(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00008045

fig|226900.1.peg.2337   Bacillus cereus ATCC 14579                         QDFINA−−QNQY−−−GVSAHYLAAHAILESG−−−Y−−−−−GKS−−−−EIAY−−−−−−QKHNLFGL−−−−−−−−−R−−−AYDGDPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KYAKYLPSYGDSIAYNANYV−−RERYLEESGMY−−−YNGSTL−−−−TGMN−−−−−−−−−VKYASD−−−−−KG−−−−−−WAKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IAGIMER                           
fig|226900.8.peg.2496   Bacillus cereus ATCC 14579                         QDFINA−−QNQY−−−GVSAHYLAAHAILESG−−−Y−−−−−GKS−−−−EIAY−−−−−−QKHNLFGL−−−−−−−−−R−−−AYDGDPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KYAKYLPSYGDSIAYNANYV−−RERYLEESGMY−−−YNGSTL−−−−TGMN−−−−−−−−−VKYASD−−−−−KG−−−−−−WAKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IAGIMER                           
fig|526991.3.peg.5720   Bacillus cereus AH676                         QDFINA−−QNQY−−−GVSAHYLAAHAILESG−−−Y−−−−−GKS−−−−EIAY−−−−−−QKHNLFGL−−−−−−−−−R−−−AYDGDPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KYAKYLPSYGDSIAYNANYV−−RERYLEESGMY−−−YNGSTL−−−−TGMN−−−−−−−−−VKYASD−−−−−KG−−−−−−WAKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IAGIMER                           
fig|526969.3.peg.2097   Bacillus cereus m1550                         QDFINA−−QNQY−−−GVSAHYLAAHAILESG−−−Y−−−−−GKS−−−−EIAY−−−−−−QKHNLFGL−−−−−−−−−R−−−AYDGDPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KYAKYLPSYGDSIAYNANYV−−RERYLEESGMY−−−YNGSTL−−−−TGMN−−−−−−−−−VKYASD−−−−−KG−−−−−−WAKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IAGIMER                           
fig|526974.3.peg.1043   Bacillus cereus BDRD-ST24                         QDFINA−−QNQY−−−GVSAHYLAAHAILESG−−−Y−−−−−GKS−−−−EIAY−−−−−−QKHNLFGL−−−−−−−−−R−−−AYDGDPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KYAKYLPSYGDSIAYNANYV−−RERYLEESGMY−−−YNGSTL−−−−TGMN−−−−−−−−−VKYASD−−−−−KG−−−−−−WAKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IAGIMER                           
fig|526982.3.peg.3555   Bacillus cereus Rock1-15                         QDFINA−−QNQY−−−GVSAHYLAAHAILESG−−−Y−−−−−GKS−−−−EIAY−−−−−−QKHNLFGL−−−−−−−−−R−−−AYDGDPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KYAKYLPSYGDSIAYNANYV−−RERYLEESGMY−−−YNGSTL−−−−TGMN−−−−−−−−−VKYASD−−−−−KG−−−−−−WAKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IAGIMER                           
fig|714359.3.peg.2369   Bacillus thuringiensis BMB171                         QDFINA−−QNQY−−−GVSAHYLAAHAILESG−−−Y−−−−−GKS−−−−EIAY−−−−−−QKHNLFGL−−−−−−−−−R−−−AYDGDPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KYAKYLPSYGDSIAYNANYV−−RERYLEESGMY−−−YNGSTL−−−−TGMN−−−−−−−−−VKYASD−−−−−KG−−−−−−WAKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IAGIMER                           
fig|1053238.3.peg.390   Bacillus cereus VD154                         QDFINA−−QNQY−−−GVSAHYLAAHAILESG−−−Y−−−−−GKS−−−−EIAY−−−−−−QKHNLFGL−−−−−−−−−R−−−AYDGDPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KYAKYLPSYGDSIAYNANYV−−RERYLEENGMY−−−YNGPTL−−−−TGMN−−−−−−−−−VKYASD−−−−−KG−−−−−−WAKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IAGIMER                           
fig|405533.4.peg.4068   Bacillus cereus AH1134                         QDFINA−−QNQY−−−GVSAHYLAAHAILESG−−−Y−−−−−GKS−−−−EIAY−−−−−−QKHNLFGL−−−−−−−−−R−−−AYDGDPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KYAKYLPSYGDSIAYNANYV−−RERYLEENGMY−−−YNGPTL−−−−TGMN−−−−−−−−−VKYASD−−−−−KG−−−−−−WAKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IAGIMER                           
fig|526967.3.peg.2701   Bacillus cereus 172560W                         QDFINA−−QNQY−−−GVSAHYLAAHAILESG−−−Y−−−−−GKS−−−−EIAY−−−−−−QKHNLFGL−−−−−−−−−R−−−AYDGDPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KYAKYLPSYGDSIAYNANYV−−RERYLEENGMY−−−YNGPTL−−−−TGMN−−−−−−−−−VKYASD−−−−−KG−−−−−−WAKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IAGIMER                           
fig|405532.4.peg.2266   Bacillus cereus B4264                         QDFINA−−QNQY−−−GVSAHYLAAHAILESG−−−Y−−−−−GKS−−−−EIAY−−−−−−QKHNLFGL−−−−−−−−−R−−−AYDGDPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KYAKYLPSYGDSIAYNANYV−−RERYLEENGMY−−−YNGPTL−−−−TGMN−−−−−−−−−VKYASD−−−−−KG−−−−−−WAKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IAGIMER                           
fig|527019.3.peg.3329   Bacillus thuringiensis IBL 200                         QDFINA−−QNQY−−−GVSAHYLAAHAILESG−−−Y−−−−−GKS−−−−EIAY−−−−−−QKHNLFGL−−−−−−−−−R−−−AYDGDPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KYAKYLPSYGDSIAYNANYV−−RERYLEESGMY−−−YNGPTL−−−−TGMN−−−−−−−−−VKYASD−−−−−KG−−−−−−WAKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IAGIMER                           
fig|527030.3.peg.3857   Bacillus thuringiensis serovar huazhongensis BGSC 4BD1                         QDFINA−−QNQY−−−GVSAHYLAAHAILESG−−−Y−−−−−GKS−−−−EIAY−−−−−−QKHNLFGL−−−−−−−−−R−−−AYDGDPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KYAKYLPSYGDSIAYNANYV−−RERYLEESGMY−−−YNGPTL−−−−TGMN−−−−−−−−−VKYASD−−−−−KG−−−−−−WAKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IAGIMER                           
fig|527026.3.peg.3356   Bacillus thuringiensis serovar sotto str. T04001                         QDFINA−−QNQY−−−GVSAHYLAAHAILESG−−−Y−−−−−GKS−−−−EIAY−−−−−−QKHNLFGL−−−−−−−−−R−−−AYDGDPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KYAKYLPSYGDSIAYNANYV−−RERYLEESGMY−−−YNGPTL−−−−TGMN−−−−−−−−−VKYASD−−−−−KG−−−−−−WAKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IAGIMER                           
fig|405531.7.peg.2343   Bacillus cereus G9842                         QDFINA−−QNQY−−−GVSAHYLAAHAILESG−−−Y−−−−−GKS−−−−EIAY−−−−−−QKHNLFGL−−−−−−−−−R−−−AYDGDPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KYAKYLPSYGDSIAYNANYV−−RERYLEESGMY−−−YNGPTL−−−−TGMN−−−−−−−−−VKYASD−−−−−KG−−−−−−WAKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IAGIMER                           
fig|527020.3.peg.3346   Bacillus thuringiensis IBL 4222                         QDFINA−−QNQY−−−GVSAHYLAAHAILESG−−−Y−−−−−GKS−−−−EIAY−−−−−−QKHNLFGL−−−−−−−−−R−−−AYDGDPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KYAKYLPSYGDSIAYNANYV−−RERYLEESGMY−−−YNGPTL−−−−TGMN−−−−−−−−−VKYASD−−−−−KG−−−−−−WAKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IAGIMER                           
fig|526987.3.peg.1563   Bacillus cereus Rock4-2                         QDFINA−−QNQY−−−GVSAHYLAAHAILESG−−−Y−−−−−GKS−−−−EIAY−−−−−−QKHNLFGL−−−−−−−−−R−−−AYDGDPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KYAKYLPSYGDSIAYNANYV−−RERYLEESGMY−−−YNGPTL−−−−TGMN−−−−−−−−−VKYASD−−−−−KG−−−−−−WAKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IAGIMERIKPFHVEDY                  
fig|526989.3.peg.2250   Bacillus cereus F65185                         QDFINA−−QNQY−−−GVSAHYLAAHAILESG−−−Y−−−−−GKS−−−−EIAY−−−−−−QKHNLFGL−−−−−−−−−R−−−AYDGDPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KYAKYLPSYGDSIAYNANYV−−RERYLEESGMY−−−YNGPTL−−−−TGMN−−−−−−−−−VKYASD−−−−−KG−−−−−−WAKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IAGIMERIKPFHVEDY                  
fig|1053215.3.peg.2949   Bacillus cereus ISP2954                         QDFINA−−QNQY−−−GVSAHYLAAHAILESG−−−Y−−−−−GKS−−−−EIAY−−−−−−QKHNLFGL−−−−−−−−−R−−−AYDGDPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KYAKYLPSYGDSIAYNANYV−−RERYLEESGMY−−−YNGPTL−−−−TGMN−−−−−−−−−VKYASD−−−−−KG−−−−−−WAKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IAGIMERIKPFHVEDY                  
fig|269801.1.peg.1035   Bacillus cereus G9241                         QDFINA−−QNKY−−−GVNAHYLAAHAILESG−−−Y−−−−−GKS−−−−EIAY−−−−−−QKHNLFGL−−−−−−−−−R−−−AYDGDPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KYAKYLPTYGDSIAYNANYV−−RERYLEESGMY−−−YNGPTL−−−−ADMN−−−−−−−−−VKYASD−−−−−KG−−−−−−WAKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IAGIMERIKPFHVEDY                  
fig|269801.5.peg.1037   Bacillus cereus G9241                         QDFINA−−QNKY−−−GVNAHYLAAHAILESG−−−Y−−−−−GKS−−−−EIAY−−−−−−QKHNLFGL−−−−−−−−−R−−−AYDGDPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KYAKYLPTYGDSIAYNANYV−−RERYLEESGMY−−−YNGPTL−−−−ADMN−−−−−−−−−VKYASD−−−−−KG−−−−−−WAKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IAGIMERIKPFHVEDY                  
fig|527028.3.peg.889   Bacillus thuringiensis serovar pulsiensis BGSC 4CC1                         QDFINA−−QNQY−−−GVSAHYLAAHAILESG−−−Y−−−−−GKS−−−−EIAY−−−−−−QKHNLFGL−−−−−−−−−R−−−AYDRDPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KYAKYLPTYGDSIAYNANYV−−RERYLEESGMH−−−YNGPTL−−−−AGMN−−−−−−−−−VKYASD−−−−−KG−−−−−−WAKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IAGIMER                           
fig|527022.3.peg.2028   Bacillus thuringiensis serovar monterrey BGSC 4AJ1                         QDFINA−−QNQY−−−GVNAHYLAAHAILESG−−−Y−−−−−GKS−−−−EIAY−−−−−−QKHNLFGL−−−−−−−−−R−−−AYDRDPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KYAKYLPTYGDSIAYNANYV−−RERYLEESGMH−−−YNGPTL−−−−AGMN−−−−−−−−−VKYASD−−−−−KG−−−−−−WAKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IAGIMER                           
fig|451709.4.peg.5895   Bacillus cereus 03BB108                         QDFINA−−QNQY−−−GVNALYLAAHAILESG−−−Y−−−−−GKS−−−−EIAY−−−−−−RKHNLFGL−−−−−−−−−R−−−AYDKDPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KYAKYLPTYGDSIAYNANYV−−RERYLEEDGMH−−−YNGPTL−−−−DGMN−−−−−−−−−VKYASD−−−−−KG−−−−−−WAGK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IANIMER                           
fig|526990.3.peg.2277   Bacillus cereus AH603                         QDFINA−−QNKY−−−GVNAQYLAAHAILESG−−−Y−−−−−GKS−−−−EIAY−−−−−−RKHNLFGL−−−−−−−−−R−−−AYDKDPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KYAKYLPTYGDSIAYNANYV−−RERYLEEDGMH−−−YNGPTL−−−−DGMN−−−−−−−−−VKYASD−−−−−KG−−−−−−WARK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IANIMER                           
fig|526980.3.peg.1277   Bacillus cereus ATCC 10876                         QDFINA−−QNQY−−−GVNAQYLAAHAILESG−−−Y−−−−−GKS−−−−EIAY−−−−−−RKHNLFGL−−−−−−−−−R−−−AYDKDPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KYAKYLPTYGDSIAYNANYV−−RERYLEEDGMH−−−YNGPTL−−−−AGMN−−−−−−−−−VKYASD−−−−−KG−−−−−−WAGK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IANIMER                           
fig|527026.3.peg.3963   Bacillus thuringiensis serovar sotto str. T04001                         QDFINA−−QNQY−−−GVNAQYLAAHAILESG−−−Y−−−−−GKS−−−−EIAY−−−−−−RKHNLFGL−−−−−−−−−R−−−AYDKDPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KYAKYLPTYGDSIAYNANYV−−RERYLEEDGMH−−−YNGPTL−−−−AGMN−−−−−−−−−VKYASD−−−−−KG−−−−−−WAGK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IANIMER                           
fig|405533.4.peg.5792   Bacillus cereus AH1134                         QDFINA−−QNQY−−−GVNAQYLAAHAILESG−−−Y−−−−−GKS−−−−EIAY−−−−−−RKHNLFGL−−−−−−−−−R−−−AYDKDPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KYAKYLPTYGDSIAYNANYV−−RERYLEEDGMH−−−YNGPTL−−−−AGMN−−−−−−−−−VKYASD−−−−−KG−−−−−−WAGK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IANIMER                           
fig|315749.4.peg.1463   Bacillus cereus subsp. cytotoxis NVH 391-98                            IAA−−QNEH−−−GVNALYLAAHAILESG−−−Y−−−−−GRS−−−−EIAY−−−−−−RKHNLFGL−−−−−−−−−R−−−AYDRDPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YHAKYLPTYRDSISYNANYV−−RERYLEKGAIY−−−YNGPTL−−−−VGMN−−−−−−−−−VKYASD−−−−−PE−−−−−−WAGK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IAGLMER                           
fig|315749.4.peg.3519   Bacillus cereus subsp. cytotoxis NVH 391-98         NFIARYHPDSPLVGHGQDFIEA−−QNNH−−−GVNALYLAAHAILESG−−−Y−−−−−GKS−−−−EIAY−−−−−−RKHNLFGL−−−−−−−−−R−−−AYDWDPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GNAKYLQSYGESIAYNANYV−−RARYLEKTGMY−−−YNGPTL−−−−TGMN−−−−−−−−−VKYATD−−−−−KE−−−−−−WAPK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IANIMER                           
fig|526990.3.peg.3700   Bacillus cereus AH603                            IKA−−QNEY−−−GVNSLYLAAHAILESG−−−Y−−−−−GKS−−−−EIAY−−−−−−RKHNLFGL−−−−−−−−−R−−−AYDWDPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AHAKYLPSYGLSISYNADYV−−RKNYLEQGAKY−−−FKGYTL−−−−PAMN−−−−−−−−−VMYSTD−−−−−KE−−−−−−WAGK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IANIMER                           
fig|1053226.3.peg.3111   Bacillus cereus VD048                            IKA−−QNEY−−−GVNSLYLAAHAILESG−−−Y−−−−−GKS−−−−EIAY−−−−−−RKHNLFGL−−−−−−−−−R−−−AYDWDPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AHAKYLPSYGLSISYNADYV−−RKNYLEQGAKY−−−FKGYTL−−−−PAMN−−−−−−−−−VMYSTD−−−−−KE−−−−−−WAGK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IANIMER                           
fig|1053246.3.peg.1633   Bacillus cereus VDM019                            IKA−−QNEY−−−GVNSLYLAAHAILESG−−−Y−−−−−GKS−−−−EIAY−−−−−−RKHNLFGL−−−−−−−−−R−−−AYDWDPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AHAKYLPSYGLSISYNADYV−−RKNYLEQGAKY−−−FKGYTL−−−−PAMN−−−−−−−−−VMYSTD−−−−−KE−−−−−−WAGK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IANIMER                           
fig|222523.1.peg.1878   Bacillus cereus ATCC 10987                       IGQDFIKA−−QNEY−−−GVNALYLAAHAILESG−−−Y−−−−−GKS−−−−EIAY−−−−−−RKHNLFGL−−−−−−−−−R−−−AYDRDPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AYAKYLPSYGLSISYNADYV−−KKNYLEEGARY−−−FKGYTL−−−−PAMN−−−−−−−−−VMYSTD−−−−−TA−−−−−−WAGK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IANIMER                           
fig|527024.3.peg.3005   Bacillus thuringiensis serovar tochigiensis BGSC 4Y1                       IGQDFIKA−−QNEY−−−GVNALYLAAHAILESG−−−Y−−−−−GKS−−−−EIAY−−−−−−RKHNLFGL−−−−−−−−−R−−−AYDRDPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AYAKYLPSYGLSISYNADYV−−KKNYLEDGARY−−−FKGYTL−−−−PAMN−−−−−−−−−VMYSTD−−−−−TA−−−−−−WAGK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IANIMER                           
fig|526977.3.peg.1386   Bacillus cereus ATCC 4342                       IGQDFIKA−−QNEY−−−GVNALYLAAHAILESG−−−Y−−−−−GKS−−−−EIAY−−−−−−RKHNLFGL−−−−−−−−−R−−−AYDRDPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AYAKYLPSYGLSISYNADYV−−KKNYLEDSARY−−−FKGYTL−−−−PAMN−−−−−−−−−VMYSTD−−−−−TA−−−−−−WAGK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IANIMER                           
fig|526976.3.peg.4146   Bacillus cereus BDRD-ST196                         QDFIKA−−QNEY−−−GVNSLYLAAHAILESG−−−Y−−−−−GKS−−−−EIAY−−−−−−RKHNLFGL−−−−−−−−−R−−−AYDWDPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AHAKYLPSYGLSISYNADYV−−RKNYLEQGAKY−−−FKGYTL−−−−PAMN−−−−−−−−−VMYSTD−−−−−KE−−−−−−WAGK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IANIMER                           
fig|526993.3.peg.5619   Bacillus cereus AH1272                            IKA−−QNEY−−−GVNSLYLAAHAILESG−−−Y−−−−−GKS−−−−EIAY−−−−−−RKHNLFGL−−−−−−−−−R−−−AYDWDPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AHAKYLPSYGLSISYNADYV−−RKNYLEQGAKY−−−FNGYTL−−−−PAMN−−−−−−−−−VMYSTD−−−−−KE−−−−−−WAGK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IANIMER                           
fig|526973.3.peg.3153   Bacillus cereus m1293     QEIDNFIKKSHPDSPLVGNGKDFIQA−−QNEY−−−GVSALYLAAHAILESG−−−Y−−−−−GKS−−−−EIAY−−−−−−RKHNLFGL−−−−−−−−−K−−−AFDWEPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ANAKYLPSYAQSISYNADYV−−RKNYLEEGADH−−−FHGYTL−−−−PAMN−−−−−−−−−EKYATD−−−−−KE−−−−−−WAGK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IANIMER                           
fig|1053214.3.peg.5103   Bacillus cereus IS845/00     QEIDNFIKKSHPDSPLVGNGKDFIQA−−QNEY−−−GVSALYLAAHAILESG−−−Y−−−−−GKS−−−−EIAY−−−−−−RKHNLFGL−−−−−−−−−K−−−AFDWEPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ANAKYLPSYAQSISYNADYV−−RKNYLEEGADH−−−FHGYTL−−−−PAMN−−−−−−−−−EKYATD−−−−−KE−−−−−−WAGK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IANIMER                           
fig|526992.3.peg.5244   Bacillus cereus AH1271                            VQA−−QNEY−−−GVSALYLAAHAILESG−−−Y−−−−−GKS−−−−EIAY−−−−−−RKHNLFGL−−−−−−−−−K−−−AFDWDPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AYAKYLPSYKESISYNADYV−−RKNYLEKGADH−−−FNGYTL−−−−PAMN−−−−−−−−−IKYATD−−−−−KA−−−−−−WAGK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IANIMER                           
fig|572264.4.peg.1702   Bacillus cereus 03BB102                            IQA−−QNEY−−−GVSALYLAAHAILESG−−−Y−−−−−GKS−−−−EIAY−−−−−−RKHNLFGL−−−−−−−−−R−−−AYDRDPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AYAKYLPSYKDSISYNADYV−−RKNYLEKGADH−−−FNGYTL−−−−PAMN−−−−−−−−−IKYATD−−−−−KE−−−−−−WAGK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IANLMER                           
fig|288681.15.peg.1711   Bacillus cereus E33L                            IQA−−QNEY−−−GVSALYLAAHAILESG−−−Y−−−−−GKS−−−−EIAY−−−−−−RKHNLFGL−−−−−−−−−R−−−AYDRDPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AYAKYLPSYKDSISYNADYV−−RKNYLEKGADH−−−FNGYTL−−−−PAMN−−−−−−−−−IKYATD−−−−−KE−−−−−−WAGK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IANLMER                           
fig|269801.1.peg.1262   Bacillus cereus G9241                            IQA−−QNEY−−−GVSALYLAAHAILESG−−−Y−−−−−GKS−−−−EIAY−−−−−−RKHNLFGL−−−−−−−−−R−−−AYDRDPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AYAKYLPSYKDSISYNADYV−−RKNYLEKGADH−−−FNGYTL−−−−PAMN−−−−−−−−−IKYATD−−−−−KE−−−−−−WAGK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IANLMER                           
fig|269801.5.peg.1284   Bacillus cereus G9241                            IQA−−QNEY−−−GVSALYLAAHAILESG−−−Y−−−−−GKS−−−−EIAY−−−−−−RKHNLFGL−−−−−−−−−R−−−AYDRDPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AYAKYLPSYKDSISYNADYV−−RKNYLEKGADH−−−FNGYTL−−−−PAMN−−−−−−−−−IKYATD−−−−−KE−−−−−−WAGK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IANLMER                           
fig|527029.3.peg.689   Bacillus thuringiensis serovar pondicheriensis BGSC 4BA1                         QDFIQA−−QNEY−−−GVSALYLAAHAILESG−−−Y−−−−−GKS−−−−EIAY−−−−−−RKHNLFGL−−−−−−−−−R−−−AYDRDPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AYAKYLPSYKDSISYNADYV−−RKNYLEKGADH−−−FNGYTL−−−−PAMN−−−−−−−−−IKYATD−−−−−KE−−−−−−WAGK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IANLMER                           
fig|526985.3.peg.3638   Bacillus cereus Rock3-42                            IQA−−QNEY−−−GVSALYLAAHAILESG−−−Y−−−−−GKS−−−−EIAY−−−−−−RKHNLFGL−−−−−−−−−R−−−AYDRDPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AYAKYLPSYKDSISYNADYV−−RKNYLEKGADH−−−FNGYTL−−−−PAMN−−−−−−−−−IKYATD−−−−−KE−−−−−−WAGK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IANIMER                           
fig|405917.4.peg.1456   Bacillus cereus W     QEIDNFIEKWHPDSPLIGTGQDFIQA−−QNEY−−−GVSALYLAAHAILESA−−−Y−−−−−GKS−−−−EIAY−−−−−−RKHNLFGL−−−−−−−−−R−−−AYDRDPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AYAKYLPSYKDSISYNADYV−−RKNYLEKGADH−−−FNGYTL−−−−PAMN−−−−−−−−−IKYATD−−−−−KE−−−−−−WAGK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IANIMER                           
fig|347495.3.peg.1673   Bacillus cereus F837/76                            IQA−−QNEY−−−GVSALYLAAHAILESA−−−Y−−−−−GKS−−−−EIAY−−−−−−RKHNLFGL−−−−−−−−−R−−−AYDRDPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AYAKYLPSYKESISYNADYV−−RKNYLEKGADH−−−FNGYTL−−−−PAMN−−−−−−−−−IKYATD−−−−−KE−−−−−−WAGK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IANLMER                           
fig|451709.4.peg.2613   Bacillus cereus 03BB108                            IQA−−QNEY−−−GVSALYLAAHAILESA−−−Y−−−−−GKS−−−−EIAY−−−−−−RKHNLFGL−−−−−−−−−R−−−AYDRDPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AYAKYLPSYKESISYNADYV−−RKNYLEKGADH−−−FNGYTL−−−−PAMN−−−−−−−−−IKYATD−−−−−KE−−−−−−WAGK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IANLMER                           
fig|486622.3.peg.1358   Bacillus anthracis str. A0174     QEIDNFIEKWHPDSPLIGTGQDFIQA−−QNEY−−−GVSALYLAAHAILGSA−−−Y−−−−−GKS−−−−EMAY−−−−−−RRHNLFGL−−−−−−−−−R−−−AYDRDPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AYAKYLPSYKQSISYNADYV−−RKNYLEEGANH−−−FNGYTL−−−−PAMN−−−−−−−−−EKYATD−−−−−KE−−−−−−WAGK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IANIMER                           
fig|527022.3.peg.4240   Bacillus thuringiensis serovar monterrey BGSC 4AJ1     QEIDNFIEKWHPDSPLIGTGQDFIQA−−QNEY−−−GVSALYLAAHAILESA−−−Y−−−−−GKS−−−−EIAY−−−−−−RKHNLFGL−−−−−−−−−R−−−AYDRDPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AYAKYLPSYKQSISYNADYV−−RKNYLEEGANH−−−FNGYTL−−−−PAMN−−−−−−−−−EKYATD−−−−−KE−−−−−−WAGK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IANIMER                           
fig|527028.3.peg.2866   Bacillus thuringiensis serovar pulsiensis BGSC 4CC1     QEIDNFIEKWHPDSPLIGTGQDFIQA−−QNEY−−−GVSALYLAAHAILESA−−−Y−−−−−GKS−−−−EIAY−−−−−−RKHNLFGL−−−−−−−−−R−−−AYDRDPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AYAKYLPSYKQSISYNADYV−−RKNYLEEGANH−−−FNGYTL−−−−PAMN−−−−−−−−−EKYATD−−−−−KE−−−−−−WAGK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IANIMER                           
fig|405535.8.peg.1803   Bacillus cereus AH820     QEIDNFIEKWHPDSPLIGTGQDFIQA−−QNEY−−−GVSALYLAAHAILESA−−−Y−−−−−GKS−−−−EIAY−−−−−−RKHNLFGL−−−−−−−−−R−−−AYDRDPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AYAKYLPSYKQSISYNADYV−−RKNYLEEGANH−−−FNGYTL−−−−PAMN−−−−−−−−−EKYATD−−−−−KE−−−−−−WAGK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IANIMER                           
fig|526986.3.peg.4063   Bacillus cereus Rock3-44                            VAA−−QAKY−−−GVNALYLAAHAILESG−−−Y−−−−−GKS−−−−EIAY−−−−−−RKHNLFGL−−−−−−−−−R−−−AYDWDPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KHAKYLPTFGDSIAYNADYV−−RDKYLEENGEY−−−YYGPTL−−−−QGMN−−−−−−−−−VMYSTD−−−−−QE−−−−−−WSDK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IAKIMER                           
fig|562970.4.peg.347   Bacillus tusciae DSM 2912     QEIDQFIREHHPDSPLVGMGNAFVQA−−GQQY−−−GVNAQYLAAHAILESG−−−W−−−−−GLS−−−−SIAL−−−−−−DKKNLFGY−−−−−−−−−G−−−AYDGDPY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NAAATFASYEDSIRFIAYFV−−RHQYLDSGGRW−−−YGGSPTL−−−−DGMN−−−−−−−−−VHYATD−−−−−PD−−−−−−WAEK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IAALMEQ                           
fig|655813.3.peg.501   Streptococcus oralis ATCC 35037                             EA−−EERY−−−GVNALYLMAHSALESA−−−W−−−−−GRS−−−−QIAR−−−−−−DKNNFFGI−−−−−−−−−A−−−AYDTSPY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LSAKSFDNVDKGILGAAKWI−−RENYID−−−−−−−−YGRDHLGNKATGMN−−−−−−−−−VRYASD−−−−−PY−−−−−−WGEK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IASIMMTIN                         
fig|334413.6.peg.848   Finegoldia magna ATCC 29328                        AHSFIKV−−EKKY−−−GVNALYLLAIANHESD−−−F−−−−−GQS−−−−RIAK−−−−−−DKNNLFGF−−−−−−−−−N−−−AIDSNPY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NGASQYDSLDEGIQDIGKKI−−KILYLSDNGKY−−−FKG−−−−−YNSYAMN−−−−−−−−−KNYASD−−−−−KN−−−−−−WGEK−−−−−−−−−−−−−−−−−−−−−−−−−−−−VNN                               
fig|525282.5.peg.927   Finegoldia magna ATCC 53516                        AHSFIKV−−EKKY−−−GVNALYLLAIANHESD−−−F−−−−−GQS−−−−RIAK−−−−−−DKNNLFGF−−−−−−−−−N−−−AVDSDPY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NGASQYDSLDEGIQDIGKKI−−KILYLSDNGKY−−−FKG−−−−−YNSYAMN−−−−−−−−−KNYASD−−−−−KN−−−−−−WGEK−−−−−−−−−−−−−−−−−−−−−−−−−−−−VNN                               
fig|525919.4.peg.730   Anaerococcus prevoti prevotii DSM 20548                             DV−−SEKY−−−GINPLLLMAMAKHETG−−−N−−−−−GTS−−−−DLFR−−−−−−EKNNLFGF−−−−−−−−−N−−−AIDHDPY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NMASKFKDPKDSIDTVAKHL−−KEEYLDKNGTY−−−FNG−−−−−VSAKGIG−−−−−−−−−TSYASD−−−−−PE−−−−−−WSQK−−−−−−−−−−−−−−−−−−−−−−−−−−−−VNSMM                             
fig|525255.3.peg.567   Anaerococcus tetradius ATCC 35098                       LGKDFKAV−−ADKY−−−GINPLLLMAMAKHETG−−−N−−−−−GTS−−−−ELFR−−−−−−EKNNLFGF−−−−−−−−−N−−−AIDHDPY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NMATKFKRPKDSIDTVAKHL−−KEEYLDKNGTY−−−FNG−−−−−VSAEGIG−−−−−−−−−SSYASD−−−−−PD−−−−−−WSKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−VNSMM                             
fig|262543.4.peg.950   Exiguobacterium sibiricum 255-15         AYIKKNAPDSPLIGKGKTFKQV−−ERTY−−−RINAAYLLAHAIHESD−−−Y−−−−−GRS−−−−DIAK−−−−−−DKFNLFGV−−−−−−−−−N−−−ATDIAPG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QNATSYDSFEDSIRKTGRFI−−ARDYLSKDGKY−−−YRGPFLGNKARGMN−−−−−−−−−VFYASD−−−−−PY−−−−−−WSEK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IAGIL                             
fig|262543.8.peg.963   Exiguobacterium sibiricum 255-15         AYIKKNAPDSPLIGKGKTFKQV−−ERTY−−−RINAAYLLAHAIHESD−−−Y−−−−−GRS−−−−DIAK−−−−−−DKFNLFGV−−−−−−−−−N−−−ATDIAPG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QNATSYDSFEDSIRKTGRFI−−ARDYLSKDGKY−−−YRGPFLGNKARGMN−−−−−−−−−VFYASD−−−−−PY−−−−−−WSEK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IAGIL                             
fig|420246.5.peg.2976   Geobacillus thermodenitrificans NG80-2                 QSPLKELGTAFKQA−−EEKY−−−QVNALYLLAQAILESN−−−W−−−−−GLS−−−−QLAQ−−−−−−TKNNLFGI−−−−−−−−−K−−−AYDSDPL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NSADSFKSFEECIDYMAKTIV−−AGRYANPSDW−−RYNGAVLGDKSVGFN−−−−−−−−−VRYASD−−−−−PY−−−−−−WGQK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IAGWMYQADQF                       
fig|420246.7.peg.3263   Geobacillus thermodenitrificans NG80-2                 QSPLKELGTAFKQA−−EEKY−−−QVNALYLLAQAILESN−−−W−−−−−GLS−−−−QLAQ−−−−−−TKNNLFGI−−−−−−−−−K−−−AYDSDPL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NSADSFKSFEECIDYMAKTIV−−AGRYANPSDW−−RYNGAVLGDKSVGFN−−−−−−−−−VRYASD−−−−−PY−−−−−−WGQK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IAGWMYQADQF                       
fig|471223.3.peg.3252   Geobacillus sp. WCH70                    LKTLGEAFKKT−−EEKY−−−NVNALYLLAHAIHESD−−−W−−−−−GTS−−−−EIAK−−−−−−EKKNLFGI−−−−−−−−−R−−−AVDSDPL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NSAVKFNTFEDCINYMAQTIV−−SNRYANPKDW−−RYSGAVLGDKTIGFN−−−−−−−−−VRYASD−−−−−PY−−−−−−WGQK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IAGIMYRADKF                       
fig|553973.6.peg.1732   Clostridium hylemonae DSM 15053                          QFVNQ−−QNTY−−−GINALVMTGIAANESG−−−W−−−−−GTS−−−−SISQ−−−−−−SNNNLFGL−−−−−−−−−N−−−AVDSSPG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TSANKYSSVDECIRQFANGWM−−SRGYVYPKDS−−RYRGGFLGNKASGLN−−−−−−−−−VKYASD−−−−−PF−−−−−−WGEK−−−−−−−−−−−−−−−−−−−−−−−−−−−−AAGVMYSLD                         
fig|445974.6.peg.565   Clostridium ramosum DSM 1402                                 QNKY−−−GVNALMAASFAALESG−−−W−−−−−GKS−−−−SIAQ−−−−−−NKNNLFGM−−−−−−−−−N−−−ATDANPS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EDAKKYSSVEACIEDFASNWM−−SKKYLNGTYTS−−LFRGGYFGDKGSGIF−−−−−−−−−GKYSSD−−−−−PY−−−−−−EGEK−−−−−−−−−−−−−−−−−−−−−−−−−−−−CASIAENMD                         
fig|451755.5.peg.2375   Clostridium perfringens E str. JGS1987                        GEYFIEA−−QNKY−−−GVNALIMLGIAINESA−−−W−−−−−GTS−−−−YYAR−−−−−−NKNNLFGI−−−−−−−−−G−−−AVDSNP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DDAFYFESVEQCINEFAKYQM−−SRGYSDPYNW−−SYNGAALGNKGFGAN−−−−−−−−−IQYASD−−−−−PF−−−−−−WGEK                                                              
fig|289380.14.peg.570   Clostridium perfringens SM101                        GEYFIEA−−QNKY−−−GVNALIMLGIAINESA−−−W−−−−−GTS−−−−YYAR−−−−−−NKNNLFGI−−−−−−−−−G−−−AVDSNP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DDAFYFESVEQCINEFAKYQM−−SRGYSDPYNW−−SYNGAALGNKGFGAN−−−−−−−−−IQYASD−−−−−PF−−−−−−WGEK                                                              
fig|428127.7.peg.1702   Eubacterium dolichum DSM 3991                              A−−QNTY−−−GVNAGLMWAVSINESG−−−W−−−−−GLS−−−−QLSL−−−−−−ERNNLFGH−−−−−−−−−K−−−AYDSNV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GAAERYNSVLDCVNTHAKTYI−−SSGYLDPTDY−−RYRGPHLGDKQSGIN−−−−−−−−−VKYASD−−−−−PY−−−−−−WGEK                                                              
fig|518637.5.peg.96   Eubacterium biforme DSM 3989                                 QNKY−−−GVNALMMYSNAVLESG−−−W−−−−−GQS−−−−QIAM−−−−−−DKNNLFGH−−−−−−−−−G−−−AADNNPY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YGANGYSSVDDCIQYHAKVFI−−SESYCDPKDYIGRYYGSHLGDKESGIN−−−−−−−−−VKYASD−−−−−PY−−−−−−WGEK−−−−−−−−−−−−−−−−−−−−−−−−−−−−IASL                              
fig|526968.3.peg.1015   Bacillus cereus R309803                             EV−−ESKY−−−NVNALFLYSLAAHESQ−−−Y−−−−−GTS−−−−ELAR−−−−−−DKNNLFGL−−−−−−−−−N−−−ATDNNPF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GNGKKFDSKEDCIEDAAKVYM−−NEWYLNPGHW−−RYTAAYTGDKSGGIN−−−−−−−−−MNYASD−−−−−AN−−−−−−WGKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−VAGHMFRFD                         
fig|315730.11.peg.1358   Bacillus weihenstephanensis KBAB4         SYVKSIKPDSPLIGLGKKFKEV−−ESKY−−−NVNALFLYSLAVHESY−−−Y−−−−−GTS−−−−ALAK−−−−−−DKNNLFGL−−−−−−−−−K−−−ATDDSPY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GNGEAFNSKEDCIEHAAKVYM−−NEGYLNPGHW−−RYTATYTGDKAAGLN−−−−−−−−−AKYASD−−−−−AN−−−−−−WGKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−VAGHMNRFD                         
fig|526980.3.peg.1720   Bacillus cereus ATCC 10876         SYVKSIKPDSPLIGLGKKFKEV−−ESKY−−−NVNALFLYSLAIHESY−−−Y−−−−−GTS−−−−ALAK−−−−−−DKNNLFGL−−−−−−−−−K−−−ATDDSPY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GNGEAFNSKEDCIEHAAQLYM−−NEGYLNPGHW−−RYTATYTGDKAAGLN−−−−−−−−−AKYASD−−−−−AN−−−−−−WGKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−VAGHMNRFD                         
fig|526982.3.peg.2027   Bacillus cereus Rock1-15         SYVKSIKPDSPLIGLGKKFKEV−−ESKY−−−NVNALFLYSLAIHESY−−−Y−−−−−GTS−−−−ALAK−−−−−−DKNNLFGL−−−−−−−−−K−−−ATDDSPY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GNGEAFNSKEDCIEHAAKLYM−−NEGYLNPGHW−−RYTATYTGDKAAGLN−−−−−−−−−AKYASD−−−−−AN−−−−−−WGKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−VAGHMNRFD                         
fig|714359.3.peg.812   Bacillus thuringiensis BMB171         SYVKSIKPDSPLIGLGKKFKEV−−ESKY−−−NVNALFLYSLAIHESY−−−Y−−−−−GTS−−−−ALAK−−−−−−DKNNLFGL−−−−−−−−−K−−−ATDDSPY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GNGEAFNSKEDCIEHAAKLYM−−NEGYLNPGHW−−RYTATYTGDKAAGLN−−−−−−−−−AKYASD−−−−−AN−−−−−−WGKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−VAGHMNRFD                         
fig|1053238.3.peg.3114   Bacillus cereus VD154         SYVKSIKPDSPLIGLGKKFKEV−−ESKY−−−NVNALFLYSLAIHESY−−−Y−−−−−GTS−−−−ALAK−−−−−−DKNNLFGL−−−−−−−−−K−−−ATDDSPY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GNGEAFNSKEDCIEHAAKLYM−−NEGYLNPGHW−−RYTATYTGDKAAGLN−−−−−−−−−AKYASD−−−−−AN−−−−−−WGKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−VAGHMNRFD                         
fig|1053215.3.peg.1050   Bacillus cereus ISP2954         SYVKSIKPDSPLIGLGKKFKEV−−ESKY−−−NVNALFLYSLAIHESY−−−Y−−−−−GTS−−−−ALAK−−−−−−DKNNLFGL−−−−−−−−−K−−−ATDDSPY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GNGEAFNSKEDCIEHAAKLYM−−NEGYLNPGHW−−RYTATYTGDKAAGLN−−−−−−−−−AKYASD−−−−−AN−−−−−−WGKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−VAGHMNRFD                         
fig|405533.4.peg.546   Bacillus cereus AH1134         SYVKSIKPDSPLIGLGKKFKEV−−ESKY−−−NVNALFLYSLAIHESY−−−Y−−−−−GTS−−−−ALAK−−−−−−DKNNLFGL−−−−−−−−−K−−−ATDDSPY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GNGEAFNSKEDCIEHAAKLYM−−NEGYLNPGHW−−RYTATYTGDKAAGLN−−−−−−−−−AKYASD−−−−−AN−−−−−−WGKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−VAGHMNRFD                         
fig|526967.3.peg.1150   Bacillus cereus 172560W         SYVKSIKPDSPLIGLGKKFKEV−−ESKY−−−NVNALFLYSLAIHESY−−−Y−−−−−GTS−−−−ALAK−−−−−−DKNNLFGL−−−−−−−−−K−−−ATDDSPY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GNGEAFNSKEDCIEHAAKLYM−−NEGYLNPGHW−−RYTATYTGDKAAGLN−−−−−−−−−AKYASD−−−−−AN−−−−−−WGKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−VAGHMNRFD                         
fig|526991.3.peg.3767   Bacillus cereus AH676         SYVKSIKPDSPLIGLGKKFKEV−−ESKY−−−NVNALFLYSLAIHESY−−−Y−−−−−GTS−−−−ALAK−−−−−−DKNNLFGL−−−−−−−−−K−−−ATDDSPY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GNGEAFNSKEDCIEHAAKLYM−−NEGYLNPGHW−−RYTATYTGDKAAGLN−−−−−−−−−AKYASD−−−−−AN−−−−−−WGKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−VAGHMNRFD                         
fig|665957.3.peg.3339   Bacillus sp. 7_6_55CFAA_CT2         SYVKSIKPDSPLIGLGKKFKEV−−ESKY−−−NVNALFLYSLAIHESY−−−Y−−−−−GTS−−−−ALAK−−−−−−DKNNLFGL−−−−−−−−−K−−−ATDDSPY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GNGEAFNSKEDCIEHAAKLYM−−NEGYLNPGHW−−RYTATYTGDKAAGLN−−−−−−−−−AKYASD−−−−−AN−−−−−−WGKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−VAGHMNRFD                         
fig|526989.3.peg.2420   Bacillus cereus F65185         SYVKSIKPDSPLIGLGKKFKEV−−ESKY−−−NVNALFLYSLAIHESY−−−Y−−−−−GTS−−−−ALAK−−−−−−DKNNLFGL−−−−−−−−−K−−−ATDDSPY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GNGEAFNSKEDCIEHAAKLYM−−NEGYLNPGHW−−RYTATYTGDKAAGLN−−−−−−−−−AKYASD−−−−−AN−−−−−−WGKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−VAGHMNRFD                         
fig|527019.3.peg.1611   Bacillus thuringiensis IBL 200         SYVKSIKPDSPLIGLGKKFKEV−−ESKY−−−NVNALFLYSLAIHESY−−−Y−−−−−GTS−−−−ALAK−−−−−−DKNNLFGL−−−−−−−−−K−−−ATDDSPY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GNGEAFNSKEDCIEHAAKLYM−−NEGYLNPGHW−−RYTATYTGDKAAGLN−−−−−−−−−AKYASD−−−−−AN−−−−−−WGKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−VAGHMNRFD                         
fig|526987.3.peg.73   Bacillus cereus Rock4-2         SYVKSIKPDSPLIGLGKKFKEV−−ESKY−−−NVNALFLYSLAIHESY−−−Y−−−−−GTS−−−−ALAK−−−−−−DKNNLFGL−−−−−−−−−K−−−ATDDSPY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GNGEAFNSKEDCIEHAAKLYM−−NEGYLNPGHW−−RYTATYTGDKAAGLN−−−−−−−−−AKYASD−−−−−AN−−−−−−WGKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−VAGHMNRFD                         
fig|527021.3.peg.3028   Bacillus thuringiensis Bt407         SYVKSIKPDSPLIGLGKKFKEV−−ESKY−−−NVNALFLYSLAIHESY−−−Y−−−−−GTS−−−−ALAK−−−−−−DKNNLFGL−−−−−−−−−K−−−ATDDSPY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GNGEAFNSKEDCIEHAAKLYM−−NEGYLNPGHW−−RYTATYTGDKAAGLN−−−−−−−−−AKYASD−−−−−AN−−−−−−WGKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−VAGHMNRFD                         
fig|526974.3.peg.1393   Bacillus cereus BDRD-ST24         SYVKSIKPDSPLIGLGKKFKEV−−ESKY−−−NVNALFLYSLAIHESY−−−Y−−−−−GTS−−−−ALAK−−−−−−DKNNLFGL−−−−−−−−−K−−−ATDDSPY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GNGEAFNSKEDCIEHAAKLYM−−NEGYLNPGHW−−RYTATYTGDKAAGLN−−−−−−−−−AKYASD−−−−−AN−−−−−−WGKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−VAGHMNRFD                         
fig|226900.1.peg.794   Bacillus cereus ATCC 14579         SYVKSIKPDSPLIGLGKKFKEV−−ESKY−−−NVNALFLYSLAIHESY−−−Y−−−−−GTS−−−−ALAK−−−−−−DKNNLFGL−−−−−−−−−K−−−ATDDSPY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GNGEAFNSKEDCIEHAAKLYM−−NEGYLNPGHW−−RYTATYTGDKAAGLN−−−−−−−−−AKYASD−−−−−AN−−−−−−WGKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−VAGHMNRFD                         
fig|226900.8.peg.840   Bacillus cereus ATCC 14579         SYVKSIKPDSPLIGLGKKFKEV−−ESKY−−−NVNALFLYSLAIHESY−−−Y−−−−−GTS−−−−ALAK−−−−−−DKNNLFGL−−−−−−−−−K−−−ATDDSPY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GNGEAFNSKEDCIEHAAKLYM−−NEGYLNPGHW−−RYTATYTGDKAAGLN−−−−−−−−−AKYASD−−−−−AN−−−−−−WGKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−VAGHMNRFD                         
fig|405532.4.peg.801   Bacillus cereus B4264         SYVKSIKPDSPLIGLGKKFKEV−−ESKY−−−NVNALFLYSLAIHESY−−−Y−−−−−GTS−−−−ALAK−−−−−−DKNNLFGL−−−−−−−−−K−−−ATDDSPY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GNGEAFNSKEDCIEHAAKLYM−−NEGYLNPGHW−−RYTATYTGDKAAGLN−−−−−−−−−AKYASD−−−−−AN−−−−−−WGKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−VAGHMNRFD                         
fig|526969.3.peg.502   Bacillus cereus m1550         SYVKSIKPDSPLIGLGKKFKEV−−ESKY−−−NVNALFLYSLAIHESY−−−Y−−−−−GTS−−−−ALAK−−−−−−DKNNLFGL−−−−−−−−−K−−−ATDDSPY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GNGEAFNSKEDCIEHAAKLYM−−NEGYLNPGHW−−RYTATYTGDKAAGLN−−−−−−−−−AKYASD−−−−−AN−−−−−−WGKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−VAGHMNRFD                         
fig|527030.3.peg.1722   Bacillus thuringiensis serovar huazhongensis BGSC 4BD1         SYVKSIKPDSPLIGLGKKFKEV−−ESKY−−−NVNALFLYSLAIHESY−−−Y−−−−−GTS−−−−ALAK−−−−−−DKNNLFGL−−−−−−−−−K−−−ATDDSPY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GNGEAFNSKEDCIEHAAKLYM−−NEGYLNPGHW−−RYTATYTGDKAAGLN−−−−−−−−−AKYASD−−−−−AN−−−−−−WGKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−VAGHMNRFD                         
fig|405531.7.peg.796   Bacillus cereus G9842         SYVKSIKPDSPLIGLGKKFKEV−−ESKY−−−NVNALFLYSLAIHESY−−−Y−−−−−GTS−−−−ALAK−−−−−−DKNNLFGL−−−−−−−−−K−−−ATDDSPY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GNGEAFNSKEDCIEHAAKLYM−−NEGYLNPGHW−−RYTATYTGDKAAGLN−−−−−−−−−AKYASD−−−−−AN−−−−−−WGKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−VAGHMNRFD                         
fig|527020.3.peg.4285   Bacillus thuringiensis IBL 4222         SYVKSIKPDSPLIGLGKKFKEV−−ESKY−−−NVNALFLYSLAIHESY−−−Y−−−−−GTS−−−−ALAK−−−−−−DKNNLFGL−−−−−−−−−K−−−ATDDSPY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GNGEAFNSKEDCIEHAAKLYM−−NEGYLNPGHW−−RYTATYTGDKAAGLN−−−−−−−−−AKYASD−−−−−AN−−−−−−WGKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−VAGHMNRFD                         
fig|527026.3.peg.4442   Bacillus thuringiensis serovar sotto str. T04001         SYVKSIKPDSPLIGLGKKFKEV−−ESKY−−−NVNALFLYSLAIHESY−−−Y−−−−−GTS−−−−ALAK−−−−−−DKNNLFGL−−−−−−−−−K−−−ATDDSPY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GNGEAFNSKEDCIEHAAKLYM−−NEGYLNPGHW−−RYTATYTGDKAAGLN−−−−−−−−−AKYASD−−−−−AN−−−−−−WGKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−VAGHMNRFD                         
fig|345219.8.peg.937   Bacillus coagulans 36D1                             KA−−AKQN−−−GINEIYLIAHALLETG−−−N−−−−−GTS−−−−QLANGVKYNGKTVYNMYGTGANDGNAVQN−−−−−−−−−−−−−−−−−−−−GAR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−Y−−−−−−−−−−−−−−−−−−−−−−−−−−−AYQHGWTTPEAAIIGGAKFISSNYLGAGQDTLYKMRW−−−−−−−−NPDVAATYGYAS−−−HQYATD−−−−−IG−−−−−−WAYK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QVDKIYNLYN                      
fig|471855.5.peg.1873   Slackia heliotrinireducens DSM 20476                       MVEAALEC−−QEQY−−−GHPAGCTLAQIICESG−−−−−−−−−−QGDHLSGLAT−−−−−−QDNNLFGI−−−−−−−−−K−−−W−−−−−−−−AASFASCPEVSGKSSWSTGEE−−−−−−−−−−−−−−−−−−−−−−−−−−−−YGGEYVTIM−−−−−−−−−−−−−−−−−ADFTSFRSHRDCIVFRSRVLL−−QSDRYAGNELIQRAIAE−−−−−HDSDLMAEGLKD−−−AGYATS−−−−−SV−−−−−−YVES−−−−−−−−−−−−−−−−−−−−−−−−−−−−LKSVMDTYGLRRFD                    
fig|471855.4.peg.825   Slackia heliotrinireducens DSM 20476                       MVEAALEC−−QEQY−−−GHPAGCTLAQIICESG−−−−−−−−−−QGDHLSGLAT−−−−−−QDNNLFGI−−−−−−−−−K−−−W−−−−−−−−AASFASCPEVSGKSSWSTGEE−−−−−−−−−−−−−−−−−−−−−−−−−−−−YGGEYVTIM−−−−−−−−−−−−−−−−−ADFTSFRSHRDCIVFRSRVLL−−QSDRYAGNELIQRAIAE−−−−−HDSDLMAEGLKD−−−AGYATS−−−−−SV−−−−−−YVES−−−−−−−−−−−−−−−−−−−−−−−−−−−−LKSVMDTYGLRRFD                    
fig|479437.5.peg.1556   Eggerthella lenta DSM 2243                      EMVEEALAC−−QEEY−−−GHPAGCTIAQIIVESG−−−−−−−−−−QGDHLSGLAT−−−−−−QDHNLFGM−−−−−−−−−K−−−W−−−−−−−−SSSYALCEEVAGKSSWRTGEE−−−−−−−−−−−−−−−−−−−−−−−−−−−−YGGEQVTIT−−−−−−−−−−−−−−−−−ADFISFVGDAECIRFRSRVFL−−QADRYASNALIREAIAN−−−−−HDSDKMAEGLKD−−−AGWATS−−−−−SS−−−−−−YVES−−−−−−−−−−−−−−−−−−−−−−−−−−−−LKSTMETYNLYRFD                    
fig|411903.6.peg.613   Collinsella aerofaciens ATCC 25986                      EMVEAALEC−−QEEY−−−GHPAGCTIAQIIQESG−−−−−−−−−−QGDRMSRLAE−−−−−−RDHNLFGM−−−−−−−−−K−−−W−−−−−−−−WSGYAGCPEVAGKANWATSEE−−−−−−−−−−−−−−−−−−−−−−−−−−−−YVPGEHTQIT−−−−−−−−−−−−−−−−−ASFIRFTGDAECIRFRSRVFL−−QAERYSGNALIREAIER−−−−−HDSDRMAEGLKD−−−AGWATD−−−−−SS−−−−−−YVES−−−−−−−−−−−−−−−−−−−−−−−−−−−−LKSIMAQWGLYRLD                    
fig|479437.5.peg.821   Eggerthella lenta DSM 2243                      EMVEAALEA−−QEDY−−−GHPAGCTIAQIIVESG−−−−−−−−−−QGDHMSRLAT−−−−−−RDHNLFGM−−−−−−−−−K−−−W−−−−−−−−APSFAAAPEVAGKANWVTGEE−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDGAHVTIT−−−−−−−−−−−−−−−−−DSFTVFKSDADSIKFRSRVFL−−ASSTYSGNALIGEAVSE−−−−−RSSDKMAEGLKD−−−AGWATD−−−−−SA−−−−−−YVEK−−−−−−−−−−−−−−−−−−−−−−−−−−−−LKAVMDQYGLRAFD                    
fig|411470.6.peg.1970   Ruminococcus gnavus ATCC 29149                             AV−−QEES−−−GIPVSTGVAQVIAESGFGLYGPGGDNGQGLSQLAY−−−−−−EYKNLFGI−−−−−−−−−K−−−−−−−−−−−−−−YFSGDKYAIGGVDMSTGEE−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−GNGNTTII−−−−−−−−−−−−−−−−−AGFSVYPDYGACIRQRGWML−−NREPYAGKVAPYRNHNDKKYTKEAARGFMNGIRA−−−AGWATD−−−−−SS−−−−−−YVEK−−−−−−−−−−−−−−−−−−−−−−−−−−−−CVQHMDNYNLYRFD                    
fig|500632.7.peg.1126   Clostridium nexile DSM 1787                 SFITQEMVIAALEE−−QETH−−−GYPAAVTIAQIVAESGYGRFGPGGETGKGLSQLAY−−−−−−NYKNLFGM−−−−−−−−−K−−−−−−−−−−−−−−APAGDSTPIGIVNMQTGEQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−GKDHITIT−−−−−−−−−−−−−−−−−AGFLIFKNYTDCIKYRSGLI−−Q−−−−−−−−−−−RVYSDLVQNITDPDMFALKIA−−−SRWATD−−−−−HS−−−−−−YASK−−−−−−−−−−−−−−−−−−−−−−−−−−−−LIRIMQQYDLYRFN                    
fig|411468.9.peg.1702   Clostridium scindens ATCC 35704                           ALKC−−QDET−−−GYPASVTIAQIIQESGFGKYGPGGEEGKGLSYLAY−−−−−−QYNNLFGI−−−−−−−−−K−−−−−−−−−−−−−−G−−−−TGPAGSVGMRTCEQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−ASDGSAYMIT−−−−−−−−−−−−−−−−−SGFRVYNTYTECIEDRTELL−−K−−−−−−−−−−−EVYKDLTFGVEDANTFAIKVG−−−SRWATD−−−−−IQ−−−−−−YSQS−−−−−−−−−−−−−−−−−−−−−−−−−−−−LIGQMERYDLYRLD                    
fig|216593.1.peg.2125   Escherichia coli E2348/69                 KAFLAQLSLPAQLA−−SQQS−−−GVPHHLILAQAALESG−−−W−−−−−GQRQIRRENGE−−−−−−PSYNLFGV−−−−−−−−−K−−−A−−−−−−−−SGNWK−−−GPVTE−−ITTTE−−−−−−−−−−−−−−−−−−−−−−−−−−−−YENGEAKKVK−−−−−−−−−−−−−−−−−AKFRVYSSYLEALSDYVGLLT−−−−−−−−RNPRYAAVTTAA−−−SAEQGAQALQD−−−AGYATD−−−−−PH−−−−−−YARK−−−−−−−−−−−−−−−−−−−−−−−−−−−−LTNMIQQ                           
fig|216598.1.peg.1595   Shigella dysenteriae M131649                 KAFLAQLSLPAQLA−−SQQS−−−GVPHHLILAQAALESG−−−W−−−−−GQRQIRRENGE−−−−−−PSYNLFGV−−−−−−−−−K−−−A−−−−−−−−SGNWK−−−GPVTE−−ITTTE−−−−−−−−−−−−−−−−−−−−−−−−−−−−YENGEAKKVK−−−−−−−−−−−−−−−−−AKFRVYSSYLEALSDYVGLLT−−−−−−−−RNPRYAAVTTAA−−−SAEQGAQALQD−−−AGYATD−−−−−PH−−−−−−YARK−−−−−−−−−−−−−−−−−−−−−−−−−−−−LTNMIQQ                           
fig|1181763.3.peg.1955   Escherichia coli KTE217                 KAFLAQLSLPAQLA−−SQQS−−−GVPHHLILAQAALESG−−−W−−−−−GQRQIRRENGE−−−−−−PSYNLFGV−−−−−−−−−K−−−A−−−−−−−−SGNWK−−−GPVTE−−ITTTE−−−−−−−−−−−−−−−−−−−−−−−−−−−−YENGEAKKVK−−−−−−−−−−−−−−−−−AKFRVYSSYLEALSDYVGLLT−−−−−−−−RNPRYAAVTTAA−−−SAEQGAQALQD−−−AGYATD−−−−−PH−−−−−−YARK−−−−−−−−−−−−−−−−−−−−−−−−−−−−LTNMIQQ                           
fig|1116001.3.peg.1330   Escherichia coli ThroopD                 KAFLAQLSLPAQLA−−SQQS−−−GVPHHLILAQAALESG−−−W−−−−−GQRQIRRENGE−−−−−−PSYNLFGV−−−−−−−−−K−−−A−−−−−−−−SGNWK−−−GPVTE−−ITTTE−−−−−−−−−−−−−−−−−−−−−−−−−−−−YENGEAKKVK−−−−−−−−−−−−−−−−−AKFRVYSSYLEALSDYVGLLT−−−−−−−−RNPRYAAVTTAA−−−SAEQGAQALQD−−−AGYATD−−−−−PH−−−−−−YARK−−−−−−−−−−−−−−−−−−−−−−−−−−−−LTNMIQQ                           
fig|331111.3.peg.3679   Escherichia coli E24377A                 KAFLAQLSLPAQLA−−SQQS−−−GVPHHLILAQAALESG−−−W−−−−−GQRQIRRENGE−−−−−−PSYNLFGV−−−−−−−−−K−−−A−−−−−−−−SGNWK−−−GPVTE−−ITTTE−−−−−−−−−−−−−−−−−−−−−−−−−−−−YENGEAKKVK−−−−−−−−−−−−−−−−−AKFRVYSSYLEALSDYVGLLT−−−−−−−−RNPRYAAVTTAA−−−SAEQGAQALQD−−−AGYATD−−−−−PH−−−−−−YARK−−−−−−−−−−−−−−−−−−−−−−−−−−−−LTNMIQQ                           
fig|331112.3.peg.1121   Escherichia coli HS                 KAFLAQLSLPAQLA−−SQQS−−−GVPHHLILAQAALESG−−−W−−−−−GQRQIRRENGE−−−−−−PSYNLFGV−−−−−−−−−K−−−A−−−−−−−−SGNWK−−−GPVTE−−ITTTE−−−−−−−−−−−−−−−−−−−−−−−−−−−−YENGEAKKVK−−−−−−−−−−−−−−−−−AKFRVYSSYLEALSDYVGLLT−−−−−−−−RNPRYAAVTTAA−−−SAEQGAQALQD−−−AGYATD−−−−−PH−−−−−−YARK−−−−−−−−−−−−−−−−−−−−−−−−−−−−LTNMIQQ                           
fig|1240778.3.peg.1659   Escherichia coli O104:H4 str. Ec12-0465                 KAFLAQLSLPAQLA−−SQQS−−−GVPHHLILAQAALESG−−−W−−−−−GQRQIRRENGE−−−−−−PSYNLFGV−−−−−−−−−K−−−A−−−−−−−−SGNWK−−−GPVTE−−ITTTE−−−−−−−−−−−−−−−−−−−−−−−−−−−−YENGEAKKVK−−−−−−−−−−−−−−−−−AKFRVYSSYLEALSDYVGLLT−−−−−−−−RNPRYAAVTTAA−−−SAEQGAQALQD−−−AGYATD−−−−−PH−−−−−−YARK−−−−−−−−−−−−−−−−−−−−−−−−−−−−LTNMIQQ                           
fig|573235.3.peg.1447   Escherichia coli O26:H11 str. 11368                 KAFLAQLSLPAQLA−−SQQS−−−GVPHHLILAQAALESG−−−W−−−−−GQRQIRRENGE−−−−−−PSYNLFGV−−−−−−−−−K−−−A−−−−−−−−SGNWK−−−GPVTE−−ITTTE−−−−−−−−−−−−−−−−−−−−−−−−−−−−YENGEAKKVK−−−−−−−−−−−−−−−−−AKFRVYSSYLEALSDYVGLLT−−−−−−−−RNPRYAAVTTAA−−−SAEQGAQALQD−−−AGYATD−−−−−PH−−−−−−YARK−−−−−−−−−−−−−−−−−−−−−−−−−−−−LTNMIQQ                           
fig|585055.6.peg.1225   Escherichia coli 55989                 KAFLAQLSLPAQLA−−SQQS−−−GVPHHLILAQAALESG−−−W−−−−−GQRQIRRENGE−−−−−−PSYNLFGV−−−−−−−−−K−−−A−−−−−−−−SGNWK−−−GPVTE−−ITTTE−−−−−−−−−−−−−−−−−−−−−−−−−−−−YENGEAKKVK−−−−−−−−−−−−−−−−−AKFRVYSSYLEALSDYVGLLT−−−−−−−−RNPRYAAVTTAA−−−SAEQGAQALQD−−−AGYATD−−−−−PH−−−−−−YARK−−−−−−−−−−−−−−−−−−−−−−−−−−−−LTNMIQQ                           
fig|83333.1.peg.1066   Escherichia coli K12                 KAFLAQLSLPAQLA−−SQQS−−−GVPHHLILAQAALESG−−−W−−−−−GQRQIRRENGE−−−−−−PSYNLFGV−−−−−−−−−K−−−A−−−−−−−−SGNWK−−−GPVTE−−ITTTE−−−−−−−−−−−−−−−−−−−−−−−−−−−−YENGEAKKVK−−−−−−−−−−−−−−−−−AKFRVYSSYLEALSDYVGLLT−−−−−−−−RNPRYAAVTTAA−−−SAEQGAQALQD−−−AGYATD−−−−−PH−−−−−−YARK−−−−−−−−−−−−−−−−−−−−−−−−−−−−LTNMIQQ                           
fig|1005436.3.peg.1360   Escherichia coli 99.1805                 KAFLAQLSLPAQLA−−SQQS−−−GVPHHLILAQAALESG−−−W−−−−−GQRQIRRENGE−−−−−−PSYNLFGV−−−−−−−−−K−−−A−−−−−−−−SGNWK−−−GPVTE−−ITTTE−−−−−−−−−−−−−−−−−−−−−−−−−−−−YENGEAKKVK−−−−−−−−−−−−−−−−−AKFRVYSSYLEALSDYVGLLT−−−−−−−−RNPRYAAVTTAA−−−SAEQGAQALQD−−−AGYATD−−−−−PH−−−−−−YARK−−−−−−−−−−−−−−−−−−−−−−−−−−−−LTNMIQQ                           
fig|570506.3.peg.2102   Escherichia coli O157:H7 str. FRIK966                 KAFLAQLSLPAQLA−−SQQS−−−GVPHHLILAQAALESG−−−W−−−−−GQRQIRRENGE−−−−−−PSYNLFGV−−−−−−−−−K−−−A−−−−−−−−SGNWK−−−GPVTE−−ITTTE−−−−−−−−−−−−−−−−−−−−−−−−−−−−YENGEAKKVK−−−−−−−−−−−−−−−−−AKFRVYSSYLEALSDYVGLLT−−−−−−−−RNPRYAAVTTAA−−−SAEQGAQALQD−−−AGYATD−−−−−PH−−−−−−YARK−−−−−−−−−−−−−−−−−−−−−−−−−−−−LTNMIQQ                           
fig|1169389.3.peg.1179   Escherichia coli KTE139                 KAFLAQLSLPAQLA−−SQQS−−−GVPHHLILAQAALESG−−−W−−−−−GQRQIRRENGE−−−−−−PSYNLFGV−−−−−−−−−K−−−A−−−−−−−−SGNWK−−−GPVTE−−ITTTE−−−−−−−−−−−−−−−−−−−−−−−−−−−−YENGEAKKVK−−−−−−−−−−−−−−−−−AKFRVYSSYLEALSDYVGLLT−−−−−−−−RNPRYAAVTTAA−−−SAEQGAQALQD−−−AGYATD−−−−−PH−−−−−−YARK−−−−−−−−−−−−−−−−−−−−−−−−−−−−LTNMIQQ                           
fig|868174.3.peg.1559   Escherichia coli DEC8E                 KAFLAQLSLPAQLA−−SQQS−−−GVPHHLILAQAALESG−−−W−−−−−GQRQIRRENGE−−−−−−PSYNLFGV−−−−−−−−−K−−−A−−−−−−−−SGNWK−−−GPVTE−−ITTTE−−−−−−−−−−−−−−−−−−−−−−−−−−−−YENGEAKKVK−−−−−−−−−−−−−−−−−AKFRVYSSYLEALSDYVGLLT−−−−−−−−RNPRYAAVTTAA−−−SAEQGAQALQD−−−AGYATD−−−−−PH−−−−−−YARK−−−−−−−−−−−−−−−−−−−−−−−−−−−−LTNMIQQ                           
fig|868187.3.peg.1163   Escherichia coli DEC11B                 KAFLAQLSLPAQLA−−SQQS−−−GVPHHLILAQAALESG−−−W−−−−−GQRQIRRENGE−−−−−−PSYNLFGV−−−−−−−−−K−−−A−−−−−−−−SGNWK−−−GPVTE−−ITTTE−−−−−−−−−−−−−−−−−−−−−−−−−−−−YENGEAKKVK−−−−−−−−−−−−−−−−−AKFRVYSSYLEALSDYVGLLT−−−−−−−−RNPRYAAVTTAA−−−SAEQGAQALQD−−−AGYATD−−−−−PH−−−−−−YARK−−−−−−−−−−−−−−−−−−−−−−−−−−−−LTNMIQQ                           
fig|574521.7.peg.1204   Escherichia coli O127:H6 str. E2348/69                 KAFLAQLSLPAQLA−−SQQS−−−GVPHHLILAQAALESG−−−W−−−−−GQRQIRRENGE−−−−−−PSYNLFGV−−−−−−−−−K−−−A−−−−−−−−SGNWK−−−GPVTE−−ITTTE−−−−−−−−−−−−−−−−−−−−−−−−−−−−YENGEAKKVK−−−−−−−−−−−−−−−−−AKFRVYSSYLEALSDYVGLLT−−−−−−−−RNPRYAAVTTAA−−−SAEQGAQALQD−−−AGYATD−−−−−PH−−−−−−YARK−−−−−−−−−−−−−−−−−−−−−−−−−−−−LTNMIQQ                           
fig|340185.3.peg.2982   Escherichia coli E22                 KAFLAQLSLPAQLA−−SQQS−−−GVPHHLILAQAALESG−−−W−−−−−GQRQIRRENGE−−−−−−PSYNLFGV−−−−−−−−−K−−−A−−−−−−−−SGNWK−−−GPVTE−−ITTTE−−−−−−−−−−−−−−−−−−−−−−−−−−−−YENGEAKKVK−−−−−−−−−−−−−−−−−AKFRVYSSYLEALSDYVGLLT−−−−−−−−RNPRYAAVTTAA−−−SAEQGAQALQD−−−AGYATD−−−−−PH−−−−−−YARK−−−−−−−−−−−−−−−−−−−−−−−−−−−−LTNMIQQ                           
fig|199310.1.peg.1304   Escherichia coli CFT073                 KAFLAQLSLPAQLA−−SQQS−−−GVPHHLILAQAALESG−−−W−−−−−GQRQIRRENGE−−−−−−PSYNLFGV−−−−−−−−−K−−−A−−−−−−−−SGNWK−−−GPVTE−−ITTTE−−−−−−−−−−−−−−−−−−−−−−−−−−−−YENGEAKKVK−−−−−−−−−−−−−−−−−AKFRVYSSYLEALSDYVGLLT−−−−−−−−RNPRYAAVTTAA−−−SAEQGAQALQD−−−AGYATD−−−−−PH−−−−−−YARK−−−−−−−−−−−−−−−−−−−−−−−−−−−−LTNMIQQ                           
fig|766149.3.peg.1487   Shigella flexneri K-304                 RAFLAQLSLPAQLA−−SQQS−−−GVPHHLILAQAALESG−−−W−−−−−GQRQIRRENGE−−−−−−PSYNLFGV−−−−−−−−−K−−−A−−−−−−−−SGNWK−−−GQVTE−−ITTTE−−−−−−−−−−−−−−−−−−−−−−−−−−−−YENGEAKKVK−−−−−−−−−−−−−−−−−AKFRVYSSYLEALSDYVGLLT−−−−−−−−RNPRYAAVTTAA−−−SAEQGAQVLQD−−−AGYATD−−−−−PH−−−−−−YARK−−−−−−−−−−−−−−−−−−−−−−−−−−−−LTNMIQQ                           
fig|198214.1.peg.1039   Shigella flexneri 2a str. 301                 RAFLAQLSLPAQLA−−SQQS−−−GVPHHLILAQAALESG−−−W−−−−−GQRQIRRENGE−−−−−−PSYNLFGV−−−−−−−−−K−−−A−−−−−−−−SGNWK−−−GQVTE−−ITTTE−−−−−−−−−−−−−−−−−−−−−−−−−−−−YENGEAKKVK−−−−−−−−−−−−−−−−−AKFRVYSSYLEALSDYVGLLT−−−−−−−−RNPRYAAVTTAA−−−SAEQGAQVLQD−−−AGYATD−−−−−PH−−−−−−YARK−−−−−−−−−−−−−−−−−−−−−−−−−−−−LTNMIQQ                           
fig|358708.5.peg.1722   Shigella dysenteriae 1012                 KAFLAQLSLPAQLA−−SQQS−−−GVPHHLILAQAALESG−−−W−−−−−GQRQIRRENGE−−−−−−PSYNLFGV−−−−−−−−−K−−−A−−−−−−−−SGNWK−−−GPVTE−−ITTTE−−−−−−−−−−−−−−−−−−−−−−−−−−−−YENGEAKKVK−−−−−−−−−−−−−−−−−AKFRVYSSYLEALSDYVGLLT−−−−−−−−RNPRYAAVTTAT−−−SAEQGAQALRD−−−AGYATD−−−−−PH−−−−−−YARK−−−−−−−−−−−−−−−−−−−−−−−−−−−−LTNMIQQ                           
fig|340197.3.peg.2579   Escherichia coli F11                 KAFLAQLSLPAQLA−−SQQS−−−GVPHHLILAQAALESG−−−W−−−−−GQRQIRRENGE−−−−−−PSYNLFGV−−−−−−−−−K−−−A−−−−−−−−SGNWK−−−GPVTE−−ITTTE−−−−−−−−−−−−−−−−−−−−−−−−−−−−YENGEAKKVN−−−−−−−−−−−−−−−−−AKFRVYSSYLEALSDYVGLLT−−−−−−−−RNPRYAAVTTAV−−−SAEQGAQALQD−−−AGYATD−−−−−PH−−−−−−YARK−−−−−−−−−−−−−−−−−−−−−−−−−−−−LTNMIQQ                           
fig|749530.3.peg.2351   Escherichia coli MS 60-1                 KAFLAQLSLPAQLA−−SQQS−−−GVPHHLILAQAALESG−−−W−−−−−GQRQIRRENGE−−−−−−PSYNLFGV−−−−−−−−−K−−−A−−−−−−−−SGNWK−−−GPVTE−−ITTTE−−−−−−−−−−−−−−−−−−−−−−−−−−−−YENGEAKKVN−−−−−−−−−−−−−−−−−AKFRVYSSYLEALSDYVGLLT−−−−−−−−RNPRYAAVTTAV−−−SAEQGAQALQD−−−AGYATD−−−−−PH−−−−−−YARK−−−−−−−−−−−−−−−−−−−−−−−−−−−−LTNMIQQ                           
fig|405955.9.peg.909   Escherichia coli APEC O1                 KAFLAQLSLPAQLA−−SQQS−−−GVPHHLILAQAALESG−−−W−−−−−GQRQIRRENGE−−−−−−PSYNLFGV−−−−−−−−−K−−−A−−−−−−−−SGNWK−−−GPVTE−−ITTTE−−−−−−−−−−−−−−−−−−−−−−−−−−−−YENGEAKKVK−−−−−−−−−−−−−−−−−AKFRVYSSYLEALSDYVGLLT−−−−−−−−RNPRYAAVTTAV−−−SAEQGAQALQD−−−AGYATD−−−−−PH−−−−−−YARK−−−−−−−−−−−−−−−−−−−−−−−−−−−−LTNMIQQ                           
fig|1182666.3.peg.1691   Escherichia coli KTE59                 KAFLAQLSL