|588581.3.peg.2249   Clostridium papyrosolvens DSM 2782                                                                                                  IKVDKADY−−−VSMPFDAKLTKVHENV−−−INIK−−−−RAV−−−−−PVTIKV−−−−−−−−−D−−−GKELGVKTYKDT−−−−−−−−−−−−−VS−−−−−−−−−DVL−−−−−KDNNI−−SVNSSDRFVGSQIGD−−KIVSNMNISIVR−−−−VEEKTIT−−−−ETSP−−−−−−−−−IPF−−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TITKDSNRLDKGVRNTVR−−QGKEGVREKLYKVVFE−−−−−−−−−−−−−−−−−DGKQTAKQLVKDIVSKNPLNCIVEVGTVL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NYET−−−−−S−−−−−RGETF−−RFSKVMDMRATSYTASFADTGKRPGEPGFGMTATGARVRK−−−−−−−−GIIAVDPRVIPLGTRVYIEVPGKAADYGYAVAADTGGAIKGNK−−−−−I−−DVYLESDGQVDS−−−−WGVRKVKVYILK                                         
fig|394503.7.peg.177   Clostridium cellulolyticum H10                                                                                                                                                                           TCKDT−−−−−−−−−−−−−VS−−−−−−−−−EVL−−−−−KDNNI−−SVDSDDKFVGSQLGD−−KIVSNMKISIVR−−−−VEEKTIT−−−−ETLP−−−−−−−−−IPF−−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TITKENKRLDKGVRNTVR−−QGKEGVREKLYKVVFE−−−−−−−−−−−−−−−−−DGKQTTKQLIKDFVATNPLNCIVEVGTVL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NYNT−−−−−A−−−−−RGETI−−RFSKVLDMRATSYTASFKDTGKRPGEPGFGITATGAKVRR−−−−−−−−GIIAVDPRVIPLGTRVYVEVPGKAADYGYAVASDTGGAIKGNK−−−−−I−−DVYLESGSQVDA−−−−WGVKKVKVYILK                                         
fig|485916.5.peg.110   Desulfotomaculum acetoxidans DSM 771                                   GVALCAAIGLSVFNWAQKNITLSVDGKKIITKTFASNVQELIEQ−−−−−−−−−−−−−−−−−KKIKLNEKDR−−−LIPQPDTKLTDGLEVA−−−VI−−−−−−RAL−−−−−PVSIDV−−−−−−−−−A−−−GEKLEITSSAQN−−−−−−−−−−−−−VK−−−−−−−−−QLI−−−−−DEQKI−−GLNERDEVIPALNE−−KLSPGMKIQVTR−−−−VEQKTIE−−−−KEVQ−−−−−−−−−LAY−−−−−R−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TETRYTPSLSRGITRISR−−AGKAGTEKQIWQVTYR−−−−−−−−−−−−−−−−−NGEEVSSQMVGSQIVSTPVSKIVDYGTKQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QTID−−−−−R−−−−−SGQTY−−QYSQEMYVIATAYTY−−−−TGRN−−−−−−−−TASGIPPSV−−−−−−−−GSVAVDPRVIPIGTRLYIE−−−−−−−GYGYGRAVDTGGSIKGNK−−−−−V−−DVFLESEQQCRK−−−−WGVRKVKVYVL                                          
fig|485916.4.peg.476   Desulfotomaculum acetoxidans DSM 771                                                                                                                                                 VSIDV−−−−−−−−−A−−−GEKLEITSSAQN−−−−−−−−−−−−−VK−−−−−−−−−QLI−−−−−DEQKI−−GLNERDEVIPALNE−−KLSPGMKIQVTR−−−−VEQKTIE−−−−KEVQ−−−−−−−−−LAY−−−−−R−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TETRYTPSLSRGITRISR−−AGKAGTEKQIWQVTYR−−−−−−−−−−−−−−−−−NGEEVSSQMVGSQIVSTPVSKIVDYGTKQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QTID−−−−−R−−−−−SGQTY−−QYSQEMYVIATAYTY−−−−TGRN−−−−−−−−TASGIPPSV−−−−−−−−GSVAVDPRVIPIGTRLYIE−−−−−−−GYGYGRAVDTGGSIKGNK−−−−−V−−DVFLESEQQCRK−−−−WGVRKVKVYVL                                          
fig|246194.3.peg.2088   Carboxydothermus hydrogenoformans Z-2901                                                              TVVLKTKAATVEELLTE−−−−−−−−−−−−−−−−−TKRTLGLKDT−−−INMPLTAKLKEGTKIV−−−IN−−−−−−RAK−−−−−PVKIKV−−−−−−−−−D−−−GREIEILTVAKT−−−−−−−−−−−−−IA−−−−−−−−−DAI−−−−−KEAGI−−TVNPQDIVEPSPAE−−LVGLNTEVKIIR−−−−VKVEEKT−−−−EEVV−−−−−−−−−LAY−−−−−R−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TIKRPSNSLFKGRTKVLT−−KGKTGLARTYYKITYY−−−−−−−−−−−−−−−−−DGKVVKREVIKQEVVKKPVDEVILVGTK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NTVS−−−−−R−−−−−GGRII−−RFSRVIDVVATAYTH−−−−TGYR−−−−−−−−TATGVYPHR−−−−−−−−GVVAVDPDVIPYGTRLYID−−−−−−−GYGYGTALDTGSAIRGAR−−−−−I−−DLFFDTYGEAIS−−−−WGRRYTRVYVLE                                         
fig|428128.7.peg.798   Eubacterium siraeum DSM 15702                                                                                                                         EGQK−−−IAVT−−−−RAY−−−−−DVKITA−−−−−−−−−D−−−GKTTTVKCLDNT−−−−−−−−−−−−−VS−−−−−−−−−ELL−−−−−KRAKI−−TLGKNDMVSEELES−−KITGPAEIKVSR−−−−VEIKTEK−−−−QDKI−−−−−−−−−IPY−−−−−Q−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TSTVTSNILAIGQSEVRT−−KGVNGKIRTTTTTTYI−−−−−−−−−−−−−−−−−DGVKTDVKKTTKVVTKKVDEVIAEGAAIVTPYCKIDDTSI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VLRNGRPVDYEYVVSGKATAYTAPE−−−GAY−−−−−−−−TASGRMAEI−−−−−−−−GTVAVNPNVIPYGSKLYIVGQYDNICYGYAIAADTGDGMMAGT−−−−−IPVDVYMGSTEEHYDDACAWGLQYVDIYVVE                                         
fig|411483.3.peg.37   Faecalibacterium prausnitzii A2-165                                                                                                                                                                      EYPVKMAFGT−−−−−−−−−−−−−−−−−−−−−−−−−−−VADALERAGI−−TLEADDYTEPALD−−−QLVTVGSEITVHR−−−−VDYQDKV−−−−ETQS−−−−−−−−−IPY−−−−−D−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TQYVYTSLYFRNTGRATTLQHGAEGQQTVTTREKYV−−−−−−−−−−−−−−−−−DGELENSMVVDVTTTVEPTDHVVK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TYGAGAPVSPLTGPDGTTNAPASYSQVLTGKATGYYSRT−−−−−−−−−−−−GKGSSGLGLGY−−−−−−−−GTVAVDPSVIPYGTLLYITSTDGSFVYGYAVATDTGIAVQKGQ−−−−−ILVDLFYETYAESVI−−−−NGAIQVNVYVV                                          
fig|537013.3.peg.727   Clostridium methylpentosum DSM 5476                                                                                                                                                                               T−−−−−−−−−−−−−VQ−−−−−−−−−DVL−−−−−EKAGV−−TIEDDDIINYALDQ−−EISKGAEIEIQR−−−−VSSNTYT−−−−TTEA−−−−−−−−−IPY−−−−−N−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TVQKETDKLDKGVTQVET−−AGQEGERTYYYQQELV−−−−−−−−−−−−−−−−−DGEVVSDQLVSSEVTREPVDEVILVGTYVEPPKPVVSQKPVASGR−−−−−−−−−−−−−−−−−−−TGKSTLDLPASLTLDGNGIPTNYTNVLTGRACAYTAPA−−−GAK−−−−−−−−GSTGQVMRP−−−−−−−−GYVAVNPNVIPYGSKLYIVSADGKYVYGYAIAADTGGSLMAND−−−−−ILADLFMNTSAECYE−−−−FGSRTVNIYIL                                          
fig|309798.4.peg.1187   Coprothermobacter proteolyticus DSM 5265                                                                                                                                                                                                            TTPYSDKNILKVISATGSNF−−−−−−−EVKKQGNVLLVQS−−−−VEVTTNV−−−−NYVY−−−−−−−−−IPPK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VIVQPSNTVARGRSAVLS−−SGAPTIKQQTWQIKKV−−−−−−−−−−−−−−−−−DGKVVERKLIKEQIVQQGRDKVVALGQGTYRG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EAQEILMVATAYSAEEPGIGTR−−−−−−−−TAMGTRVRY−−−−−−−−GVVAVDPKVIPLGTKLYIE−−−−−−−GYGYAVAEDVGGKIKGNR−−−−−I−−DVYFNTVKECYQ−−−−WGRRVVKVYVL                                          
fig|573061.4.peg.1962   Clostridium cellulovorans 743B                                                                                                KQANTKQRQD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ELVLENEKLEDTK−−−−KQNETYL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SEVQAKMDKANGLSKQLQEKEGQKAKEIESSKATLDDI−−−−−−−−−−−−−−−KKKEAEAKLQDFENSESPQGGNTVSEGGAGVLTPGPS−−−−−−−−−−−−−−−−−−−−−−−−−−−PTIEQPNLVESGVTSRGTNDVSYSRKYTMISTAYTAGNPGVGSR−−−−−−−−TASGLPVSRN−−−PGGYSTVAVDPSVIPLGTKLYIS−−−−−−−GYGYAIAADTGSAIKSKK−−−−−I−−DVYFNTLKECYS−−−−WGVRYVEVYVLE                                         
fig|545693.3.peg.927   Bacillus megaterium QM B1551                                                                                        NDILKQHQNDLDQIEKDK−−−KEIDKQEKVLEAAKGS−−−−−−−−−−−−−−−−−−−−−−−LAAKQAELDKNVAKQTATLTTMQEKYS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TVVNEIDAASSEKANLQSELTGIQDKIAKEK−−−−EAAQKQAEQVAKQQA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AEKAEADAEAKRQAELAT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AKKEVKTEPKQEVKTAAAT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EKKASVSSEAKETKKEESTQKHSGKEMYVEATAYTANCAGCSGV−−−−−−−−TATGQNVSSGTH−−−−−KIIAVDPSVIPLGSKVYVE−−−−−−−GYGVATAGDTGGAIKGYR−−−−−I−−DVLVPSESAAKA−−−−FGRRTVKITVL                                          
fig|326423.3.peg.1904   Bacillus amyloliquefaciens FZB42                                                MKKTIMSFVAVAAISTTAFGAHASAKEITVQ−−−−−−KGDTLWGISQKNGVNLKDLKE−−−WNQLSSDLIIEGEKLTISSVETT−−−−−−−−−−−−−−−−−−−−−−TSGQYTVKQGDSLWKIAQKFG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TSVGNLKSLNNLQS−−−−−−−DIIYAGTTLNVKG−−−−QAQAAQPAQEASHPQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TEQKPAAETEQPKQEAVK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NEQPKQEPVQEQQP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KQEAKAVEAKQQPVQSNTNQQEPKKQLTMTATAYSANDGGISGV−−−−−−−−TATGVDLNKNPDA−−−−KVIAVDPSVIPLGSKVYVE−−−−−−−GYGVATAADTGGAIKGNK−−−−−I−−DVFVAKKSDANN−−−−WGVRTVNVKVL                                          
fig|272623.7.peg.2071   Lactococcus lactis subsp. lactis Il1403                                                                   VNAESSQTEVNQ−−−−−−−−−−−−−−−−−ELTNFQTELD−−−SKLAQANKIYSQAQEA−−−QEKV−−−−KQS−−−−−KSKITEYESKIAETENDIVQLKASVAKQMRA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VQSNGGATFSYIDVVASSKNLS−−EMITRLTNLNVVL−−−−TAEADQAKSLIEKEA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SLKTMKVKLEETQESLVKNQNDYQGQVDSLQSSISS−−−−−−−−−−LKDKISSNKQLLSEMQEKAAAEQKARDEALAKSVAEVKAKAETVK−−−−−−−−−−−−−−−−−−−−−−−−−−NTSSNPPTVPDPPKQTTPTTPSGGRTLNVEATAYALN−−−−−−−−−−−−−GITATGIDLSKNP−−−−−−ICIAVDPSVIPLNSLVEVP−−−−−−−GYGIAIAGDTGGAIIGNI−−−−−I−−DVHFPTNDQAIA−−−−WGRKNIQITVL                                          
fig|638301.3.peg.556   Granulicatella adiacens ATCC 49175                                                                                                                                                                                                             DEEVLKNLADQVNELNRLKS−−−−−−−EASQAQSDLETKK−−−−EKLTSES−−−−QSYQSSIEGLKQLI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ADNKATFEKMEKEKKEAKVAFSPTIAALTSDSKQTNQVA−−−−−−−−−−−−−−−−−−−−−−PSTSGQETTAAKPVAAEPSTSTT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QAAPTTTETPTTTSNSSSSSQSSGRTLQVVATGYSYNEPGLGYY−−−−−−−−TATGIDLRSNP−−−−−−TVIAVDPSVIPLGSLIEVP−−−−−−−GYGVAIAGDTGSAIKGNI−−−−−I−−DLHFVSVDQANQ−−−−WGRRTVTIKILK                                         
fig|638301.3.peg.1410   Granulicatella adiacens ATCC 49175                                                    MMVTASIALFGYAGFTANSASANEVE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WTARTVEQVKQD−−−−−−−−−−−−−−−−−−−−−−−−−−−VKKDDKGVQEYTIKWGDTLSVISEATG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ASLDSLVQVNEIQNANLIYPGTVLRFSADQKEVT−−−−VNNGSQE−−−−HSYR−−−−−−−−−V−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QDNKEVKEVEKSEATTSASNETAQA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TQATETTQAAQTTQAASSSQ−−−KGYYLTVEATAYSYNEAGLSSY−−−−−−−−TADGTNLVNEP−−−−−−NVIAVDPSVIPLGSYVEIP−−−−−−−GYGIFRAADTGGAIYGNR−−−−−I−−DVHLVNLNDVYN−−−−FGRRTITIRVLQ                                         
fig|333990.5.peg.2113   Carnobacterium sp. AT7                                                  KFFIASATLALTGVMAFSNPAEASAAEYT−−−−−−−−−−−−−−−−−−−−−−−−TST−−−WEARTVNEIKQD−−−−−−−−−−−−−−−−−−−−−−−−−−−ITNTEDGSTEYTIQWGDTLSSVALATD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LSIDALVDVNDINNANTIYSGNTISLSADHSTVT−−−−IETTEDT−−−−KSYD−−−−−−−−−V−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SKPEEVVEVEPAVEEVPAEEPAVVE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EQPVVTEPTATETPQAETPAAQSGKTVTVEATAYSTNQPELSDT−−−−−−−−TATGINLNENP−−−−−−NVIAVDPSVIPLGSTVYVP−−−−−−−GYGTFIAGDTGSAINGNR−−−−−I−−DVHITDLNQAMN−−−−FGRQTMDVQIL                                          
fig|405532.5.peg.907   Bacillus cereus B4264     VDGTTDGWLKFKTWEGDKWM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NPTAEQITVN−−−−−−−−−−−−−−−−−KTIYAYNEPS−−−FNAQKANYEAPFNPQNWGVVEKK−−−−ENG−−−−−WMKVSTYEGYKWINPD−−−GEERFINKSFYA−−−−−−−−−−−−−Y−−−−−−−−−−−−−−−−−−NEASFNAAKANA−−−−−−−−−−−−−−GALYSPQNFR−−−−VVDGTPS−−−−GWLKVKTWEGEKWLNL−−−−−DGEERFINKSF−−−−−−−−−−−−−−−−−−−−−−−−−−−YAY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NEPSFSSGKANAGALYSPQNFRVVDGTTSGWLKIKTWEG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKWMNLNAEDTGVEFYVEATAYSVEGSPPNER−−−−−−−ITASGIDIGKN−−−PNIKLIAVDPKVIKLGTKVWVE−−−−−−−GYGDAIAGDTGGAIKGNK−−−−−I−−DVLFPTEKQARE−−−−WGRKKVRIKIMK                                         
fig|526969.3.peg.635   Bacillus cereus m1550     VDGTTDGWLKFKTWEGDKWM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NPTAEQITVN−−−−−−−−−−−−−−−−−KTIYAYNEPS−−−FNAQKANYEAPFNPQNWGVVEKK−−−−ENG−−−−−WMKVSTYEGYKWINPD−−−GEERFINKLFYA−−−−−−−−−−−−−Y−−−−−−−−−−−−−−−−−−NEASFNAAKANA−−−−−−−−−−−−−−GALYSPQNFR−−−−VVDGTPS−−−−GWLKVKTWEGEKWLNL−−−−−DGEERFINKSF−−−−−−−−−−−−−−−−−−−−−−−−−−−YAY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NEPSFSSGKANAGALYSPQNFRVVDGTTSGWLKIKTWEG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKWMNLNAEDTGVEFYVEATAYSVEGSPPNER−−−−−−−ITASGIDIGKN−−−PNIKLIAVDPKVIKLGTKVWVE−−−−−−−GYGDAIAGDTGGAIKGNK−−−−−I−−DVLFPTEKQARE−−−−WGRKKVRIKIMK                                         
fig|1053238.3.peg.2992   Bacillus cereus VD154     VDGTTDGWLKFKTWEGDKWM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NPTAEQITVN−−−−−−−−−−−−−−−−−KTIYAYNEPS−−−FNAKKANYEAPFNPQNWGVVEKK−−−−ENG−−−−−WMKVSTYEGYKWINPD−−−GEERFINKSFYA−−−−−−−−−−−−−Y−−−−−−−−−−−−−−−−−−NEASFNAAKANA−−−−−−−−−−−−−−GALYSPQNFR−−−−VVDGTPS−−−−GWLKVKTWEGEKWLNL−−−−−DGEERFINKAF−−−−−−−−−−−−−−−−−−−−−−−−−−−YAY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NEPSFSSGKANAGALYSPQNFRVVDGTTSGWLKIKTWEG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKWMNLNAEDTGVEFYVEATAYSVEGSPPNER−−−−−−−ITASGIDIGKN−−−PNIKLIAVDPKVIKLGTKVWVE−−−−−−−GYGDAIAGDTGGAIKGNK−−−−−I−−DVLFPTEKQARE−−−−WGRKKVRIKIMK                                         
fig|527027.3.peg.3913   Bacillus thuringiensis serovar pakistani str. T13001     VDGTTDGWLKFKTWEGDKWM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NPTAEQITVN−−−−−−−−−−−−−−−−−KTIYAYNEPS−−−FNAKKANYEAPFNPQNWGVVEKK−−−−ENG−−−−−WMKVSTYEGYKWINPD−−−GEERFINKSFYA−−−−−−−−−−−−−Y−−−−−−−−−−−−−−−−−−NEASFNAAKANA−−−−−−−−−−−−−−GALYSPQNFR−−−−VVDGTPS−−−−GWLKVKTWEGEKWLNL−−−−−DGEERFINKAF−−−−−−−−−−−−−−−−−−−−−−−−−−−YAY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NEPSFSSGKANAGALYSPQNFRVVDGTTSGWLKIKTWEG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKWMNLNAEDTGVEFYVEATAYSVEGSPPNER−−−−−−−ITASGIDIGKN−−−PNIKLIAVDPKVIKLGTKVWVE−−−−−−−GYGDAIAGDTGGAIKGNK−−−−−I−−DVLFPTEKQARE−−−−WGRKKVRIKIMK                                         
fig|525282.5.peg.1592   Finegoldia magna ATCC 53516                                                                  SSENIQSKKYWIN−−−−−−−−−−−−−−−−−DDTDLFKKEN−−−EHSKIIEGLEQGDNVK−−−VEKI−−−−GEV−−−−−FAKVNF−−−−−−−−−TKDGKKFEGFIYKS−−−−−−−−−−−−−YLSEKEVKPDPNKFEGWVNEETKVFDSKEKEA−−−−−−−−−−KELGVIDKDS−−E−−−−IKGHIDE−−−−DNLR−−−−−−−−−ITY−−−−−FGRTAYIVAKN−−−−−−−−−−−−−−−−−−−−−−−−−−−TTKES−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PADRDKRLAKERKIQAQKLAEK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RKKEQEERAKEEKQQAQSAPQNVSGRTITMRSTAYTSDPAENGGY−−−−−−STTAMGTAIRY−−−−−−−−GVAAVDPRVIPLGTRLYIE−−−−−−−GYGYARAEDTGGAIKGNR−−−−−I−−DLVFGSRSQSNN−−−−WGRRTVRVTIL                                          
fig|334413.6.peg.1437   Finegoldia magna ATCC 29328                                                                  SSENIQSKKYWIN−−−−−−−−−−−−−−−−−DDTDLFKSEN−−−EHSKIIEVLDQGDTVK−−−VEKI−−−−GEI−−−−−FAKVSV−−−−−−−−−TVDSKNFVGFIYKS−−−−−−−−−−−−−YLSEKEVKPDPNKFEGWVNVETKVFDSKEKEA−−−−−−−−−−KELGLIDKDS−−E−−−−IKGHIDE−−−−DNLR−−−−−−−−−ITY−−−−−FGRTAYIKAKN−−−−−−−−−−−−−−−−−−−−−−−−−−−TTKES−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PKDRDARLAKERKIQAQKLAEK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RKKEQEEKEK−−−−−QAQSAPKNVSGRTITMRSTAYTSDPSENGGY−−−−−−STTAMGTAIRY−−−−−−−−GVAAVDPNVIPLGTRLYIE−−−−−−−GYGYARAEDTGGAIKGNK−−−−−I−−DLVFGSKAQSNR−−−−WGRRTVRVTIL                                          
fig|393125.10.peg.431   Listeria monocytogenes FSL R2-503                                                                  FITVVSILLIAAGIFTTIAMANANSVVVKAEVLNVRSGPG−−−LAYDVTSQARKNEVLR−−−VVGE−−−−ENQ−−−−−WYKVQL−−−−−−−−−−DNGNSGWVASWLVE−−−−−−−−−−−−−−−−−−−NTDVSAASNSVAIVSSDGGLNVREKPSTSS−−−−−−−KALGLLNNGDQVT−−−−VTSQQN−−−−GWAQ−−−−−−−−−IQY−−−−−NGTSAWVSSDY−−−−−−−−−−−−−−−−−−−−−−−−−−−LTIRESVTKVDESELQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TVTIRDDSTNIRNKP−−−−−−−−−−−−−−−−−−−−−−−−−−SRDGAVIEKANSGQG−−FAIQGVQGDWYKIRTTSGEEGYVANWV−−−−−VDVSDKGQTSSPRSKTTKLSEATIVIDPGHGGNDPGAKGSNGTIEKEM                         
fig|393117.3.peg.1442   Listeria monocytogenes FSL J1-194                                                                  FITVVSILLIAAGIFTTIAMANANSVVVKAEVLNVRSGPG−−−LAYDVTSQARKNEVLR−−−VVGE−−−−ENQ−−−−−WYKVQL−−−−−−−−−−DNGNSGWVASWLVE−−−−−−−−−−−−−−−−−−−NTDVSAASNSVAIVSSDGGLNVREKPSTSS−−−−−−−KALGLLNNGDQVT−−−−VTSQQN−−−−GWAQ−−−−−−−−−IQY−−−−−NGTSAWVSSDY−−−−−−−−−−−−−−−−−−−−−−−−−−−LTIRESVTKVDESELQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TVTIRDDSTNIRNKP−−−−−−−−−−−−−−−−−−−−−−−−−−SRDGAVIEKANSGQG−−FAIQGVQGDWYKIRTTSGEEGYVANWV−−−−−VDVSDKGQTSSPRSKTTKLSEATIVIDPGHGGNDPGAKGSNGTIEKEM                         
fig|393125.3.peg.1912   Listeria monocytogenes FSL R2-503                                                                  FITVVSILLIAAGIFTTIAMANANSVVVKAEVLNVRSGPG−−−LAYDVTSQARKNEVLR−−−VVGE−−−−ENQ−−−−−WYKVQL−−−−−−−−−−DNGNSGWVASWLVE−−−−−−−−−−−−−−−−−−−NTDVSAASNSVAIVSSDGGLNVREKPSTSS−−−−−−−KALGLLNNGDQVT−−−−VTSQQN−−−−GWAQ−−−−−−−−−IQY−−−−−NGTSAWVSSDY−−−−−−−−−−−−−−−−−−−−−−−−−−−LTIRESVTKVDESELQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TVTIRDDSTNIRNKP−−−−−−−−−−−−−−−−−−−−−−−−−−SRDGAVIEKANSGQG−−FAIQGVQGDWYKIRTTSGEEGYVANWV−−−−−VDVSDKGQTSSPRSKTTKLSEATIVIDPGHGGNDPGAKGSNGTIEKEM                         
fig|401650.3.peg.1189   Listeria monocytogenes Aureli 1997                                                                  FITVVSILLIAAGIFTTIAMANANSVVVKAEVLNVRSGPG−−−LAYDVTSQARKNEVLR−−−VVGE−−−−ENQ−−−−−WYKVQL−−−−−−−−−−DNGNSGWVASWLVE−−−−−−−−−−−−−−−−−−−NTDVSAASNSVAIVSSDGGLNVREKPSTSS−−−−−−−KALGLLNNGDQVT−−−−VTSQQN−−−−GWAQ−−−−−−−−−IQY−−−−−NGTSAWVSSDY−−−−−−−−−−−−−−−−−−−−−−−−−−−LTIRESVTKVDESELQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TVTIRDDSTNIRNKP−−−−−−−−−−−−−−−−−−−−−−−−−−SRDGAVIEKANSGQG−−FAIQGVQGDWYKIRTTSGEEGYVANWV−−−−−VDVSDKGQTSSPRSKTTKLSEATIVIDPGHGGNDPGAKGSNGTIEKEM                         
fig|393128.3.peg.1333   Listeria monocytogenes F6900                                                                  FITVVSILLIAAGIFTTIAMANANSVVVKAEVLNVRSGPG−−−LAYDVTSQARKNEVLR−−−VVGE−−−−ENQ−−−−−WYKVQL−−−−−−−−−−DNGNSGWVASWLVE−−−−−−−−−−−−−−−−−−−NTDVSAASNSVAIVSSDGGLNVREKPSTSS−−−−−−−KSLGLLNNGDQVT−−−−VTSQQN−−−−GWAQ−−−−−−−−−IQY−−−−−NGTSAWVSSDY−−−−−−−−−−−−−−−−−−−−−−−−−−−LTIRESVTKVDESELQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TVTIRDDSTNIRNKP−−−−−−−−−−−−−−−−−−−−−−−−−−SRDGAVIEKANSGQG−−FAIQGVQGDWYKIRTTSGEEGYVANWV−−−−−VDVSDKGQTSSPRSKTTKLSEATIVIDPGHGGNDPGAKGANGTIEKEM                         
fig|393127.4.peg.1816   Listeria monocytogenes Finland 1988                                                                  FITVVSILLIAAGIFTTIAMANANSVVVKAEVLNVRSGPG−−−LAYDVTSQARKNEVLR−−−VVGE−−−−ENQ−−−−−WYKVQL−−−−−−−−−−DNGNSGWVASWLVE−−−−−−−−−−−−−−−−−−−NTDVSAASNSVAIVSSDGGLNVREKPSTSS−−−−−−−KSLGLLNNGDQVT−−−−VTSQQN−−−−GWAQ−−−−−−−−−IQY−−−−−NGTSAWVSSDY−−−−−−−−−−−−−−−−−−−−−−−−−−−LTIRESVTKVDESELQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TVTIRDDSTNIRNKP−−−−−−−−−−−−−−−−−−−−−−−−−−SRDGAVIEKANSGQG−−FAIQGVQGDWYKIRTTSGEEGYVANWV−−−−−VDVSDKGQTSSPRSKTTKLSEATIVIDPGHGGNDPGAKGANGTIEKEM                         
fig|169963.1.peg.1513   Listeria monocytogenes EGD-e                                                                  FITVVSILLIAAGIFTTIAMANANSVVVKAEVLNVRSGPG−−−LAYDVTSQARKNEVLR−−−VVGE−−−−ENQ−−−−−WYKVQL−−−−−−−−−−DNGNSGWVASWLVE−−−−−−−−−−−−−−−−−−−NTDVSAASNSVAIVSSDGGLNVREKPSTSS−−−−−−−KSLGLLNNGDQVT−−−−VTSQQN−−−−GWAQ−−−−−−−−−IQY−−−−−NGTSAWVSSDY−−−−−−−−−−−−−−−−−−−−−−−−−−−LTIRESVTKVDESELQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TVTIRDDSTNIRNKP−−−−−−−−−−−−−−−−−−−−−−−−−−SRDGAVIEKANSGQG−−FAIQGVQGDWYKIRTTSGEEGYVANWV−−−−−VDVSDKGQTSSPRSKTTKLSEATIVIDPGHGGNDPGAKGANGTIEKEM                         
fig|552536.5.peg.1033   Listeria monocytogenes HCC23                                                                  FITVVSILLIAAGIFTTIAMANANSVVVKAEVLNVRSGPG−−−LAYDVTSQARKNEVLR−−−VVGE−−−−ENQ−−−−−WYKVQL−−−−−−−−−−DNGNSGWVASWLVE−−−−−−−−−−−−−−−−−−−NTDVSAASNSVAIVSSDGGLNVREKPSTSS−−−−−−−KSLGLLNNGDQVT−−−−VTSQQN−−−−GWAQ−−−−−−−−−IQY−−−−−NGTSAWVSSDY−−−−−−−−−−−−−−−−−−−−−−−−−−−LTIRESVTKVDESELQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TVTIRDDSTNIRNKP−−−−−−−−−−−−−−−−−−−−−−−−−−SRDGAVIEKANSGQG−−FAIQGVQGDWYKIRTTSGEEGYVANWV−−−−−VDVSDKGQTSSPRSKTTKLSEATIVIDPGHGGNDPGAKGANGTIEKEM                         
fig|393133.3.peg.1999   Listeria monocytogenes 10403S                                                                  FITVVSILLIAAGIFTTIAMANANSVVVKAEVLNVRSGPG−−−LAYDVTSQARKNEVLR−−−VVGE−−−−ENQ−−−−−WYKVQL−−−−−−−−−−DNGNSGWVASWLVE−−−−−−−−−−−−−−−−−−−NTDVSAASNSVAIVSSDGGLNVREKPSTSS−−−−−−−KSLGLLNNGDQLT−−−−VTSQQN−−−−GWAQ−−−−−−−−−IQY−−−−−NGTSAWVSSDY−−−−−−−−−−−−−−−−−−−−−−−−−−−LTIRESVTKVDESELQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TVTIRDDSTNIRNKP−−−−−−−−−−−−−−−−−−−−−−−−−−SRDGAVIEKANSGQG−−FAIQGVQGDWYKIRTTSGEEGYVANWV−−−−−VDVSDKGQTSSPRSKTTKLSEATIVIDPGHGGNDPGAKGANGTIEKEM                         
fig|683837.3.peg.1432   Listeria seeligeri serovar 1/2b str. SLCC3954                                                                  FITVVSILLIAAGIVTTIAMANANSVVVKAEVLNVRSGPG−−−LAYDVTSQARKNEVLR−−−VVGE−−−−ENQ−−−−−WYKVQL−−−−−−−−−−DNGNSGWVASWLVE−−−−−−−−−−−−−−−−−−−NTDVSAASNSVAIVNSDGGLNVREKPSTSS−−−−−−−KSLGLLNNGDQVT−−−−VTSQQD−−−−GWAQ−−−−−−−−−IQY−−−−−QGKNAWVSSDY−−−−−−−−−−−−−−−−−−−−−−−−−−−LTIRESATKVDESELQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TVTIREDSTNIRNEA−−−−−−−−−−−−−−−−−−−−−−−−−−SRDGEVIEKANSGQS−−FAIQGVQGDWYQIRTTSGDTGYVANWV−−−−−VDVSDKGQTATPKSKTTKLSEATIVIDPGHGGNDPG                                     
fig|386043.6.peg.1488   Listeria welshimeri serovar 6b str. SLCC5334                                                                  FITVVSILLIAAGIVTTIAMANANSVIVKAEVLNVRSGPG−−−LAYDVTSQARKNEVLR−−−VVGE−−−−ENE−−−−−WYKVQL−−−−−−−−−−DNGNTGWVASWLVE−−−−−−−−−−−−−−−−−−−NTDVSAASNSVAIVSSDGGLNVREKPSTSS−−−−−−−ASLGLLNNGDQVT−−−−VTSQQN−−−−GWAQ−−−−−−−−−IQY−−−−−KGKSAWVSSDF−−−−−−−−−−−−−−−−−−−−−−−−−−−LNIRESVTKVDESELQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TVTIREDSTNIRNKP−−−−−−−−−−−−−−−−−−−−−−−−−−SRDGDVIEKANSGQG−−FAIQGVQGDWYKIRTTSGQEGYVANWV−−−−−VDVSDKGQTSSPRSKTTKLSEATIVIDPGHGGNDPGAKGANGTIEKEM                         
fig|272626.1.peg.1545   Listeria innocua Clip11262                                                                  FITVVSILLIAAGIFTTIAMANANSVVVKAEVLNVRSGPG−−−LAYDVTSQARKNEVLR−−−VVGE−−−−ENQ−−−−−WYKVQL−−−−−−−−−−DNGNSGWVASWLVE−−−−−−−−−−−−−−−−−−−NTDVSAASNSIAIVSSDGGLNVREKPSTSS−−−−−−−TSLGLLNNGDQVT−−−−VTSQQN−−−−GWAQ−−−−−−−−−IQY−−−−−NGKSAWVSSQY−−−−−−−−−−−−−−−−−−−−−−−−−−−LTIRESVTKVDESELQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TVTIRDDSTNIRNKP−−−−−−−−−−−−−−−−−−−−−−−−−−GRDGAVIEKANSGQG−−FAIQGVQGDWYKIRTTSGEEGYVANWV−−−−−VDVSDKGQTSSPRSKTTKLSEATIVIDPGHGGNDPGAKGANGTIEKEM                         
fig|314315.12.peg.834   Lactobacillus sakei subsp. sakei 23K                                                                          LVGVGLFATHVLATYQQITIKANVVNVRQGPG−−−LSYDTMGQASKGEVMN−−−VISQ−−−−KNN−−−−−WYQVRL−−−−−−−−−−SGDKIGWVASWLVN−−−−−−−−−−−−−−−−−−−NTEVSATSNRVATVTNDFANVRQSSNASS−−−−−−−PLLGKVNKGDKLT−−−−VLYQQN−−−−GWSQ−−−−−−−−−VKY−−−−−NSAVGWVQSDL−−−−−−−−−−−−−−−−−−−−−−−−−−−ISISNEAPTAVQTDTKTDDSSSQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−STSDIKSVTTQLDNTKLRSGP−−−−−−−−−−−−−−−−−−−−−−−−−−GVNYAYSQVYSANTK−−LTYLDKSDTWYKVKDSDGNTGYVASWV−−−−−VTPSA                                                                    
fig|1203259.4.peg.227   Lactobacillus rhamnosus LRHMDP3                                                                KWPLVILLALLFGVGAATTSVMANTQYMTVKAESVNVRLGPG−−−LAYGIMGQVKSGNELT−−−IIGS−−−−KNS−−−−−WYQVRL−−−−−−−−−−AGNKIGWVASWLVD−−−−−−−−−−−−−−−−−−−QSEAATTSAKVATVNQP−−VNVREYASQDA−−−−−−−KQLGTLNAGDSVK−−−−VVYQEG−−−−DWTQ−−−−−−−−−IAY−−−−−NNTAAWITSSS−−−−−−−−−−−−−−−−−−−−−−−−−−−VQLTGQTTNLAQPAQANLTQAK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SGAALKVTTNTM−−TNLRNAA−−−−−−−−−−−−−−−−−−−−−−−−−−GINAPSVEKLDKGTE−−LTVTKQQDDWYQVTAPDGKSGYVASWT−−−−−VT                                                                       
fig|568703.9.peg.1475   Lactobacillus rhamnosus GG                                                                     ILLALLFGVGAATTSVMANTQYMTVKAESVNVRLGPG−−−LAYGIMGQVKSGNELT−−−IIGS−−−−KNS−−−−−WYQVRL−−−−−−−−−−AGNKIGWVASWLVD−−−−−−−−−−−−−−−−−−−QSEAATTSAKVATVNQP−−VNVREYASQDA−−−−−−−KQLGTLNAGDSVK−−−−VVYQEG−−−−DWTQ−−−−−−−−−IAY−−−−−NNTAAWITSSS−−−−−−−−−−−−−−−−−−−−−−−−−−−VQLTGQTTNLAQPAQANLTQAK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SGAALKVTTNTI−−TNLRNAA−−−−−−−−−−−−−−−−−−−−−−−−−−GINAPSVEKLDKGTE−−LTVTKQQDDWYQVTAPDGKSGYVASWT−−−−−VT                                                                       
fig|1256204.3.peg.310   Lactobacillus paracasei subsp. paracasei Lpp14                                                                        ALLFGVGVATTSVMANTQYMTVKADTVNVRLGPG−−−LAYSIMGQVKSGNELS−−−IIGA−−−−KNS−−−−−WYQVRL−−−−−−−−−−AGNKIGWVASWLVD−−−−−−−−−−−−−−−−−−−QSEAATSQAKVATVNQP−−VNVREYASQNA−−−−−−−KQLGSLNAGDSVK−−−−VVYQEG−−−−AWTQ−−−−−−−−−IAY−−−−−NTTAAWITSSS−−−−−−−−−−−−−−−−−−−−−−−−−−−VQLTGQTTNLAQPAQTALANEK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SAPALKVTTNTM−−TNLRNAA−−−−−−−−−−−−−−−−−−−−−−−−−−GINAPSVEKLDKGTE−−LTVSKQQDDWYAVTAPDGKTGYVASWT−−−−−VSAPNDGQTQKAAT                                                           
fig|999378.3.peg.1674   Lactobacillus casei LC2W                                                                        ALLFGVGVATTSVMANTQYMTVKADTVNVRLGPG−−−LAYSIMGQVKSGNELS−−−IIGA−−−−KNS−−−−−WYQVRL−−−−−−−−−−AGNKIGWVASWLVD−−−−−−−−−−−−−−−−−−−QSEAATSQAKVATVNQP−−VNVREYASQNA−−−−−−−KQLGSLNAGDSVK−−−−VVYQEG−−−−AWTQ−−−−−−−−−IAY−−−−−NTTAAWITSSS−−−−−−−−−−−−−−−−−−−−−−−−−−−VQLTGQTTNLAQPAQTALATEK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SAPALKVTTNTM−−TNLRNAA−−−−−−−−−−−−−−−−−−−−−−−−−−GINAPSVEKLDKGTE−−LTVSKQQDDWYAVTAPDGKTGYVASWT−−−−−VSAPNDGQTQKAAT                                                           
fig|1051651.3.peg.1525   Lactobacillus casei 21/1                                                                        ALLFGVGVATTSVMANTQYMTVKADTVNVRLGPG−−−LAYSIMGQVKSGNELS−−−IIGA−−−−KNS−−−−−WYQVRL−−−−−−−−−−AGNKIGWVASWLVD−−−−−−−−−−−−−−−−−−−QSEAATSQAKVATVNQP−−VNVREYASQNA−−−−−−−KQLGSLNAGDSVK−−−−VVYQEG−−−−AWTQ−−−−−−−−−IAY−−−−−NTTAAWITSSS−−−−−−−−−−−−−−−−−−−−−−−−−−−VQLTGQTTNLAQPAQTALAIEK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SAPALKVTTNTM−−TNLRNAA−−−−−−−−−−−−−−−−−−−−−−−−−−GINAPSVEKLDKGTE−−LTVSKQQDDWYAVTAPDGKTGYVASWT−−−−−VSAPNDGQTQKAAT                                                           
fig|491915.6.peg.745   Anoxybacillus flavithermus WK1                                                                MKKSLIASLFIFCCLLLIVQTASAAMNVRIVVDRLNVRTGPG−−−LTFPVQEKVAKGKQYA−−−VVQK−−−−RGE−−−−−WLQIRL−−−−−−−−−−TSNRTGWVYGKYVQ−−−−−−−−−−−−−−−MQNEQMEKKKQIQQLVVCQADGLRLRKGPGTTY−−−−−−−AIIGYVNRNEKGT−−−−ATVIQE−−−−DWMY−−−−−−−−−VRW−−−−−DGKEGWVHRSY−−−−−−−−−−−−−−−−−−−−−−−−−−−VANVEKNEQNNEQNNEQHT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YVQMLYDNTNIRSAP−−−−−−−−−−−−−−−−−−−−−−−−−−STQSPVITKAKQGDQ−−FSVIRKEGQWYVIQVDAQTIGYVAEWV−−−−−VQVSNQPSPSQPQSL−−−−VGKTIVIDA                                             
fig|477974.3.peg.1446   Desulforudis audaxviator MP104C                                                                     LVAVFLFLVIGLAGRSVEASQMAVVTNPTVNLRGGAG−−−TNHPVVGQAGQGARLP−−−VLGK−−−−SGD−−−−−WVQVRQ−−−−−−−−−−ANGQAAWVAGWLVR−−−−−−−−−LEAAPASVAPTQPATATGGQVAVVTTGAVNLRGGAGTNH−−−−−−−PVVGQAGQGACLP−−−−VLGKSG−−−−DWVQ−−−−−−−−−VRQA−−−−−NGQAAWVAGWL−−−−−−−−−−−−−−−−−−−−−−−−−−−VRLEAAPASVAPTQPATA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TGGQVAVVTTGA−−VNLRGGA−−−−−−−−−−−−−−−−−−−−−−−−−−GTNHPVVGQAGQGAR−−LPVLGKSGDWVQVRQANGQAAWVAGWL−−−−−VRLEAAPASVAPTQPATATGGQVAVVTTGAVNL                                        
fig|500633.7.peg.1790   Clostridium hiranonis DSM 13275                                                                MKKAIAALGISAVTLAMSSADSSALETATVTADTLNMRSGPG−−−ISYSKRGVLHKGAKVT−−−ILEK−−−−SKG−−−−−WVKIKD−−−−−−−−−−SSGKTAWVSGQYLS−−−−−−−−−−−−TSGGNSSSSSSSESAGYIAYVSVNSSLNLRSEASTSG−−−−−−−SVIASLKNSEKVQ−−−−IIEKKDN−−−−GWSK−−−−−−−−−VKTE−−−−−SGKIGWVSSKY−−−−−−−−−−−−−−−−−−−−−−−−−−−LVNTPTNSGNTSSQENSSSQNDSVA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TSGNVKVNTSSG−−LNVRKGP−−−−−−−−−−−−−−−−−−−−−−−−−−GTNHSIIGSLAGGSV−−VQAKEKSGGWVKVVLPNGSTGWVSGQY−−−−−V                                                                        
fig|765079.3.peg.197   Propionibacterium acnes HL110PA3                                            GVATLATAGLAIGGSQFFV−−−−−−−−−−−−−−−−PPAQATNSSVKARVSARTAVNIRAQAG−−−IHGKIVGVLERGQQLN−−−QTGV−−−PVNG−−−−−WVPVA−−−−−−−−−−YRGHTAFIDHHYLS−−−−−−−−−−−SVAWRPSPSSPSASSSPVGIAQATTYVYVRAGHSMQA−−−−−−−AKVGVLSPGEKVG−−−−VTGRSAQ−−−−GFSE−−−−−−−−−VVY−−−−−NGVHRWVGSRY−−−−−−−−−−−−−−−−−−−−−−−−−−−LSPTAAKPSPKPTP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−A−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PKPSKTVYTTAN−−LNLRNGA−−−−−−−−−−−−−−−−−−−−−−−−−−SMSAAVYTSVSRGTA−−LAATGRTTSGWTQITHRGRTLWASSKY−−−−−L−−T−−−−TTAQPTP−−−−APRPAPDPSVSPRGARAAIVNYATAQVG                         
fig|596329.3.peg.1291   Peptostreptococcus anaerobius 653-L                                            MKTKMFLSALALIP−−−−−−−−−−−−−−−−−−−−−ALGMNANAEASVGHINFEFVNIRTNPS−−−MDDRVSFVLKRGAEVT−−−ILEE−−−−KDG−−−−−WSHIK−−−−−−−−−−SGNHEGWVQSNSII−−−−KGEDNNNVKLNSNVGSQ−−−−−−−−−KMINNPTLNLRQGATTSS−−−−−−−KIIAVLKKGDIVR−−−−LLEDRV−−−−GWCK−−−−−−−−−VDF−−−−−NGKVGYLSSRY−−−−−−−−−−−−−−−−−−−−−−−−−−−LSDVNANTSSIP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AKTIMTVTSNQ−−LNVRREA−−−−−−−−−−−−−−−−−−−−−−−−−−KATSAKLMTIYKGDE−−VVFEANTNGWAKITKDGKTGYVSSYY−−−−−L−−K−−−−DTGKTQE−−−−APRDEINEAETKPSIDPNIANRNSNAGIQGGVSYQDMNMSLSDHVNMQM     
fig|699033.6.peg.2410   Clostridium difficile 2007855                                                                         GNLAYANESEVESVSIESRTITGNAVNFRKGPG−−−TNHESMGKLYKGDKVE−−−YVGK−−−−EGS−−−−−WVKVKY−−−−−−−−−−−NGNTGYVHGNYVA−−−−−−−−−−−−INSLGSSNESSDTSVKSTKVVTAKGLNFRTGPSTSS−−−−−−−SKISTLGYGTEVG−−−−YISESN−−−−GWSK−−−−−−−−−ISS−−−−−NGRVGYVSSKY−−−−−−−−−−−−−−−−−−−−−−−−−−−LGTSVNDSTNENVENSSND−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LVKGTKVVTAKS−−LNVRTGP−−−−−−−−−−−−−−−−−−−−−−−−−−GTSHSKIATLSYGTE−−VGSISESGGWTKVSYGNQTGYVSSQY−−−−−LAEKGSVDTSIPS                                                            
fig|479832.7.peg.1973   Clostridium difficile QCD-76w55                                                                         GNLAYANESEVESVSIESRTITGNAVNFRKGPG−−−TNHESMGKLYKGDKVE−−−YVGK−−−−EGS−−−−−WVKVKY−−−−−−−−−−−NGNTGYVHGNYVA−−−−−−−−−−−−INSLGSSNESSDTSVKSTKVVTAKGLNFRTGPSTSS−−−−−−−SKISTLGYGTEVG−−−−YISESN−−−−GWSK−−−−−−−−−ISS−−−−−NGRVGYVSSKY−−−−−−−−−−−−−−−−−−−−−−−−−−−LGTSVNDSTNENVENSSND−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LVKGTKVVTAKS−−LNVRTGP−−−−−−−−−−−−−−−−−−−−−−−−−−GTSHSKIATLSYGTE−−VGSISESGGWTKVSYGNQTGYVSSQY−−−−−LAEKGSVDTSIPS                                                            
fig|479831.4.peg.1679   Clostridium difficile QCD-63q42                                                                         GNLAYANESEVESVSIESRTITGNAVNFRKGPG−−−TNHESMGKLYKGDKVE−−−YVGK−−−−EGS−−−−−WVKVKY−−−−−−−−−−−NGNTGYVHGNYVA−−−−−−−−−−−−INSLGSSNESSDTSVKSTKVVTAKGLNFRTGPSTSS−−−−−−−SKISTLGYGTEVG−−−−YISESN−−−−GWSK−−−−−−−−−ISS−−−−−NGRVGYVSSKY−−−−−−−−−−−−−−−−−−−−−−−−−−−LGTSVNDSTNENAENSSND−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LVKGTKVVTAKS−−LNVRTGP−−−−−−−−−−−−−−−−−−−−−−−−−−GTSHSKIATLSYGTE−−VGSISESGGWTKVSYGNQTGYVSSQY−−−−−LAEKGSVDTSIPS                                                            
fig|499175.4.peg.2028   Clostridium difficile ATCC 43255                                                                         GNLAYANESEVESVSIESRTITGNAVNFRKGPG−−−TNHESMGKLYKGDKVE−−−YVGK−−−−EGS−−−−−WVKVKY−−−−−−−−−−−NGNTGYVHGNYVA−−−−−−−−−−−−INSLGSSNESSDTSVKSTKVVTAKGLNFRTGPSTSS−−−−−−−SKISTLGYGTEVG−−−−YISESN−−−−GWSK−−−−−−−−−ISS−−−−−NGRVGYVSSKY−−−−−−−−−−−−−−−−−−−−−−−−−−−LGTSVNDSTNENAENSSND−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LVKGTKVVTAKS−−LNVRTGP−−−−−−−−−−−−−−−−−−−−−−−−−−GTSHSKIATLSYGTE−−VGSISESGGWTKVSYGNQTGYVSSQY−−−−−LAEKGSVDTSIPS                                                            
fig|1125976.4.peg.1196   Clostridium difficile CD37                                                                         GNLAYANESEVESVSIESRTITGNAVNFRKGPG−−−TNHESMGKLYKGDKVE−−−YVGK−−−−EGS−−−−−WVKVKY−−−−−−−−−−−NGNTGYVHGNYVA−−−−−−−−−−−−INSLGSSNESSDTSVKSTKVVTAKGLNFRTGPSTSS−−−−−−−SKISTLGYGTEVG−−−−YISESN−−−−GWSK−−−−−−−−−ISS−−−−−NGRVGYVSSKY−−−−−−−−−−−−−−−−−−−−−−−−−−−LGTSVNDSTNENAENSSND−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LVKGTKVVTAKS−−LNVRTGP−−−−−−−−−−−−−−−−−−−−−−−−−−GTSHSKIATLSYGTE−−VGSISESGGWTKVSYGNQTGYVSSQY−−−−−LAEKGSVDTSIPS                                                            
fig|272563.8.peg.2520   Clostridium difficile 630                                                                         GNLAYANESEVESVSIESRTITGNAVNFRKGPG−−−TNHESMGKLYKGDKVE−−−YVGK−−−−EGS−−−−−WVKVKY−−−−−−−−−−−NGNTGYVHGNYVA−−−−−−−−−−−−INSLGSSNESSDTSVKSTKVVTAKGLNFRTGPSTSS−−−−−−−SKISTLGYGTEVG−−−−YISESN−−−−GWSK−−−−−−−−−ISS−−−−−NGRVGYVSSKY−−−−−−−−−−−−−−−−−−−−−−−−−−−LGTSVNDSTNENAENSSND−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LVKGTKVVTAKS−−LNVRTGP−−−−−−−−−−−−−−−−−−−−−−−−−−GTSHSKIATLSYGTE−−VGSISESGGWTKVSYGNQTGYVSSQY−−−−−LAEKGSVDTSIPS                                                            
fig|405532.5.peg.1783   Bacillus cereus B4264                                            MKKILASVAVASVTGSVFISTAQAKNTVIPKDTKHEQTTDVVKYENQVTVNTNALRVRTQPN−−−MSSAIMGRVYEGEVLQ−−−VIGE−−−−ENS−−−−−WLKINH−−−−−−−−−−−KGKTGYVSSEFVS−−−−−−−−−−−−−−−GNNVSAKTNVSMSRSKTVTANVLRVRTQPNTSS−−−−−−−AIMGRVYEGKALQ−−−−VIGEEN−−−−GWLK−−−−−−−−−INH−−−−−NGEVGYVSSQF−−−−−−−−−−−−−−−−−−−−−−−−−−−VIDGSSNGSDNNNGKVQV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ASGNYKVNVSS−−−LRVRTGP−−−−−−−−−−−−−−−−−−−−−−−−−−STSHAILGSIHKGQV−−VQVTGEIQDWVKINYSGQTAYISKDY−−−−−ISKSGSNANVDQTNEQQKNVTVQTDGTYIVNATSLRVRTGP                                
fig|526968.3.peg.785   Bacillus cereus R309803                                                                                ANAEQLSNVKTGYVKVDQATLHKEDN−−−INSVSIDKIRFNTKVN−−−ILEK−−−−TND−−−−−WYKVSV−−−−−−−−−−−NNKVGYVQKDTIL−−−−−−−−−−−LKNKLQSNNQ−−−−−−−−−YIVNANALNVRSEPNLES−−−−−−−SILDVLPNGKFVT−−−−IQEEQG−−−−EWYK−−−−−−−−−ILH−−−−−NGQTGYVQKAF−−−−−−−−−−−−−−−−−−−−−−−−−−−ISNGSQPLVKGITVQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NNTKYTVATPK−−−LNVRSNA−−−−−−−−−−−−−−−−−−−−−−−−−−STSSSLLGSLQNGTQ−−VQVVETVGTWYKIRFGTGYGYVAKHY−−−−−VVQN−−−−−−−−−−−−−−−QPQSQAKTAQPSSIPAAFKFPAQGR                             
fig|262543.4.peg.1074   Exiguobacterium sibiricum 255-15                                                                  MKKTFLTLTTLALISSATGVEAASTTLILTDNVNIRTAAT−−−TSAPVITTLKKGTTVT−−−AVKK−−−−TGS−−−−−WYEIRH−−−−−−−−−−−QSKKAFITAAYVK−−−−−−−−−−−−−−−−−−−TVPAKAPTTTTYITNTSSVNVREKATTTS−−−−−−−KSLGKLAKNVSLS−−−−VKKKTG−−−−EWYE−−−−−−−−−INY−−−−−KNKSAYVHTTL−−−−−−−−−−−−−−−−−−−−−−−−−−−VTAKTSTVTTGSKPPVTKPVTPPVSTAVKAVD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SSKQYEVNAKEG−−LNARLSA−−−−−−−−−−−−−−−−−−−−−−−−−−STTAKIYKTLPHKTV−−LKVTGSLDKWYQIQLDGKDLYVASSY−−−−−V−−−−−−−−−−LATAKDAPPPTPSTPGVSVTPVDQSKAYKVNAPTGLNVRTAPSTTSTVFTQLAHGSTVQVSG
fig|262543.4.peg.2557   Exiguobacterium sibiricum 255-15                         SVEIKATPASSVATLASLQTGNVYYTTQLVTNPLGEQWHKVSKDGKTGYVKVNQGKTIKYYTVHDLSLKTTTATALHSYAG−−−PSYGVIKTIPNGTVVK−−−IQGQ−−−−IGN−−−−−WYKVSY−−−−−−−−−−−DGKSGYAAGTTFT−−−−−−−−−−DYVTTQPIPAT−−−−−−−−−DIQLETDVAMKAAPKANA−−−−−−−ATVTMFKTKDIYQTNQLVTNGSS−−−−KWHR−−−−−−−−−VTK−−−−−DGQTGYIPVD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QGKPVDY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SSENMAMKATET−−TILRTYA−−−−−−−−−−−−−−−−−−−−−−−−−−GNSYATVATIATNTN−−VQVIGKIQDWYKVSANGKTGYVVADT                                                                              
fig|262543.8.peg.2591   Exiguobacterium sibiricum 255-15                         SVEIKATPASSVATLASLQTGNVYYTTQLVTNPLGEQWHKVSKDGKTGYVKVNQGKTIKYYTVHDLSLKTTTATALHSYAG−−−PSYGVIKTIPNGTVVK−−−IQGQ−−−−IGN−−−−−WYKVSY−−−−−−−−−−−DGKSGYAAGTTFT−−−−−−−−−−DYVTTQPIPAT−−−−−−−−−DIQLETDVAMKAAPKANA−−−−−−−ATVTMFKTKDIYQTNQLVTNGSS−−−−KWHR−−−−−−−−−VTK−−−−−DGQTGYIPVD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QGKPVDY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SSENMAMKATET−−TILRTYA−−−−−−−−−−−−−−−−−−−−−−−−−−GNSYATVATIATNTN−−VQVIGKIQDWYKVSANGKTGYVVADT                                                                              
fig|360911.3.peg.1152   Exiguobacterium sp. AT1b                                                                                    TVTPSSATAQTKANLNLRSSKS−−−TKTTVLLTIPKGKTVT−−−VLSV−−−−EGS−−−−−WSKVKY−−−−−−−−−−−GSKTGYVANTYLT−−−−−−−−−−−−TSGAATPTTPSTGQSINQQFTTTANLNVRQGAGVGY−−−−−−−PLVTTIPNGTVVK−−−−ATKQSG−−−−SWYY−−−−−−−−−VTY−−−−−NGKSGYVSAGY−−−−−−−−−−−−−−−−−−−−−−−−−−−LKQTSTTPSNPAPNEGDAGAGNAAVDY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IVNTPS−−LNVRSSA−−−−−−−−−−−−−−−−−−−−−−−−−−STSATIIGSVKAGQT−−LRVVQSSKGWLQIYYGNTVGFVASAY−−−−−VKTVPKGSTDGPSWVEGSYDANSYYT                                               
fig|360911.3.peg.2184   Exiguobacterium sp. AT1b                                                                                  QSTVAEAASIYTTTANLNLRLSAA−−−TWSPVLLTIPSGSRVT−−−YIST−−−−YGS−−−−−WYKVSY−−−−−−−−−−−GGKTGYVASQYVS−−−−−−−−−−−−−−−−−−−−−−−−VSNTSAYYKTTDRLNMRLTAASWS−−−−−−−DVVTVIPADATVK−−−−YVSRYG−−−−SWYK−−−−−−−−−VTF−−−−−NGKTGYVASAY−−−−−−−−−−−−−−−−−−−−−−−−−−−LTPTSAPVPPSDY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YKTTAN−−LNLRLSA−−−−−−−−−−−−−−−−−−−−−−−−−−ASWSSVVTTIPSGAT−−VKYVSRYGSWYKVTYNGKTGYVSSDY−−−−−LTATTAPVTPSSYYETTVNLNMRLSAASWSDVLTVIPAGSVVKYVSRY                         
fig|262543.8.peg.2518   Exiguobacterium sibiricum 255-15                                                                                                DLLNLRSSDS−−−VSSKKLTTIPKKTSLT−−−SNYR−−−−IGD−−−−−WYLVTH−−−−−−−−−−−NGKTGYVLGQYLT−−−−−−−−−−−−−−−−−−−KVVSGTAFAKTAYQTTDALSLRQDASTSS−−−−−−−VRLLTIPVKTTVT−−−−SSFRDG−−−−NWYK−−−−−−−−−VTY−−−−−NNKTGFVSGAY−−−−−−−−−−−−−−−−−−−−−−−−−−−LKKVTASSTA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YTTTER−−LNFRTAP−−−−−−−−−−−−−−−−−−−−−−−−−−TTSGALLMTIPSNQV−−VQSLSVSSNWHKISYGGKTGYVMGTY−−−−−LKKETASPTVPTAGTADYSGSKMYVLIDAGST                                         
fig|262543.4.peg.2484   Exiguobacterium sibiricum 255-15                                                                                                DLLNLRSSDS−−−VSSKKLTTIPKKTSLT−−−SNYR−−−−IGD−−−−−WYLVTH−−−−−−−−−−−NGKTGYVLGQYLT−−−−−−−−−−−−−−−−−−−KVVSGTAFAKTAYQTTDALSLRQDASTSS−−−−−−−VRLLTIPVKTTVT−−−−SSFRDG−−−−NWYK−−−−−−−−−VTY−−−−−NNKTGFVSGAY−−−−−−−−−−−−−−−−−−−−−−−−−−−LKKVTASSTA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YTTTER−−LNFRTAP−−−−−−−−−−−−−−−−−−−−−−−−−−TTSGALLMTIPSNQV−−VQSLSVSSNWHKISYGGKTGYVMGTY−−−−−LKKETASPTVPTAGTADYSGSKMYVLIDAGST                                         
fig|634956.3.peg.2495   Geobacillus thermoglucosidasius C56-YS93                                                                      ATGKV−−−−−−−−−−−−−−−−−−−TADTLNVRSSGS−−−ASASVIGQLSYGTVVN−−−VLEI−−−−NGY−−−−−WAKIS−−−−−−−−