(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00008511

fig|527032.3.peg.5201   Bacillus thuringiensis serovar andalousiensis BGSC 4AW1     MAVYRPVHVSFWQDSFVLDLTPEEKYFYLYLMTNSKTSQSGIYELPLRIIETDTGYNRETVMKLLERFAEYGKINYNQKTKELFLINWLKFNPIKNVNIEKCVLKEIQSVKDQ−−DFLVDFYETCLQLEKEQDFKIPRIKE−−−−−YL−−−SV−−−−−−−−−−−−−−−−−−−−−−−RLEGL−−−−−−−−−−−IRGFQDPSKEE−−−−−−−−−−−−−−EK−−−−−−−−−−−−−−EEEKEQQQ−−−−−−−−−−−−EERAGAEEVVEVNPISFYEQNFGLITPFIADGIYAWIDDL−−NAELVIKAMEIALEKNTRNMSYVNTILRDWHLKGFKTVTDVEAADKAFRAQRLTKAQQQTKAPDQQKGLSESTKNVIQQQQAWE−−−−−QNIPTEEELAVLNQQN                   
fig|451707.4.peg.5196   Bacillus cereus NVH0597-99     MAVYRPVHVSFWQDSFVLDLTPEEKYFYLYLMTNSKTSQSGIYELPLRIIETDTGYNRETVMKLLERFAEYGKINYNQKTKELFLINWLKFNPIKNVNIEKCVLKEIQSVKDQ−−DFLVDFYETCLQLEKEQDFKIPRIKE−−−−−YL−−−SV−−−−−−−−−−−−−−−−−−−−−−−RLEGL−−−−−−−−−−−IRGFQAPSKEE−−−−−−−−−−−−−−EK−−EKEKEK−−−−−−EKEKEQQQ−−−−−−−−−−−−EEHAGAEEVVEVNPISFYEQNFGLITPFIADGIYAWIDDL−−NAELVIKAMEIALEKNTRNMSYVNTILRDWHLKGFKTVTDVEAADKAFRAQRLTKAQQQTKAPDQQKGLSESTKNVIQQQQAWE−−−−−QNIPTEEELAVLNQQN                   
fig|1217737.3.peg.3468   Bacillus thuringiensis HD-789     MAVYRPVHVSFWQDSFVLDLTPEEKYFYLYLMTNSKTSQSGIYELPLRIIETDTGYNRETVMKLLERFAEYGKINYNQKTKELFLINWLKFNPIKNVNIEKCVLKEIQSVKDQ−−DFLVDFYETCLQLEREQDFKIPRIKE−−−−−YL−−−SV−−−−−−−−−−−−−−−−−−−−−−−RLEGL−−−−−−−−−−−IRGFQDPSKEE−−−−−−−−−−−−−−EK−−−−−−EK−−−−−−EEEKEQQQ−−−−−−−−−−−−EERAGAEEVVEVNPISFYEQNFGFITPFIADGIYAWIDDL−−NAELVIKAMEIALEKNTRNMSYVNTILRDWHLKGFKTVTDVEAADKAFRAQRLTKSQQQTKAPDQQKGLSESTKNVIQQQQAWE−−−−−QNIPTEEELAVLNQQN                   
fig|339854.4.peg.3345   Bacillus thuringiensis serovar israelensis ATCC 35646     MAVYRPVHVSFWQDSFVLDLTPEEKYFYLYLMTNSKTSQSGIYELPLRIIETDTGYNRETVMKLLERFAEYGKINYNQKTKELFLINWLKFNPIKNVNIEKCVLKEIQSVKDQ−−DFLVDFYETCLQLEREQDFKIPRIKE−−−−−YL−−−SV−−−−−−−−−−−−−−−−−−−−−−−RLEGL−−−−−−−−−−−IRGFQDPSKEE−−−−−−−−−−−−−−EK−−−−−−EK−−−−−−EEEKEQQQ−−−−−−−−−−−−EERAGAEEVVEVNPISFYEQNFGFITPFIADGIYAWIDDL−−NAELVIKAMEIALEKNTRNMSYVNTILRDWHLKGFKTVTDVEAADKAFRAQRLTKSQQQTKAPDQQKGLSESTKNVIQQQQAWE−−−−−QNIPTEEELAVLNQQN                   
fig|526987.3.peg.4711   Bacillus cereus Rock4-2     MAVYRPVHVSFWQDSFVLDLTPEEKYFYLYLMTNSKTSQSGIYELPLRIIETDTGYNRETVMKLLERFAEYGKINYNQKTKELFLINWLKFNPIKNVNIEKCVLKEIQSVKDQ−−DFLVDFYETCLQLEKEQDFKIPRIKE−−−−−YL−−−SV−−−−−−−−−−−−−−−−−−−−−−−RLEGL−−−−−−−−−−−IRGFQDPSKEE−−−−−−−−−−−−−−EK−−−−−−−−−−−−−−−−EEKEQQQ−−−−−−−−−−−−EERAGAEEVVEVNPISFYEQNFGFITPFIADGIYAWVDDL−−NTELVIKAMEIALEKNTRNMSYVNTILRDWHLKGFKTVTDVEAADKAFRAQRLTKAQQQTQAPYQQKGLSETTKNVIQQQQAWE−−−−−QNIPTEEELAVLNQQN                   
fig|405531.7.peg.3803   Bacillus cereus G9842     MAVYRPVHVSFWQDSFVLDLTPEEKYFYLYLMTNSKTSQSGIYELPLRIIETDTGYNRETVMKLLERFAEYGKINYNQKTKELFLINWLKFNPIKNVNIEKCVLKEIQSVKDQ−−DFLVDFYETCLQLEKEQDFKIPRIKE−−−−−YL−−−SV−−−−−−−−−−−−−−−−−−−−−−−RLEGL−−−−−−−−−−−IRGFQDPSKEE−−−−−−−−−−−−−−EK−−−−−−EK−−−−−−EEEKEQQQ−−−−−−−−−−−−EERAGAEEVVEVNPISFYEQNFGFITPFIADGIYAWIDDL−−NAELVIKAMEIALEKNTRNMSYVNTILRDWHLKGFKTVTDVEAADKAFRAQRLTKAQQQTQAPYQQKGLSESTKNVIQQQQAWE−−−−−QNIPTEEELAVLNQQN                   
fig|526980.3.peg.4821   Bacillus cereus ATCC 10876     MAVYRPVHVSFWQDSFVLDLTPEEKYFYLYLMTNSKTSQSGIYELPLRIIETDTGYNRETVMKLLERFAEYGKINYNQKTKELFLINWLKFNPIKNVNIEKCVLKEIQSVKDQ−−DFLVDFYETCLQLEREQDFKIPRIKE−−−−−YL−−−SV−−−−−−−−−−−−−−−−−−−−−−−RLEGL−−−−−−−−−−−IRGFQDPSKEE−−−−−−−−−−−−−−EK−−−−EKEE−−−−−−EKEQQQQQ−−−−−−−−−−−−EERAGAEEVVEVNPISFYEQNFGFITPFIADGIYAWIDDL−−NAELVIKAMEIALEKNTRNMSYVNTILRDWHLKGFKTVADVEAADKAFRAQRLPKAQQQTQAPYQQKGLSETTKNVIQQQQAWE−−−−−QNIPTEEELAVLNQQN                   
fig|527025.3.peg.5532   Bacillus thuringiensis serovar thuringiensis str. T01001     MAVYRPVHVSFWQDSFVLDLTPEEKYFYLYLMTNSKTSQSGIYELPLRIIETDTGYNRETVMKLLERFAEYGKINYNQKTKELFLINWLKFNPIKNVNIEKCVLKEIQSVKDQ−−DFLVDFYETCLQLEREQDFKIPRIKE−−−−−YL−−−SV−−−−−−−−−−−−−−−−−−−−−−−RLEGL−−−−−−−−−−−IRGFQDPSKEE−−−−−−−−−−−−−−EK−−−−−−EE−−−−−−EKEKEQQ−−−−−−−−−−−−EERAGAEEVVEVNPISFYEKNFGFITPFIADGIYAWIDDL−−NAELVIKAMELALEKNTRNMSYVNTILRDWHLKGFKTVTDVESADKAFRAQRLTKAQQQTQAPYQQKGLSESTKNVIQQQQAWE−−−−−QNIPTEEELAVLNQQN                   
fig|527030.3.peg.1748   Bacillus thuringiensis serovar huazhongensis BGSC 4BD1     MAVYRPVHVSFWQDSFVLDLTPEEKYFYLYLMTNSKTSQSGIYELPLRIIETDTGYNRETVMKLLERFAEYGKINYNQKTKELFLINWLKFNPIKNVNIEKCVLKEIQSVKDQ−−DFLVDFYETCLQLEREQDFKIPRIKE−−−−−YL−−−SV−−−−−−−−−−−−−−−−−−−−−−−RLEGL−−−−−−−−−−−IRGFQDPSKEE−−−−−−−−−−−−−−EK−−−−−−EK−−−−−−EEEKEQQQ−−−−−−−−−−−−EERAGAEEVVEVNPISFYEQNFGFITPFIADGIHAWIDDL−−NAELVIKAMEIALEKNTRNMSYVNTILRDWHLKGFKTVTDVEAADKAFRAQRLTKAQQQTQAPYQQKGLTETTKNVIQQQQAWE−−−−−QNIPTEEELAVLNQQN                   
fig|527024.3.peg.4889   Bacillus thuringiensis serovar tochigiensis BGSC 4Y1     MAVYRPVHVSFWQDSFVLDLTPEEKYFYLYLMTNSKTSQSGIYELPLRIIETDTGYNRETVMKLLERFAEYGKINYNQKTKELFLINWLKFNPIKNVNIEKCVLKEIQSVKDQ−−DFLVDFYETCLQLEREQDFKIPRIKE−−−−−YL−−−SV−−−−−−−−−−−−−−−−−−−−−−−RLEGL−−−−−−−−−−−IRGFQDPSKEE−−−−−−−−−−−−−−EK−−−−−−EE−−−−−−EEKEQQQQ−−−−−−−−−−−−EKRASAEEVVEVNPISFYEQNFGLITPFIADGIYAWVDDL−−NAELVVKAMEIALEKNTRNMNYVNTILRDWHLKGLKTIMDVEAADKAFRTQRLTKAQEQTQAPYQQKGLSESTKNVIQQQQAWE−−−−−QNIPTEEELAVLNQRN                   
fig|315730.11.peg.4246   Bacillus weihenstephanensis KBAB4     MAVYRPVHVSFWQDSFVLDLTPEEKYFYLYLMTNSKTSQSGIYELPLRIIETDTGYNRETVMKLLERFAEYGKINYNQKTKELFLINWLKFNPIKNVNIEKCVLKEIQSVKDQ−−DFLADFYETCLQLEREQNFKIPRIKE−−−−−YL−−−SV−−−−−−−−−−−−−−−−−−−−−−−RLEGL−−−−−−−−−−−IRGFQDHSKEE−−−−−−−−−−−−−−EK−−−−EEEK−−−−−−EEEKEQQQ−−−−−−−−−−−−EERASAEEVVEVNPISFYEQNFGFITPFIADGIHAWIDDL−−NAELVVKAMEIALEKNTRNMSYVNTILRDWHLKGFKTIVDVEVADKAFRTQRLAKAQQPTQAPYQQKGLSESTKNVIQQQESWE−−−−−QNIPTDEELAALNQKSG                  
fig|315730.5.peg.4168   Bacillus weihenstephanensis KBAB4     MAVYRPVHVSFWQDSFVLDLTPEEKYFYLYLMTNSKTSQSGIYELPLRIIETDTGYNRETVMKLLERFAEYGKINYNQKTKELFLINWLKFNPIKNVNIEKCVLKEIQSVKDQ−−DFLADFYETCLQLEREQNFKIPRIKE−−−−−YL−−−SV−−−−−−−−−−−−−−−−−−−−−−−RLEGL−−−−−−−−−−−IRGFQDHSKEE−−−−−−−−−−−−−−EK−−−−EEEK−−−−−−EEEKEQQQ−−−−−−−−−−−−EERASAEEVVEVNPISFYEQNFGFITPFIADGIHAWIDDL−−NAELVVKAMEIALEKNTRNMSYVNTILRDWHLKGFKTIVDVEVADKAFRTQRLAKAQQPTQAPYQQKGLSESTKNVIQQQESWE−−−−−QNIPTDEELAALNQKSG                  
fig|526993.3.peg.5977   Bacillus cereus AH1272     MAVYRPVQVSYWQDAFVLDLTPEEKYFYLYLMTNSKTSQSGIYELPLRVIEMDTGYNRETVEKLLERFSDYGKINYNKKTKEIMLLNWLKFNAITNMNIEKCVLKEIQSIKDE−−EFLVDFYETCLEQEKQQDFKIPRIKE−−−−−YF−−−QA−−−−−−−−−−−−−−−−−−−−−−−RFEWL−−−−−−−−−−−TRGFDDPMKEK−−−−−−−−−−−−−−EETKTETETK−−−−−−EKEETKTETKTETKEA−−−ASCSEMPKVAEENPIAFYEQNFGVLKPFVAEGINAWIDDL−−NTQLVIKAMKIALEKNAPNMSYVQGILRDWHAKGYKSINDVEAAQAQFRKK−−−−−−−−−−−−YQSRGGRNNARKEIVPDWLHT−−−−−QDTETHSQSVERSETGLEAE               
fig|526967.3.peg.167   Bacillus cereus 172560W     MAVYRPVQVSYWQDAFVLDLTPEEKYFYLYLMTNSKTSQSGIYELPLRVIEMDTGYNRETVEKLLERFADYGKIHYNKKTKEIMLINWLKFNAITNMNIEKCVLKEIQNIKCE−−DFLIDFYETCLELEKQQDFKIPRIKE−−−−−YF−−−QA−−−−−−−−−−−−−−−−−−−−−−−RFEWF−−−−−−−−−−−IRGFEDPMKEK−−−−−−−−−−−−−−EETK−−TETK−−−−−−EKEETKTK−−−−−EEA−−−ASCSRDKKVAEENPIAFYEQNFGVLKPFVAEGINAWIEDL−−NAQLVIKAMKIALEKNAPNMSYVQGILRDWHAKGYKSITDVEAAQAQFRKK−−−−−−−−−−−−YQSRGGRSNAQKEIVPDWLHT−−−−−QDTEAQSQPVKHDEMELEVERKRLEQVLAKYKKEA
fig|527030.3.peg.3499   Bacillus thuringiensis serovar huazhongensis BGSC 4BD1                                                         MDTGYNRETVEKLLERFADYGKIHYNKKTKEIMLINWLKFNAITNMNIEKCVLKEIQNIKCE−−DFLIDFYETCLELEKQQDFKIPRIKE−−−−−YF−−−QA−−−−−−−−−−−−−−−−−−−−−−−RFEWL−−−−−−−−−−−IRGFEDPMKEK−−−−−−−−−−−−−−EETK−−TETK−−−−−−EKEETKTK−−−−−EEA−−−ASCSRDKKVAEENPIAFYEQNFGVLKPFVAEGINAWIEDL−−NAQLVIKAMKIALEKNAPNMSYVQGILRDWHAKGYKSITDVEAAQTQFRKK−−−−−−−−−−−−YHSRGGRNNARNEIVPDWLHT−−−−−QDTETNSQSVELNETELEAE               
fig|527019.3.peg.6836   Bacillus thuringiensis IBL 200                                                         MDTGYNRETVEKLLERFADYGKIHYNKKTKEIMLINWLKFNAITNMNIEKCVLKEIQNIKCE−−DFLIDFYETCLDLEQQQDFKIPRIKE−−−−−YF−−−QA−−−−−−−−−−−−−−−−−−−−−−−RFEWL−−−−−−−−−−−IRGFEDPMKEK−−−−−−−−−−−−−−EETK−−TETK−−−−−−EKEETKTK−−−−−EEAA−−−ASCSRDKKVAEENPIAFYEQNFGVLKPFVAEGINAWIEDL−−NAQLVIKAMKIALEKNAPNMSYVQGILRDWHAKGYKSITDVEAAQTQFRKK−−−−−−−−−−−−YHSRGGRNNARNEIVPDWLHT−−−−−QDTETNSQSVELSETELEAE               
fig|526969.3.peg.2289   Bacillus cereus m1550     MAIFRQVHTSFWNDVKVQEDFTPEDKYFFLYLLTNPQTKQIGVYQITKKQMAFETGYSHETIKALMQRFEDYHKIIKYDNETRELVIFNWGKYNLKKAGKPVEDLIKKELKEVKNI−−SLLIPICKHIE−−−−−−QKSIKKLIE−−−−−TFI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−HDSYNDTLTNRGT−−SRGQEE−−−EE−−−−−−EK−−−−−−EQEQEEKE−−−−−−−−−−−−QEEQEVPLVVENLAIDFYMKNFGHISPFMGEEINQWIDEL−−NQSLVVEAMKIALENNKRNWAYTKGILKDWHQQGFKTIQDVETAQATFRRQQSKKR−−−−−TGKGYSKRTEVVPDWLRKQEEQEPI                                      
fig|526967.3.peg.73   Bacillus cereus 172560W     MAIFRQVHTSFWNDVKVQEDFTPEDKYFFLYLLTNPQTKQIGVYQITKKQMAFETGYSHETIKVLMQRFEDYHKIIKYDNETRELVIFNWGKYNLKKAGKPVEDLIKKELKEVKNI−−SLLIPICKHIE−−−−−−QKSVKKLIE−−−−−TFI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−HDSYNDTLTNRGT−−SRGQEE−−−EQ−−−−−−EK−−−−−−EKEKEIE−−−−−−−−−−−−QEEKEGPLVVENFAIDFYMKNFGHISPFMGEEINQWIDEL−−NQMLVVEAMKITLANNKRNWSYTKGILKDWHQQGFKTIQDVEAAQAAFRRQQQSKKR                                                                   
fig|565653.4.peg.113   Enterococcus gallinarum EG2     MAIYRQLHTTFWKDKRVGEWSKDQKLFFLYLLSNDYTTQCGVYEFNLRYAKFELDMTAEEIKTNIDFLVSEGRIVFNEKSEELMIVNWLKYNSARSPKVAAVIDKELKEIKTL−−EFEIEVIKKCQ−−−−EYKYPIQTLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PKENTVSIGYGYGI−−−−−−−−−−−DTIT−−QPASSPATTPT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TSPATAENAQSAPAAANPFQLYQEVFGVINGLVADDLRHWVEDI−−GEEMVCEAMRRS−−AIDQKSYGYAKGIMQSWVKKNIKTMADVRADDVRHKNQNSYSKKPIR−−−−−−−−−TEPIPEWLNDPEGYNAQKEAEIMER                              
fig|742813.4.peg.1424   Enterococcus saccharolyticus 30_1     MAIYRQLHTTFWKDKRVGEWSKDQKLFFLYLLSNDYTTQCGVYEFNLRYAKFELDMTAEEIKTNIDFLVSEGRIVFNEKSEELMIVNWLKYNSARSPKVAAVIDKELKEIKTL−−EFEIEVIKKCQ−−−−EYKYPIQTLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PKENTVSIGYGYGI−−−−−−−−−−−DTIT−−QPASSPATTPT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TSPATAENAQSAPAAANPFQLYQEVFGVINGLVADDLRHWVEDI−−GEEMVCEAMRRS−−AIDQKSYGYAKGIMQSWVKKNIKTMADVRADDVRHKNQNSYSKKPIR−−−−−−−−−TEPIPEWLNDPEGYNAQKEAEIMER                              
fig|526980.3.peg.5006   Bacillus cereus ATCC 10876     MAKYRHVQTTFWSDPKVTEEMTPEDRYFYLYLMTNEHTTQIGVYQITRKQMAFELGYSIESAKALLDRFTKHHELIVYNEETREICILNWGKYNLIKGGKPIEDCIQKELKTIKDL−−SLVKLVLDRTK−−−−−−NEKLVHKIS−−−−−AF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AGFNDTSNDTST−−IRGQKEK−−EK−−−−−−EK−−−−−−EKEKEKEK−−−−−−−−−−−−LQQEEIFPTAENLAIDFYMNNFGFISPFMGEEINQWVDDL−−NQDLVVEAMKITLQNNTRNWSYTKGILKDWHQQGFKTIQDVEAAQATFRRQQQNKK−−−−RTGKGYANRTEAVPDWLHQQEEHEPVQQPQQTPSDD                            
fig|515621.3.peg.2763   Clostridium botulinum Ba4 str. 657     MAYRLVYTEFWTDPKVLEEMTPEDRYFYLYLLTNPCTTNCGIYQITRKQMAFEIGHSTESINSLMDRFTNHHKLIMYNTETRELAIKNWGKYNLNKGGKPVLDCLTKELKEVKDK−−SLIKYVGENVK−−−−−−SEDLRQLYQ−−−−−SFI−−DMVKSHERDVPRKENDTVTSRGRIVPRQVDDTKASTNGEKQILRIYQGFNDTVT−−NR−−−−−−−−−−−−−−−ERVVPRQGDNTTTNTSTNTDTNTTTITSTKKSSYSGKSNIDVFKHLEKCNFIMSTMLMEKIAADIEIY−−GHSEVMKAAEISDENSKHSYNYLKGVLEN                                                                                                
fig|101031.3.peg.3826   Bacillus B-14905     MAKFRLVHTSFWNDPRVVEEMTAEDKYFFLYLLTNESTTQIGIYQITKKQIAFDLGYSPESANALLQRFIEHHKLIRYNAETREIAIKNWGKYNLVRGGKPILDCVKSELKNVKDA−−TLIEWVGESVP−−−−−−NDSIRNVYQ−−−−−TYY−−DT−−−−−−−−−−−−−−−−−−−−−−−HHDTATIRDEKEESSNTKGFYVTSHDTST−−ISGQEE−−−QQQQDKQQEK−−−−−−EEEKEQQQ−−−−−−−−EKKVGQSVSSSSDFAKLVEFTNQNITPVLPTIAEHLGYILDDF−−KDVDLILAALQNAVLNNARNKIKYAEGTLINWRKDMITTYQQLQLKAKEAQRDERNSQGYERHSNNEYDGLS                                                      
fig|634956.3.peg.3677   Geobacillus thermoglucosidasius C56-YS93     MAKYRYVHVSFWQDAKVLEEMTPEDKYFYIYLLTNPNTTQIGIYQITKKQMAFELGYSIESINSLVERFENVHKVIKYNPQTREIALLNWGKYNLIKGGKPVLDCIEKELMEVKDT−−SLIGLVARKIP−−−−−−NESIRELFL−−−−−RYANDTS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YDTYHDTLDDTST−−IRTTLSG−−EK−−−−−−EK−−−−−−EKQKEKEYYYPGN−−−−−−−−−−−−−−−DDDIADVGRFYQANIGVLAPIVSESIEYWCRDL−−SPELVKEAIKRAATNNVRRWSYIEEILKNWKDNNVTTVEEAMSLDAQWKNKKDETAIRPAHQPLKN                                                          
fig|526998.3.peg.1747   Bacillus mycoides Rock1-4     MAVYRPVQVSFWQDAKVIEEMTPEDKLFNLYLLTNPCTTQIGVYQITKKQMAFDLGYSMESINALLDRFENHHKLVKYNPETRELAIINWGKYNLNRGGKPIEDCVRKELDGVTDI−−SLISLVTPKVK−−−−−−NDKIRAIFE−−−−−DFL−−AV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−HDTCHDTST−−ISGEK−−−EK−−−−−−EK−−−−−−EKEKQQQE−−−−−−−−−−−−EERT−−−−DVVEVNPISFYEQNFGFMTPFIAEGILAWVDDL−−NAELVVKAMEIALEKNTRNMSYVNSILRDWHVKGFKKVTDVEVADKEFRAKRTTQVKQ−−QLVYQSVAMSESTKQVLQQQKEWN−−−−−QNIATDEELAALNQQNG                  
fig|527000.3.peg.3616   Bacillus pseudomycoides DSM 12442     MAVFRPVQVSFWQDAKVIEEMTPEDKLFNLYLLTNPCTTQIGVYQITKKQMDFDLGYSMESVNSLLDRFENHHKLVKYNPETRELAIINWGKYNLNRGGKPIEDCVRKELDGVTDI−−SLISLVTPKVK−−−−−−NDKIRAIFE−−−−−EFL−−AV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−HDTCHDTST−−ISGEK−−−EK−−−−−−EK−−−−−−EKEKEKQQ−−−−−−−−−−−−EERT−−−−DVVEVNPISFYEQNFGFMTPFIAEGILAWVDDL−−NAELVVKAMEISLEKNTRNMSYVNSILRDWHVKGFKTVTDVEVADKEFRAKRTTQVKQ−−QPAYQSVAMSESTKQVLQQQKEWN−−−−−QNIATDEELAALNQQNG                  
fig|526971.3.peg.941   Bacillus cereus MM3     MAVYRPVQVSFWQDAKVIEEMTPEDKLFNLYLLTNPCTTQIGVYQITKKQMAFDLGYSMESVNALLDRFENHHKLVKYNAETRELAIINWGKYNLNRGGKPIEDCVRKELDGVSDI−−SLIRLVTPKVK−−−−−−NDKIRVIFE−−−−−EFL−−AV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NDTCHDTST−−ISGQK−−−EK−−−−−−EK−−−−−−EKEKQQQE−−−−−−−−−−−−EEPAGAEAVVEVNPISFYEQNFGFVTPFIAEGINHWIDDL−−NAELVVKAMEIALEKNTRNMNYVNTILRDWHLKGLKTVADVEAADKEFRAQRLAKAQQQPQAPYQQKSLSESTKNVIQQQEAWE−−−−−QNIPTDEELAALNQQNG                  
fig|405535.8.peg.515   Bacillus cereus AH820     MAVYRPVQVSFWQDAKVIEEMTPEDKLFNLYLLTNPCTTQIGVYQITKKQMAFDLGYSMESVNALLDRFENHHKLVKYNAETRELAIINWGKYNLNRGGKPIEDCVRKELDGVSDI−−SLVHLVTPKVK−−−−−−NDKIRAIFE−−−−−EFL−−DV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NDTCHDTST−−ISGEK−−−EK−−−−−−EK−−−−−−EKEKQQQ−−−−−−−−−−−−EERAGAEEVVEVNPISFYEQNFGIITPFIADGIHGWIDDL−−NAELVVKAMQIALEKNTRNMNYVNTILRDWHLKGLKTVADVEAADQAFRAQRLAKVQQ−−QAPYQQKGLSESTKNVIQQQEAWE−−−−−QNIPTDEELAALTKQSG                  
fig|405534.9.peg.849   Bacillus cereus AH187     MAVYRPVQVSFWQDAKVIEEMTPEDKLFNLYLLTNPCTTQIGVYQITKKQMAFDLGYSMESVNALLDRFENHHKLVKYNAETRELAIINWGKYNLNRGGKPIEDCVRKELDGVSDI−−SLVRLVTPKVK−−−−−−NDKIRVIFE−−−−−EFL−−TV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NDTCHDTST−−ISGQK−−−EK−−−−−−EK−−−−−−EKEKQQQ−−−−−−−−−−−−EERAGAEEVVEVNPISFYEQNFGFITPFVADGIHAWVDDL−−NAELVVKAMQIALEKNTRNMTYVNTILRDWHLKGLKTIADVEAADQAFRAQRLAKAQQSSQVPYQQKGLSESTRNVIQQQEAWK−−−−−QNIPTEEELAALNQQN                   
fig|405535.8.peg.4403   Bacillus cereus AH820     MAVYRQVQVSFWQDAKVIEEMTPEDKLFNLYLLTNPRTTQIGVYQITKKQMAFDLGYSMESVNALLDRFEKHHKLVKYNPETRELAILNWGKYNLNRGGKPVEDCIRKELDGVGDT−−SLVALVAAKVK−−−−−−NDKIRAIFE−−−−−EFL−−HA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DDTSDDTST−−TGGQEK−−−EE−−−−−−EK−−−−−−EEEKEQQQ−−−−−−−−−−−−EERAGAKEVVEVNPISFYEKNFGFITPFIADGIHAWIDDL−−NAELVVKAMQIALEKNTRNMNYVNTILRDWHLKGLKTVADVEAADQAFRAQRLAKGQQTMQAPYQNKGLSASTQNVLQQQEAWK−−−−−QNIPTEEELAALNQQN                   
fig|526979.3.peg.364   Bacillus cereus 95/8201     MAVYRQVQVSFWQDAKVIEEMTPEDKLFNLYLLTNPRTTQIGVYQITKKQMAFDLGYSMESVNALLDRFEKHHKLVKYNPETRELAIINWGKYNLNRGGKPVEDCIRKELDGVSDG−−SLVELVSAKVK−−−−−−SDKIRAIFE−−−−−EFI−−NA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NDTSDDTFT−−TGGQEK−−−EE−−−−−−EK−−−−−−EEEKEEQQ−−−−−−−−−−−−QERAGAEDVVEINPIIFYERNFGLITPFIADGINAWIDDL−−NAELVVKAMQIALEKNTRNMNYVNTILRDWHLKGLKTVADVEAADKEFRAQRFAKAQQSSQVPYQQKGLSESTKNVIQQQESWE−−−−−QNIPTDEELAALNQQNG                  
fig|526973.3.peg.1453   Bacillus cereus m1293     MAVYRQVQVSFWQDAKVIEEMTPEDKLFNLYLLTNPRTTQIGVYQITKKQMAFDLGYSMESVNALLDRFEKHHKLVKYNPETRELAIINWGKYNLNRGGKPVEDCIRKELDGVGDT−−SLVALVAAKVK−−−−−−NDKIRAIFE−−−−−EFL−−HA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NDTSDDTST−−TGGQ−−−−−EE−−−−−−EK−−−−−−EEEKEEQQQ−−−−−−−−−−−−EERTSAEEVVAVNPITFYEQNFGFITPYIADGIHGWIDDL−−NAELVVKAMEIALEKNTRNMNYVNTILRDWHLKGLKTVADVETADKEFRAQRYAKAQQSSQVPYQQKGLSESTKNVIQQQESWE−−−−−QNIPTDEELAALNQQNG                  
fig|444177.5.peg.1892   Lysinibacillus sphaericus C3-41     MAKFRHVHTTFWDDGFVLDLTPEEKYFYLYLMTNGNTTQCGIYELPYRVIEMHTGYNRETVQKLLQRFFEYGKISYNELTKEIMLINWAKYNFINSPKVKKCIEKELLAVKHI−−PFVRSYVTSLE−−−−QLGYSIDTVCI−−−−−WLNKLNE−−−−−−−−−−−−−−−−−−−−−−−QKESNDSNNKDSIPYPYPIDRPSKDCRE−−EEKQQEK−−IK−−−−−−EK−−−−−−EKEKETTEC−−−−−−−E−−−DSQSTVTNEQLIFLTKFYDENIQKASSYICECIEHMACEN−−NPVLVYEAMKIAVLQQPNKPIQYIERILVNWRTDLITNDGQLKAKEQREINKRQQSFPYSYQK−−−−−−−SLGRREIVPEWFDKRNDKVEHPIPSTES                           
fig|441770.4.peg.2637   Clostridium botulinum A str. ATCC 19397     MAKYRQLHTQFWSDGFVLDLTPEEKYFYLYLMSNTKTSQCGVYELPLRVIEMETGYNRETVIKLIKRFIDYKKIKYDEETKEIMIFNWVKYNVPNNINSIKCINKELKNIKNK−−EFIKILYLKYC−−−−ELQLDIEKLFD−−−−−GIFILTN−−−−−−−−−−−−−−−−−−−−−−−EKKTL−−−−−−−−−−−−−−−EGVNEDIGS−−KEGISNKVKVT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NEEINTNLEDVVTFFKKNICTPKDLEYRKIKEWASRI−−DCDVIIMAIEEAVKYNAKNIQYIENVLYSWDERALKTKKDVE                                                                                  
fig|629742.3.peg.669   Staphylococcus hominis SK119                                                                                  YDTTTAYDFLLN−−NFVEMQNTNKQKEVSNLIQDIKDNTLDVVKEATNYCK−−−−DNNKGLNYFIA−−−−−VIKNWIA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DDVDT−−KEKALAKVKPN−−−−−−NK−−−−−−−−KHNKTDEVFAAMEKELNTNENKRQTIHEADNVFTFYENNGFGRLNSTIVEKIDAWREDFNGNDDIVIEALKEAINNNVYKWAYVNSILVSWYQEGINSVEDIEARKKQRNKLNSNKS−−−−−−−−−−−−−−−−−−−FLDRLEDEE−−−−−ENSQYSE                            
fig|592031.3.peg.193   Eubacterium saphenum ATCC 49989                                                                                                           EKAIRKSLKSLKDN−−GLITFDKDIL−−−−TEDPKIISFISVADEFYF−−−GS−−−−−−−−−−−−−−−−−−−−−−−SDKTV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ENNASRCDDNTSSDSKACHAEKTLDKNPDNNADQAYDSTKEELFNRIEKLTGTTLSTQSLKGINSFLEKN−−MEPAVIEKAFEKAFEREITNWKYVKAILRDWYDSGIMDINTLSTVEEIDGSRQRQYKSILKRLGITNYFNPSDAQKEVINK                                             
fig|101031.3.peg.3314   Bacillus B-14905                                                                                                            KCGREATASIINE−−LILAGYLQKVQ−−−−ERTKDGKFSKV−−−−−EFVVFEV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SKRAAQPSTGYPST−−−−−−DAPQTEKPTQLNNKLLNNQLLKNKDDDQQSHTADYFYEQQGFGSLSAYITAKIHSWLTIF−−SEEIVIHAMKLAVEHNVLRWRYVEKILRNWHHKQLKTMADIASDQRRFQAKKIKVT−−−−−−−−−−−−−DIPANRRKEIIPQWF−−−−−HHRHEEERPQQ                        
fig|526989.3.peg.5473   Bacillus cereus F65185     MAVYRNVQVNFWQDEFILDLTPEERYFYIYLLTGTKTKQCGIYILPKRVAELETGYSMETVEKLLNRFVEYGKILYDTETKEVFIINWLHYNPISNTNVEKCVLRELKTIKSN−−EFIHIFLRKCL−−−−EEEYKIPLLLQ−−−−−HF−−−GM−−−−−−−−−−−−−−−−−−−−−−−PKEED−−−−−−−−−−−−−−−−−−−−NSSS−−QVV−−−−−−IE−−−−−−EK−−−−−−EEAE−−−−−−−−−−−−−−−EIEVETIEKDVPNSEVYKFYEQNISSLSPYIVKELKNWIQRL−−SGEKVLEVLKIAFENNKKTLAYVRGILRNWCSEKLKDFSGEKCVMGSLERRKCILS                                                                    
fig|527023.3.peg.5336   Bacillus thuringiensis serovar kurstaki str. T03a001     MAVYRNVQVNFWQDEFILDLTPEERYFYIYLLTGTKTKQCGIYILPKRVAELETGYSMETVEKLLNRFVEYGKILYDTETKEVFIINWLHYNPISNTNVEKCVLRELKTIKSN−−EFIHIFLRKCL−−−−EEEYKIPLLLQ−−−−−HF−−−GM−−−−−−−−−−−−−−−−−−−−−−−PKEED−−−−−−−−−−−−−−−−−−−−NSSS−−QVV−−−−−−IE−−−−−−EK−−−−−−EEAE−−−−−−−−−−−−−−−EIEVETIEEDVPNSEVYKFYEQNISSLSPYIVKELKNWIQRL−−SGEKVLEVLKIAFENNKKTLAYVRGILRNWCSEKLKDFSGEKCVMGSLERRKCILS                                                                    
fig|526980.3.peg.4145   Bacillus cereus ATCC 10876     MAVYRNVQVNFWQDEFILDLTPEERYFYIYLLTGTKTKQCGIYILPKRVAELETGYSMETVEKLLNRFVEYGKILYDTETKEVFIINWLQYNPISNTNVEKCVLRELKTIKSN−−EFIHIFLRKCL−−−−EEEYKIPLLLQ−−−−−HF−−−GM−−−−−−−−−−−−−−−−−−−−−−−PKEED−−−−−−−−−−−−−−−−−−−−NSSS−−QVV−−−−−−IE−−−−−−EK−−−−−−EEAE−−−−−−−−−−−−−−−EIEVETIEEDVPNSEVYKFYEQNISSLSPYIVKELKNWIQRL−−FGEKVLEVLKIAFENNKKTLAYVKGILRNWCSEKLKDFSGEKCVMGSLERRKCILS                                                                    
fig|526967.3.peg.3336   Bacillus cereus 172560W     MAVYRNVQVNFWQDEFILDLTPEERYFYIYLLTGTKTKQCGIYILPKRVAELETGYSMETVEKLLNRFVEYGKILYDTETKEVFIINWLHYNPISNTNVEKCVLRELKTIKSN−−EFIHIFLRKCL−−−−EEEYKIPLLLQ−−−−−HF−−−GM−−−−−−−−−−−−−−−−−−−−−−−PKEED−−−−−−−−−−−−−−−−−−−−NSSS−−QVV−−−−−−IE−−−−−−EK−−−−−−EEAE−−−−−−−−−−−−−−−EIEVETIEEDVPNSEVYKFYEQNISSLSPYIVKELKNWIQRL−−SGEKVLEALKIAFENNKKTLAYVKGILRNWCSEKLKDFSGEKCVMGSLERRKCILS                                                                    
fig|526987.3.peg.2369   Bacillus cereus Rock4-2     MAVYRNVQVNFWQDEFILDLTPEERYFYIYLLTGTKTKQCGIYILPKRVAELETGYSMETVEKLLNRFVEYGKILYDTETKEVFIINWLHYNPISNTNVEKCVLRELKTIKSN−−KFIHIFLRKCL−−−−EEEYKIPLVLQ−−−−−HF−−−GM−−−−−−−−−−−−−−−−−−−−−−−PKEED−−−−−−−−−−−−−−−−−−−−NSSS−−QVV−−−−−−IE−−−−−−EK−−−−−−EEAE−−−−−−−−−−−−−−−EIEVETIEEDVPNSEVYKFYEQNISSLSPYIVKELKNWIQRL−−SGEKVLEALKIAFENNKKTLAYVKGILRNWCSEKLKDFSGEKCVMGSLERRKCILS                                                                    
fig|526969.3.peg.3033   Bacillus cereus m1550     MAVYRNVQVNFWQDEFILDLTPEERYFYIYLLTGTKTKQCGIYILPKRVAELETGYSMETVEKLLNRFVEYGKILYDTETKEVFIINWLHYNPISNTNVEKCVLRELKTIKSN−−EFIHIFLRKCL−−−EEEEYKIPLLLQ−−−−−HF−−−GM−−−−−−−−−−−−−−−−−−−−−−−PKEED−−−−−−−−−−−−−−−−−−−−NSSS−−QVV−−−−−−IE−−−−−−EK−−−−−−EEAE−−−−−−−−−−−−−−−EIEVETIEEDVPNSEVYKFYEQNISSLSPYIVKELKNWIQRL−−SGEKVLEALKIAFENNKKTLAYVKGILRNWCSKKLKDFSGEKSVMGSLERRKCMLS                                                                    
fig|714359.3.peg.3152   Bacillus thuringiensis BMB171     MAVYRNVQVNFWQDEFILDLTPEERYFYIYLLTGTKTKQCGIYILPKRVAELETGYSMETVEKLLNRFVEYGKILYDTETKEVFIINWLHYNPISNTNVEKCVLRELKTVKSN−−EFIHIFLRKCL−−−−EKEYKIPLVLQ−−−−−HF−−−GM−−−−−−−−−−−−−−−−−−−−−−−PKEED−−−−−−−−−−−−−−−−−−−−NSSS−−QVV−−−−−−IE−−−−−−EK−−−−−−EEAE−−−−−−−−−−−−−−−−−EVETIEEDVPNSEVYKFYEQNISSLSPYIVKELKNWIQRL−−SGEKVLEALKIAFENNKKTLAYVKGILRNWCSKKLKDFSGEKSVMGSLERRKCMLS                                                                    
fig|526974.3.peg.3792   Bacillus cereus BDRD-ST24     MAVYRNVQVNFWQDEFILDLTPEERYFYIYLLTGTKTKQCGIYILPKRVAELETGYSMETVEKLLNRFVEYGKILYDTETKEVFIINWLHYNPISNTNVEKCVLRELKTVKSN−−EFIHIFLRKCL−−−−EKEYKIPLVLQ−−−−−HF−−−GM−−−−−−−−−−−−−−−−−−−−−−−PKEED−−−−−−−−−−−−−−−−−−−−NSSS−−QVV−−−−−−IE−−−−−−EK−−−−−−EEAE−−−−−−−−−−−−−−−−−EVETIEEDVPNSEVYKFYEQNISSLSPYIVKELKNWIQRL−−SGEKVLEALKIAFENDKKTLAYVKGILRNWCSKKLKDFSGGKSVMGSLERRKCMLS                                                                    
fig|226900.1.peg.3108   Bacillus cereus ATCC 14579     MAVYRNVQVNFWQDEFILDLTPEERYFYIYLLTGTKTKQCGIYILPKRVAELETGYSMETVEKLLNRFVEYGKILYDTETKEVFIINWLHYNPISNTNVEKCVLRELKTVKSN−−EFIHIFLRKCL−−−−EKEYKIPLVLQ−−−−−HF−−−GM−−−−−−−−−−−−−−−−−−−−−−−PKEED−−−−−−−−−−−−−−−−−−−−NSSS−−QVV−−−−−−IE−−−−−−EK−−−−−−EEAE−−−−−−−−−−−−−−−−−EVETIEEDVPNSEVYKFYEQNISSLSPYIVKELKNWIQRL−−SGEKVLEALKIAFENNKKTLAYVKGILRNWCSKKLKDFSGGKSVMGSLERRKCMLS                                                                    
fig|526978.3.peg.3310   Bacillus cereus BDRD-Cer4     MAVYRNVQVNFWQDEFILDLTPEERYFYIYLLTGTKTKQCGIYILPKRVAELETGYSMETVEKLLNRFVEYGKILYDTETKEVFIINWLHYNPISNTNVEKCVLRELKTVKSN−−EFIHIFLRKCL−−−−EKEYKIPLVLQ−−−−−HF−−−GM−−−−−−−−−−−−−−−−−−−−−−−PKEED−−−−−−−−−−−−−−−−−−−−NSSS−−QVV−−−−−−IE−−−−−−EK−−−−−−EEAE−−−−−−−−−−−−−−−−−EVETIEEDVPNSEVYKFYEQNISSLSPYIVKELKNWIQRL−−SGEKVLEALKIAFENNKKTLAYVKGILRNWCSKKLKDFSGGKSVMGSLERRKCMLS                                                                    
fig|1218175.3.peg.631   Bacillus thuringiensis HD-771     MAVYRNVQVNFWQDDFILDLTPEERYFYIYLLTGTKTKQCGIYILPKRVAELETGYSMETVEKLLNRFVEYGKILYDTETKEVFIINWLHYNPISNTNVEKCVLRELKTVKSN−−EFIHMFLRKCL−−−−EEEYTIPLLLQ−−−−−HF−−−GM−−−−−−−−−−−−−−−−−−−−−−−PKEED−−−−−−−−−−−−−−−−−−−−NSSS−−QVV−−−−−−IE−−−−−−EK−−−−−−EEAE−−−−−−−−−−−−−−−−−EVESIEEDVPNSEVYKFYEQNISSLSPYIVKELKNWIQKF−−SGEKVLEALKIAFENNKKTLAYVKGILRNWCSKKLKDFSGEKCVMGSLERRKCMLS                                                                    
fig|405531.7.peg.3190   Bacillus cereus G9842     MAVYRNVQVNFWQDEFILDLTPEERYFYIYLLTGTKTKQCGIYILPKRVAELETGYSMETVEKLLNRFVEYGKILYDTKTKEVFIINWLHYNPISNANVEKCVLRELKTVKSN−−EFIHIFLRKCL−−−−EEEYTIPLLLQ−−−−−HF−−−GM−−−−−−−−−−−−−−−−−−−−−−−PEEED−−−−−−−−−−−−−−−−−−−−NSSS−−QVV−−−−−−IE−−−−−−EK−−−−−−KEEE−−−−−−−−−−−−−−−−−EIETIEEGVPNSEVYKFYEQNISSLSPYIVKELKNWIQRL−−SGEKVLEALKIAFENNKKTLVYVKGILRNWCSEKLKDFSGEKCVMGSLERRKCILS                                                                    
fig|1217737.3.peg.2749   Bacillus thuringiensis HD-789     MAVYRNVQVNFWQDEFILDLTPEERYFYIYLLTGTKTKQCGIYILPKRVAELETGYSMETVEKLLNRFVEYGKILYDTKTKEVFIINWLHYNPISNTNVEKCVLRELKTVKSN−−EFIHIFLRKCL−−−−EEEYTIPLLLQ−−−−−YF−−−GM−−−−−−−−−−−−−−−−−−−−−−−PEEED−−−−−−−−−−−−−−−−−−−−NSSS−−QVV−−−−−−IE−−−−−−EK−−−−−−EEAE−−−−−−−−−−−−−−−−−EIETIEEGVPNSEVYKFYEQNISSLSPYIVKELKNWIQRL−−SGEKVLEALKIAFENNKKTLVYVKGILRNWCKKERIDFSE                                                                                     
fig|339854.4.peg.6324   Bacillus thuringiensis serovar israelensis ATCC 35646     MAVYRNVQVNFWQDEFILDLTPEERYFYIYLLTGTKTKQCGIYILPKRVAELETGYSMETVEKLLNRFVEYGKILYDTKTKEVFIINWLHYNPISNTNVEKCVLRELKTVKSN−−EFIHIFLRKCL−−−−EEEYTIPLLLQ−−−−−YF−−−GM−−−−−−−−−−−−−−−−−−−−−−−PEEED−−−−−−−−−−−−−−−−−−−−NSSS−−QVV−−−−−−IE−−−−−−EK−−−−−−EEAE−−−−−−−−−−−−−−−−−EIETIEEGVPNSEVYKFYEQNISSLSPYIVKELKNWIQRL−−SGEKVLEALKIAFENNKKTLVYVKGILRNWCKKERIDFSE                                                                                     
fig|527019.3.peg.4288   Bacillus thuringiensis IBL 200     MAVYRNVQVNFWQDEFILDLTPEERYFYIYLLTGTKTKQCGIYILPKRVAELETGYSMETVEKLLNRFVEYGKILYDTETKEVFIINWLHYNPISNTNVEKCVLRELKTVKSN−−EFIHIFLRKCL−−−−EEEYTIPLLLQ−−−−−HF−−−GM−−−−−−−−−−−−−−−−−−−−−−−PKEED−−−−−−−−−−−−−−−−−−−−NSSS−−QVV−−−−−−IE−−−−−−EK−−−−−−EEAE−−−−−−−−−−−−−−−−−EVESIEEDVPNSEVYKFYEQNISSLSPYIVKELKNWIQRL−−SGEKVLEALKIAFENNQKTLAYVKGILRNWCKKERVDFSE                                                                                     
fig|405533.4.peg.1662   Bacillus cereus AH1134     MAVYRNVQVNFWQDEFILDLTPEERYFYIYLLTGTKTKQCGIYILPKRVAELETGYSMETVEKLLNRFVEYGKILYDTETKEVFIINWLHYNPISNTNVEKCVLRELKTIKSN−−EFIHIFLRKCL−−−−EEEYKIPLLLQ−−−−−HF−−−GM−−−−−−−−−−−−−−−−−−−−−−−PKEED−−−−−−−−−−−−−−−−−−−−NSSS−−QVV−−−−−−IE−−−−−−EK−−−−−−EEAE−−−−−−−−−−−−−−−EIEVETIEEDVPNSEVYKFYEQNISSLSPYIVKELKNWIQRL−−SGEKVLEALKIAFENNKKTLAYVKGILRNWCKKGRVDFSE                                                                                     
fig|526982.3.peg.4377   Bacillus cereus Rock1-15     MAVYRNVQVNFWQDEFILDLTPEERYFYIYLLTGTKTKQCGIYILPKRVAELETGYSMETVEKLLNRFVEYGKILYDTETKEVFIINWLHYNPISNTNVEKCVLRELKTIKSN−−EFIHIFLRKCL−−−−EEEYKIPLLLQ−−−−−HF−−−GM−−−−−−−−−−−−−−−−−−−−−−−PKEED−−−−−−−−−−−−−−−−−−−−NSSS−−QVV−−−−−−IE−−−−−−EK−−−−−−EEAE−−−−−−−−−−−−−−−EIEVETIEEDVPNSEVYKFYEQNISSLSPYIVKELKNWIQRL−−SGEKVLEALKIAFENNKKTLAYVKGILRNWCKKGRVDFSE                                                                                     
fig|1053238.3.peg.1202   Bacillus cereus VD154     MAVYRNVQVNFWQDEFILDLTPEERYFYIYLLTGTKTKQCGIYILPKRVAELETGYSMETVEKLLNRFVEYGKILYDTETKEVFIINWLHYNPISNTNVEKCVLRELKTIKSN−−EFIHIFLRKCL−−−−EKEYKIPLVLQ−−−−−HF−−−GM−−−−−−−−−−−−−−−−−−−−−−−PKEED−−−−−−−−−−−−−−−−−−−−NSSS−−QVV−−−−−−IE−−−−−−EK−−−−−−EEAE−−−−−−−−−−−−−−−−−EVETIEEDVPNSEVYKFYEQNISSLSPYIVKELKNWIQRL−−SGEKVLEALKIAFENNKKTLAYVKGILRNWCKKGRVDFSE                                                                                     
fig|1209372.3.peg.5676   Bacillus sp. WBUNB009     MAVYRNVQVNFWQDEFILDLTPEERYFYIYLLTGTKTKQCGIYILPKRVAELETGYSMETVEKLLNRFVEYGKILYDTETKEVFIINWLHYNPISNTNVEKCVLRELKTIKSN−−EFIHIFLRKCL−−−−EKEYKIPLVLQ−−−−−HF−−−GM−−−−−−−−−−−−−−−−−−−−−−−PKEED−−−−−−−−−−−−−−−−−−−−NSSS−−QVV−−−−−−IE−−−−−−EK−−−−−−EEAE−−−−−−−−−−−−−−−−−EVETIEEDVPNSEVYKFYEQNISSLSPYIVKELKNWIQRL−−SGEKVLEALKIAFENNKKTLAYVKGILRNWCKKGRVDFSE                                                                                     
fig|405532.4.peg.2997   Bacillus cereus B4264     MAVYRNVQVNFWQDEFILDLTPEERYFYIYLLTGTKTKQCGIYILPKRVAELETGYSMETVEKLLNRFVEYGKILYDTETKEVFIINWLHYNPISNTNVEKCVLRELKTIKSN−−EFIHIFLRKCL−−−−EEEYKIPLLLQ−−−−−HF−−−GM−−−−−−−−−−−−−−−−−−−−−−−PKEED−−−−−−−−−−−−−−−−−−−−NSSS−−QVV−−−−−−IE−−−−−−EK−−−−−−EEAE−−−−−−−−−−−−−−−EIEVETIEEDVPNSEVYKFYEQNISRLSPYIVKELKNWIQRL−−SGEKVLEALKIAFENNKKTLAYVKGILRNWCKKGRVDFSE                                                                                     
fig|527030.3.peg.4704   Bacillus thuringiensis serovar huazhongensis BGSC 4BD1     MAVYRNVQVNFWQDEFILDLTPEERYFYIYLLTGTKTKQCGIYILPKRVAELETGYSMETVEKLLNRFVEYGKILYDTETKEVFIINWLHYNPISNTNVEKCVLRELKTIKSN−−EFIHIFLRKCL−−−−EEEYKIPLLLQ−−−−−HF−−−GM−−−−−−−−−−−−−−−−−−−−−−−PEEED−−−−−−−−−−−−−−−−−−−−NSSS−−QVV−−−−−−IE−−−−−−EK−−−−−−EEAE−−−−−−−−−−−−−−−EIEVETIEEDVPNSEVYKFYEQNISSLSPYIVKELKNWIQRL−−SGEKVLEALKIAFENNKKTLAYVKGILRNWCKKGRVDFSE                                                                                     
fig|526988.3.peg.5876   Bacillus cereus Rock4-18     MAVYRNVQVNFWQDEFILDLTPEERYFYIYLLTGTKTKQCGIYILPKRVAELETGYSMETVEKLLNRFVAYGKILYDAETKELYILNWLHYNPILNTNVEKCVLRELKTVKNK−−EFIHMYLRRCL−−−−EEEWKIPLLLQ−−−−−HF−−−GM−−−−−−−−−−−−−−−−−−−−−−−PEEED−−−−−−−−−−−−−−−−−−−−TSSL−−QEV−−−−−−IE−−−−−−EK−−−−−−EVEE−−−−−−−−−−−−−−−−−−VESIEEAVPNSKVYKFYEQHISSLSPYIVKELKDWIQRV−−SGKVVLEALKIAFEHNKRTFAYVKGILRNWCKKGQVDLSEEKEG                                                                                
fig|526983.3.peg.2233   Bacillus cereus Rock3-28     MAVYRNVQVNFWQDEFILDLTPEERYFYIYLLTGTKTKQCGIYILPKRVAELETGYSMETVEKLLNRFVEYGKIFYDMETKELFIVNWLRYNPILNTNVEKCVLRELKTVKNK−−EFIHMYLRRCL−−−−EEEWKIPLLLQ−−−−−HF−−−GM−−−−−−−−−−−−−−−−−−−−−−−PEEED−−−−−−−−−−−−−−−−−−−−TSSL−−QEV−−−−−−IE−−−−−−EK−−−−−−EVEE−−−−−−−−−−−−−−−−−−VESIEEAVPNSKAYKFYEQHISSLSPYIVKELKDWIQRV−−SGKVVLEALKIAFEHNKRTFAYVKGILRNWCKKGQVDLSEEKEG                                                                                
fig|1053237.3.peg.2315   Bacillus cereus VD148     MAVYRNVQVNFWQDEFILDLTPEERYFYIYLLTGTKTKQCGIYILPKRVAELETGYSMETVEKLLNRFVAYGKILYDAETKELYILNWLHYNPILNTNVEKCVLRELKTVKNK−−EFIYTFLRKCL−−−−EEEWKIPLLLQ−−−−−HF−−−GM−−−−−−−−−−−−−−−−−−−−−−−PEEED−−−−−−−−−−−−−−−−−−−−TSSL−−QEV−−−−−−IE−−−−−−EK−−−−−−−−−E−−−−−−−−−−−−−−−−−−VESIEEAVPNSKVYKFYEQHISSLSPYIVKELKDWIQRV−−SGKVVLEALKIAFEHNKRTFAYVKGILRNWCKKGQVDLSEEKEG                                                                                
fig|526981.3.peg.3718   Bacillus cereus Rock1-3     MAVYRNVQVNFWQDEFILDLTPEERYFYIYLLTGTKTKQCGIYILPKRVAELETGYSMETVEKLLNRFVAYGKILYDAETKELYILNWLHYNPILNTNVEKCVLRELKTVKNK−−EFIYTFLRKCL−−−−EEEWKIPLLLQ−−−−−HF−−−GM−−−−−−−−−−−−−−−−−−−−−−−PEEED−−−−−−−−−−−−−−−−−−−−TSSL−−QEV−−−−−−IE−−−−−−EK−−−−−−−−−E−−−−−−−−−−−−−−−−−−VESIEEAVPNSKVYKFYEQHISSLSPYIVKELKDWIQRV−−SGKVVLEALKIAFEHNKRTFAYVKGILRNWCKKGQVDLSEEKEG                                                                                
fig|1053187.3.peg.2374   Bacillus cereus BAG4X2-1     MAVYRNVQVNFWQDEFILDLTPEERYFYIYLLTGTKTKQCGIYILPKRVAELETGYSMETVEKLLNRFVAYGKILYDAETKELYILNWLHYNPILNTNVEKCVLRELKTVKNK−−EFIHTFLRKCL−−−−EEEWKIPLLLQ−−−−−HF−−−GM−−−−−−−−−−−−−−−−−−−−−−−PEEED−−−−−−−−−−−−−−−−−−−−TSSL−−QEV−−−−−−IE−−−−−−EK−−−−−−−−−E−−−−−−−−−−−−−−−−−−VESIEEAVPNSKVYKFYEQHISSLSPYIVKELKDWIQRV−−SGKVVLEALKIAFEHNKRTFAYVKGILRNWCKKGQVDLSEEKEG                                                                                
fig|405535.8.peg.3289   Bacillus cereus AH820     MAVYRNVQVNFWQDEFILDLTPEERYFYIYLLTGTKTKQCGIYVLPKRVAELETGYNMETVEKLLNRFVEYGKILYDVETKELYIMNWLNYNPILNTNVEKCVLRELKTVKNK−−EFIHMFLHKCL−−−−EEEWKIPLLLQ−−−−−HF−−−GM−−−−−−−−−−−−−−−−−−−−−−−PEEEG−−−−−−−−−−−−−−−−−−−−NSSL−−QEV−−−−−−VE−−−−−−EE−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−IEEDTSHGEVYKFYEQNISSLSPYIVKELKNWIQRL−−SGEKVLEALKIAFEQNKRTFAYVKGILRNWCSEYGGE−−−−−KCVMGSLERRRSVLS                                                                    
fig|405917.4.peg.57   Bacillus cereus W     MAVYRNVQVNFWQDEFILDLTPEERYFYIYLLTGTKTKQCGIYVLPKRVAELETGYNMETVEKLLNRFVEYGKILYDVETKELYIMNWLNYNPILNTNVEKCVLRELKTVKNK−−EFIHMFLHKCL−−−−EEEWKIPLLLQ−−−−−HF−−−GM−−−−−−−−−−−−−−−−−−−−−−−PEEEG−−−−−−−−−−−−−−−−−−−−NSSL−−QEV−−−−−−VE−−−−−−EE−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−IEEDTSHGEVYKFYEQNISSLSPYIVKELKNWIQRL−−SGEKVLEALKIAFEQNKRTFAYVKGILRNWCSEYGGE−−−−−KCVMGSLERRRSVLS                                                                    
fig|526979.3.peg.3615   Bacillus cereus 95/8201     MAVYRNVQVNFWQDEFILDLTPEERYFYIYLLTGTKTKQCGIYVLPKRVAELETGYNMETVEKLLNRFVEYGKILYDVETKELYIMNWLNYNPILNTNVEKCVLRELKTVKNK−−EFIHMFLHKCL−−−−EEEWKIPLLLQ−−−−−HF−−−GM−−−−−−−−−−−−−−−−−−−−−−−PEEEG−−−−−−−−−−−−−−−−−−−−NSSL−−QEV−−−−−−VE−−−−−−EE−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−IEEDTSHGEVYKFYEQNISSLSPYIVKELKNWIQRL−−SGEKVLEALKIAFEQNKRTFAYVKGILRNWCSEYGGE−−−−−KCVMGSLERRRSVLS                                                                    
fig|527022.3.peg.5892   Bacillus thuringiensis serovar monterrey BGSC 4AJ1     MAVYRNVQVNFWQDEFILDLTPEERYFYIYLLTGTKTKQCGIYVLPKRVAELETGYNMETVEKLLNRFVEYGKILYDVETKELYIMNWLNYNPILNTNVEKCVLRELKTVKNK−−EFIHMFLHKCL−−−−EEEWKIPLLLQ−−−−−HF−−−GM−−−−−−−−−−−−−−−−−−−−−−−PEEEG−−−−−−−−−−−−−−−−−−−−NSSL−−QEV−−−−−−VE−−−−−−EE−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−IEEDTSHGEVYKFYEQNISSLSPYIVKELKNWIQRL−−SGEKVLEALKIAFEQNKRTFAYVKGILRNWCSEYGGE−−−−−KCVMGSLERRRSVLS                                                                    
fig|527029.3.peg.3956   Bacillus thuringiensis serovar pondicheriensis BGSC 4BA1     MAVYRNVQVNFWQDEFILDLTPEERYFYIYLLTGTKTKQCGIYVLPKRVAELETGYNMETVEKLLNRFVEYGKILYDVETKELYIMNWLNYNPILNTNVEKCVLRELKTVKNK−−EFIHMFLHKCL−−−−EEEWKIPLLLQ−−−−−HF−−−GM−−−−−−−−−−−−−−−−−−−−−−−PEEEG−−−−−−−−−−−−−−−−−−−−NSSL−−QEV−−−−−−VE−−−−−−EE−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−IEEDTSHGEVYKFYEQNISSLSPYIVKELKNWIQRL−−SGEKVLEALKIAFEQNKRTFAYVKGILRNWCSEYGGE−−−−−KCVMGSLERRRSVLS                                                                    
fig|526985.3.peg.5060   Bacillus cereus Rock3-42     MAVYRNVQVNFWQDEFILDLTPEERYFYIYLLTGTKTKQCGIYVLPKRVAELETGYNMETVEKLLNRFVEYGKILYDVETKELYIMNWLNYNPILNTNVEKCVLRELKTVKNK−−EFIHMFLRKCL−−−−EEEWKIPLLLQ−−−−−HL−−−GM−−−−−−−−−−−−−−−−−−−−−−−PKEED−−−−−−−−−−−−−−−−−−−−TSSL−−QEV−−−−−−VE−−−−−−EI−−−−−−ENVE−−−−−−−−−−−−−−−−−−−−−EETDTSHGEVYKFYEQNISSLSPYIVKEMKNWIQRL−−LGEKVLEALKIAFEQNKRTFAYVKGILRNWCSEYGGE−−−−−KCVMGSLERRRSVLS                                                                    
fig|526968.3.peg.3282   Bacillus cereus R309803     MAVYRNVRVNFWQDEFILDLTPEERYFYIYLLTGTKTKQCGIYVLPKRLAELETGYSMETVEKLLNRFVEYGKILYDAETKELYIINWLHYNPILNTNVEKCVLRELKAVKSK−−EFLHMFLRKCL−−−−EEEWKIPLLLQ−−−−−HF−−−GM−−−−−−−−−−−−−−−−−−−−−−−PKEED−−−−−−−−−−−−−−−−−−−−NSSL−−QAV−−−−−−VE−−−−−−EE−−−−−−EDVE−−−−−−−−−−−−−−−−−VIETVEETTSHSEVYNFYEQNISSLSPYIVKELKGWIQRL−−SGSTVLEALKVAFEHNKRTLAYVKGILRNWCSEYGEE−−−−−QCVMGSLERRRSVLS                                                                    
fig|361100.6.peg.3082   Bacillus cereus Q1     MAVYRNVQVNFWQDEFILDLTPEERYFYIYLLTGTKTKQCGIYVLPKRVAELETGYSMETVEKLLSRFVEYGKILYDAETKELYIINWLHYNPILNTNVEKCVLRELKTVKNK−−EFIHMFLRTCL−−−−EGKWKIPLLLQ−−−−−YF−−−GM−−−−−−−−−−−−−−−−−−−−−−−PEEED−−−−−−−−−−−−−−−−−−−−TSSL−−QEV−−−−−−VE−−−−−−EI−−−−−−KDVE−−−−−−−−−−−−−−−−−−−−−VEEDTLHSEVYKFYEQHISSLSPYIVKELEEWIRKV−−SGERVLEALKIAFEQNKRTLAYVKGILRNWCIEYGGE−−−−−KCVMGSLERRRSVLS                                                                    
fig|451708.10.peg.1604   Bacillus cereus H3081.97     MAVYRNVQVNFWQDEFILDLTPEERYFYIYLLTGTKTKQCGIYVLPKRVAELETGYSMETVEKLLSRFVEYGKILYDAETKELYIINWLHYNPILNTNVEKCVLRELKTVKNK−−EFIHMFLRTCL−−−−EEKWKIPLLLQ−−−−−YF−−−GM−−−−−−−−−−−−−−−−−−−−−−−PEEED−−−−−−−−−−−−−−−−−−−−TSSL−−QEV−−−−−−VE−−−−−−EI−−−−−−KDVE−−−−−−−−−−−−−−−−−−−−−VEEDTLHSEVYKFYEQHISSLSPYIVKELEEWIRKV−−SGERVLEALKIAFEQNKRTLAYVKGILRNWCIEYGGE−−−−−KCVMGSLERRRSVLS                                                                    
fig|405534.9.peg.3487   Bacillus cereus AH187     MAVYRNVQVNFWQDEFILDLTPEERYFYIYLLTGTKTKQCGVYVLPKRVAELETGYSMETVEKLLSRFVEYGKILYDAETKELYIINWLHYNPILNTNVEKCVLRELKTVKNK−−EFIHMFLRTCL−−−−EEKWKIPLLLQ−−−−−YF−−−GM−−−−−−−−−−−−−−−−−−−−−−−PEEED−−−−−−−−−−−−−−−−−−−−TSSL−−QEV−−−−−−VE−−−−−−EI−−−−−−KDVE−−−−−−−−−−−−−−−−−−−−−VEEDTLHSEVYKFYEQHISSLSPYIVKELKEWIRKV−−SGERVLEALKIAFEQNKRTLAYVKGILRNWCIEYGGE−−−−−KCVMGSLERRRSVLS                                                                    
fig|222523.6.peg.3145   Bacillus cereus ATCC 10987     MAVYRNVQVNFWQDEFILDVTPEERYFYIYLLTGTKTKQCGIYVLPKRVAELETGYNMETVEKLLNRFVEYGKILYDAETKELYIINWLHYNPILNTNVEKCVLRELKTVKNK−−EFIHMFLRTCL−−−−EKEWKIPLLLQ−−−−−YF−−−GM−−−−−−−−−−−−−−−−−−−−−−−PEEED−−−−−−−−−−−−−−−−−−−−TSSL−−QEV−−−−−−VE−−−−−−EI−−−−−−KDVE−−−−−−−−−−−−−−−−−−−−−VEEDTPHSEVYKFYEQHISSLSPYIVKELKEWIQKV−−SGERVLEALKIAFEQNKRTFAYVKGILRNWCSKYGGE−−−−−KCVMGSLERRRSVLS                                                                    
fig|526973.3.peg.4604   Bacillus cereus m1293     MAVYRNVQVNFWQDEFILDLTPEERYFYIYLLTGTKTKQCGIYVLPKRLAELETGYSMETVEKLLNRFVAYGKILYDAETKELYILNWLHYNPILNTNVEKCVLRELKTVKNK−−EFIHMFLRKCL−−−−EEEWKIPLLLQ−−−−−HF−−−GM−−−−−−−−−−−−−−−−−−−−−−−PEEED−−−−−−−−−−−−−−−−−−−−TSSL−−QEV−−−−−−VE−−−−−−KI−−−−−−EDME−−−−−−−−−−−−−−−−−−−−−VEEDTQHSEVYKFYEQNISSLSPYIVEELKGWIRKV−−SGNTVLEALKIAFEQNKRTFAYVKGILRNWCIEYGGE−−−−−KCVMGSLERRRSVLS                                                                    
fig|315730.11.peg.3627   Bacillus weihenstephanensis KBAB4     MAVYRNVQVNFWQDEFILDLTPEERYFYIYLLTGTKTKQCGIYVLPKRVAELETGYSMETVEKLLNRFVEYGKILYDAETKELYILNWLNYNPILNTNVEKCVLRELKTVKNK−−EFIHIFLRKCL−−−−EEECKIPLLLQ−−−−−HF−−−GM−−−−−−−−−−−−−−−−−−−−−−−PEEEI−−−−−−−−−−−−−−−−−−−−DSNSQ−−QVI−−−−−−IQ−−−−−−EK−−−−−−EEVE−−−−−−−−−−−−−−−−−−−−RVEDATPHSEVYKFYEQNISSLSPYIAKELKEWMQRV−−SGDKVLEALKIAFENNKGTLAYIKGILRNWCSEYSGE−−−−−KCVMGSLERRRSVLS                                                                    
fig|315730.5.peg.3551   Bacillus weihenstephanensis KBAB4     MAVYRNVQVNFWQDEFILDLTPEERYFYIYLLTGTKTKQCGIYVLPKRVAELETGYSMETVEKLLNRFVEYGKILYDAETKELYILNWLNYNPILNTNVEKCVLRELKTVKNK−−EFIHIFLRKCL−−−−EEECKIPLLLQ−−−−−HF−−−GM−−−−−−−−−−−−−−−−−−−−−−−PEEEI−−−−−−−−−−−−−−−−−−−−DSNSQ−−QVI−−−−−−IQ−−−−−−EK−−−−−−EEVE−−−−−−−−−−−−−−−−−−−−RVEDATPHSEVYKFYEQNISSLSPYIAKELKEWMQRV−−SGDKVLEALKIAFENNKGTLAYIKGILRNWCSEYSGE−−−−−KCVMGSLERRRSVLS                                                                    
fig|526972.3.peg.3917   Bacillus cereus AH621     MAVYRNVQVNFWQDEFILDLTPEERYFYIYLLTGTKTKQCGIYILPKRLAELETGYSMETVEKLLNRFVEYGKILYEAETKELFIINWLHYNPIFNTNIEKCVLRELKMVKSK−−EFLHKFLRKCL−−−−EEECKIPLLLQ−−−−−YF−−−GM−−−−−−−−−−−−−−−−−−−−−−−PEEEV−−−−−−−−−−−−−−−−−−−−DSNSQ−−QVI−−−−−−IQ−−−−−−EK−−−−−−EEVE−−−−−−−−−−−−−−−−−−−−RVEDATPHSEVYKFYEQNISSLSPYIAKELKEWMQRV−−SGDKVLEALKIAFENNKGTLAYVKGILRNWCSEYSGE−−−−−KCVMGSLERRRSVLS                                                                    
fig|526976.3.peg.5469   Bacillus cereus BDRD-ST196     MAVYRNVQVNFWQDEFILDLTPEERYFYIYLLTGTKTKQCGIYILPKRLAELETGYSMETVEKLLNRFVEYGKILYDAETKELFIINWLHYNPIFNTNIEKCVFRELKMVKSK−−EFLHKFLRKCL−−−−EEECKIPLLLQ−−−−−YF−−−GM−−−−−−−−−−−−−−−−−−−−−−−PEEEV−−−−−−−−−−−−−−−−−−−−SSNSQ−−QAI−−−−−−IQEKEEKEEK−−−−−−EEVE−−−−−−−−−−−−−−−−−−−−RVEDATPHSEVYKFYEQNISSLSPYIAKELKEWMQRV−−SGDKVLEALKIAFENNKGTLAYVKGILRNWCSEYSGE−−−−−KCVMGSLERRRSVLS                                                                    
fig|526993.3.peg.1135   Bacillus cereus AH1272     MAVYRNVQVNFWQDEFILDLTPEERYFYIYLLTGTKTKQCGIYILPKRLAELETGYSMETVEKLLNRFVEYGKILYDAETKELFIINWLHYNPIFNTNIEKCVLRELKMVKSK−−EFLHKFLRKCL−−−−EEGCKIPLLLQ−−−−−YF−−−GM−−−−−−−−−−−−−−−−−−−−−−−PEEEI−−−−−−−−−−−−−−−−−−−−SSNSQ−−QVI−−−−−−IQ−−−−−−EK−−−−−−EEVE−−−−−−−−−−−−−−−−−−−−IVEEVTLHSEVYKFYEQNISSLSPYIVKGLKGWIQRV−−SGDKVLEALKIAFENNKGTFDYMQGILRNWCNKKAENAGEEKSVMGNLERRRSILS                                                                    
fig|526990.3.peg.5112   Bacillus cereus AH603     MAVYRNVQVNFWQDEFILDLTPEERYFYIYLLTGTKTKQCGIYILPKRLAELETGYSMETVEKLLNRFVEYGKILYDAETKELFIINWLHYNPIFNTNIEKCVLRELKMVKSK−−EFLHKFLRKCL−−−−EEECKIPLLLQ−−−−−YF−−−GM−−−−−−−−−−−−−−−−−−−−−−−PEEEI−−−−−−−−−−−−−−−−−−−−DSNSQ−−QVI−−−−−−IQ−−−−−−EK−−−−−−EEVE−−−−−−−−−−−−−−−−−−−−RVEEVTPHSEVYKFYEQNISSLSPYIVKELKGWMQRV−−SGDKVLEALKIAFENNKGTFAYVKGILKNWCKKGRVSFNKGKEIVRKRE                                                                           
fig|526997.3.peg.3423   Bacillus mycoides DSM 2048     MAVYRNVQVNFWQDEFILDLTPEERYFYIYLLTGTKTKQCGIYILPKRLAE