(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00007859

fig|629742.3.peg.262   Staphylococcus hominis SK119     MSKKFSFKFPSMIALTLFGAAFTTHHAEASENKQNAAN−−NVIDDQQNIENANVAKHQVSNAAQNISGVQTYQDPTLVKSNTTNNTYNTYTYDAKLDNLNQSAS−−−−−SQNNSTRSNTNDTVKNSDTISNYQSDNTK−−−−−−−−−−HNNNEVATTSTTSTDSTKLVTSEDSNH−−−−−−−−KLNSNHITTETPSTHNESAQVSNTHK−−LNTDEP−−−KTTLNNVENQNNSISKAQLSTTVV−−NNKQQKVEDNATTTNND−−−−−−−−NNKVSLSSTTESDSTSKNLSNTSDNTTVNNED−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TTLKKNNTQTSPMHNTLKVRAYSTALNNTHVNNKATTSTQS−−−−−−−−NDASVSDSTSSVHKGIGGKGGPATVS−−−−TYSTTSSLPKYVPQVKSSINNYIRTNNLKAPSIEEHYTSYFPKYGYRNGVGKPEGIVVHDTANDNSTIEGEINYMRNNYTNAFVHAFVDGNRIIETAPTDYLSWGAGPYGNNRFINVEIVHTHDYASFARSMNNYADYAATQLQYYGLKPDSAEYDAKGTVWTHYAISRYLGGTDHADPHAYLSNHNYSYDELYDLINEKYLIKMGKVAPWGTTSTN−−−−−−−−−−NSTPTTKPSINNKKLTVTSNNGLAQIKSDNSGLYTTVYDSKGKTTNQVHNTLAVTKSAQLDKDKYYLVSDYNSGKLYGWVKQNETIYNTITPKAKVNKSYTIKPGTTLYTVPWGNYNQIAGTVSKSNQSPFKASASQQVGKSTYVYGSVNGLTGWVSKYYLND−−−−−−−−−−−−−VQNKADTTNILNVSQLNNTLGQVAKKNNGAYTTVYDSSGKINPSINGNTYRVTKKATLNNKNFYLISDFNGNQSHGWIPSSEINIQTTTPINDGIKKYNIKGNSNIYETPWGSSSQIKATVPSKGDVLKSIDALKVGSNTYLHGVINNVWGWI−−−−−−LSDDVQTV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KTSQKTSSVQTVSKIAQVNSTNDGIRSSIYDASGKHAKQYANKTYVVTKEKKLDDHTYVLLSSTSGNTPLGWYNVKDLNIKNLDEEQKVKGTYTVNQNNNGLYTIAWGTNQQRLDKNNIANQTFKASKSTIVDGKTYLYGTVNNQTGWIALKDLTNASSFDTAEDYNDDLVITNGNSFYYDDPTSAKAYSLKPFNEQIFQITKRKVVNGITWYYGKLSNGKSVWIKKSDLQQQLVKLSKNYRTLDEVTKIQHNVYGAPPQVQRNNSGWSNATYSEIKNAMNAKTLAKNPALKYQFLRLDRPQLLSVDRLNRLLKGKGMLENQGQAFANAAKLTGVNEIYLIAHALLETGNGQSKLAKGANLVNNQVVSNSPIKYYNVYGIGAYDYAPLVNGINYAKQSGWNSISKAIIDGAKFIAQDYIKSGQNTLYKMRWNPDQPGTHQYATDINWANLNAKSLKYLYDQINSVGKYFEIPVFN
fig|596319.3.peg.637   Staphylococcus warneri L37603     MTKKFNYKLPSMVAVTLLGTAFTAHHADAAETAQDQTQNKNVLDDQATLKQANNAKQEVSNPTQNISGTQTYQDPTKVKPVKTTSTEN−−−NDASINQQKT−−−−−−−−−ENTSTNENTNVKAQTTDASNQN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NNQIKENSTVEETQKQEES−−−NQALDNNEKQQSSQQNSTEESKQE−−VAQQNAKQETQTAQEETS−−−−ETTTQKQAQQQTN−−TTNQNAKQTVKDNGGYRLDDDEDDVDDEAN−−SVEPSQKAHA−−−−−−−−−−−−TQQSKENVATSSNTKTQSATPKANELKA−−−NNVVNESAKVSSTQS−−−−−−−−NDNATKENAKQVTTFNSVAKPRMMYAT−−−−ANRATSSLPKYQPQVKSSINDYIRKKNFKAPQIEEDYSSYFPKYGYRNGVGRPEGIVVHDTANENSTITGEINYMKNNYNSAFVHAFVDGNRIIETAPTDYLSWGAGPNANNRFINVEIVHTHDYDSFARSMNNYADYAATQLQYYGLKPNSAENDGSGTVWTHAAISRWLGGTDHADPHGYLQQHNYSYNELYDLINEKYKIKMGQVAPWGTTTTTKPSTGGTTTKPSTGGSTTKPSTNDKLTVAANSGMAQIKPTNNGLYTTVYAKKGHSTNQAQKALSVTKTATLGNNKFYLVQDYNTGEKFGWVKQGDVVYNTAKSPVKVNQSYNVKPGTKAYTVPWGTDKQVAGTVSGKGNQTFKATKQQQIDKAIYLYGSVNGVNGWISKSFLTTPSTSNTTKPT−−TPSKPATNSQLTVAANNGVAQIKTSNSGVYTTVYDKTGKSTDQVQKTLAVSKTATLGNDKFYLVQDYNTGKKYGWVKQSDVTYNTAKSPISVNKSYNVKPGTKAYTVPWGTFKQEAGTVSGKANQTFKATKQQQIDKATYLYGTVNGISGWISKYYLTEPTATRTALAQPKMAIK−−−−−SNDTTNNEAAKAQS−−−PTNVNTTQATKQIGQVKANNTGIRSSVYDKTAKSGTKYADRTFTISKQRNEGDQTYVLLQNTASNTPLGWVNINDVDVQNLGNEAKLTGQYKVNNNNNGLYSIAWGTKNQQLLPASQLANQTFNASKAVYVGKEKYLYGTVNNRTGWIAAKDLEQANSNNPATPYNYTFVIKNNNGHYYDEPSAKNGYSLKTYFEKPFVVIKQKQQNGVTWYYGKLTNGKYVWIKESDLTKELVKYSNTGRTLNQMASIQNNLSYGPQVQRTPGVWSNATFSETKNAMDSNKLAKDPVSKYQFLRLDQPQYLSEATLNKLLKGKGVLENQGAAFSQAAKQYGLNEIYLISHALLETGNGQSQLAKGANITNGAVNTRSATKYHNVFGIAAYDYNALGEGVKFAKASGWDSVSKAIIGGAKFIGNSYVKAGQNTLYKMRWNPENPGTHQYATDINWADSNAQVLKGLYDQIGEVGKFFDIPKFK
fig|904334.4.peg.1931   Staphylococcus capitis VCU116     MTKKFNYKLPSMVALTLFGTAFTAHHAHAAENTQDQTNNKNVLDDQATLKQAEQVKEKVSQPAQNVSGTQTYQDPTKVQSNDDTTSNT−−−YDASLDELNGSSSKTSQDQSNNSAQTDQQTQDANVTISNKEDASTQDDHKEASQSEQHEQHEQDATSPSTKEDLKSDNNEDVSQPEQQNHESSLDKNEVTSQS−−−−EEVAHPSNTEDSKSNESQQVDNSSTNEQYASQTQSNDNKELDTTQSSLNKTNEKENSETSISNSSHSNHQTTKNSNSQQPTDEETNQSSAKVSSTNQSGYNFDYDEDDETEDTDVSNVQASTSNEADSHTTRTNNDKQPQITSLTAQAKEDNSSEPKAESNKSKNNESTNKATTTSVKSTNSTATTSSNKSTNEKATSNNDKKVTTFSSVAKPRMMYSVNKKTTSKATSSLPKYTPQVNSSINNYIRKNNFKAPQIEENYTSYFPKYGYRYGVGRPEGIVVHDTANENSTIDGEINFMKNNYESAFVHAFVDGNRIVETAPTDYLSWGAGPAGNERFINVEIVHTHDYASFARSMNNYADYAATQLVYYGLKPDSAENDGQGTVWTHYAISRWLGGTDHADPHQYFSNHNYSYAELYDLINEKYLIKTGQVAPWGTTSSS−−−−−−−−−−STKPSGGSSSSSSDKLTVKANSGVAQIKPSNSGLYTTVYDSKGHSTDQAQKTLSVTKSATLGNNKFYLVEDYNSGKKYGWVKQSDVVYNTAKSPVKVNQTFNVKAGSTLYTVPWGTPSQVASKVSGSGNQTFKATKQQQIDKAIYLYGTVNGKSGWISKYYLTTPSSSSNSTKPSSGSSSSSTSNNKLTVSANSGVAQIKSKNNGVYTTVYDNKGKKTDQVQRTLAVTKSATLGNDKFYLVEDYNTGKKYGWVKQSDVVYNTAKSPVKVNATYTIKPGVKLYTVPWGTFNQEASKVSGSGNQTFKATKQQQIDKATYLYGTVNGKSGWVSKYYLTAPTQSKVA−−−−−−−−−−−−TSSKVTTANRAASTQSTSKATQSATTQTINKVAQVKANNSGIRTSVYDKTAKSGAKYANRTFVISKQRTEGNNTYVLLQDSTQNTPLGWVNIKDVTSQNLGKQTKSTGKYKVNSENNGLYSIAWGTKNQQLLSSKMISNKAFSAARSVYVGKELFLYGTVDNRTGWIAAKDLTQNSTDAQATPYHYTFVVNNNKGYYYNDVANNAHYSLNSYYNQPFFVSKQMKVDGVTWYYGQLTNGKYVWIKSTDLSKESIRYVKTGMTLTKAANIQNNSYYNPQVQRTAGKWEDANYDEIKNAMDPIRLAKDDEYKYQFLLLDQPQYLPVSALNKLLEGKGVLEGQGASFSQAAKKYGINEIYLISHALIETGNGTSDLAKGGDIVNGKFTNKSAKKYHNVFGIGAYDDNPLIEGIKYAKEAGWDSVSKAIVGGAKFIGQSYVKAGQNTLYKMRWNPAHPGTHQYATDINWANLNAQVIKGFYDKMGEVGKYFEIPQYN
fig|525378.3.peg.177   Staphylococcus epidermidis M23864:W1     MTKKFNYKLPSMVALTLFGTAFTAHHAHAAEETQDQTKNSNVLDDQATLKQAEQAKNEVTQSAQNVSGTQTYQDPTKVQSKQDTTSNN−−−YDASLDELNDSSSKASQQEQSNNSNQPTDSKETNTSSVNTYQDSTKD−−−−−−−−−−−−−−−−−−−−−−−−−−−−IKNNE−−−−−−−−−−−−−ISKDAVTSED−−−−NETSKVDNTNKEVSETEQQ−−−ESTVENVNKDENSNNNIQASSNQT−−NNLNDQEKQEATSNQAS−−−−−−−−NNKTSQQATTDSTEKSNNKVSQTNSSGYNFDDDEDD−−−−VDTTNAQSKNTKAD−−−−−−−−−−QPQVASLSAQNNVNTKSESNPTIKNSTNSTNTSKSATQNTKVSNTQA−−−−−−−−NNTTTESNNKVSTFSSVAKPRMMYAV−−−−NKKTTSSLPKYTPQVKSSINDYIRKKNYKAPQIEENYTSYFPKYGYRNGVGRPEGIVVHDTANDNSTIDGEINYMKNNYQSAFVHAFVDGNRIVETAPTDYLSWGAGPQGNERFINVEIVHTHDYDSFARSMNNYADYAATQLQYYGLKPDSAENDGQGTVWTHYAISRYLGGTDHTDPHQYFRSHNYSYAELYDLIYEKYLIKTGQVAPWGTSSTS−−−−−−−−−−PSKPSKPSDSSNNNKLTVSANSGVAQIKPSNSGLYTTVYDEKGHSTDQAQKTLSVTKSATLGNNKFYLVEDYNTGKKYGWVKQGDVVYNTAKSPVKVNQTYNVKAGSTLYTVPWGTPSQVASKVSGSGNQTFKATKQQQIDKAIYLYGTVNGKSGWISKYYLTTPSSS−−NTKPSKPSTDNSSSNNKLTVSANSGVAQIKAKNNGVYTTVYDKKGKTTDQVQRTLSVTKSATLGNDKFYLVEDYNTGKKYGWVKQDDVVYNTAKSPVKVNQNYSIKPGVKLYTVPWGTYNQVASTVSGSGNQTFKATKQQQIDKATYLYGTVNGKSGWVSKYYLTTPTQSKVAVSKPKTSTKAVSTNSKATTADRAAITQTSAKASNTNSTQTINKIAQVKANNSGIRASVFDKKAKSGAKYGNRTYIITKQRTEGNNTYVLLQDSTRNTPLGWVNVKDVTSQNIGNQTKATGQYKVSQTNNGLYSIAWGTKNQQLLPSNTIASKTFNASKSLYVGKDLYLYGTVNNRTGWIAAKDLIQSNKDVQARPYNYTFVISNSNSYYYEDLGKNARYSLKPYYDKTFVVSKQKNINGVTWYYGKLTNGKYVWIKSTDVAKESVKYVNTGYTLAHAAEIQNDLYDTPQIQKVPGQWTNANYNEIKDAMDPNKLTKDSGARYQFLRLDQPQSLSVAALNELLKGQGVLEGQGAAFSEAAKKYGINEIYLVAHALVETGNGTSQLAKGGDIVNGKFSDKTKTKYHNVFGIGAYDSSPLIEGIKYAKNAGWDSVSKAIIGGAKFIGQSYIKAGQNTLYKMRWNPSNPGTHQYATDIHWATVNAQTIKGFYDKIGEVGKYYEIPKYK
fig|525376.3.peg.398   Staphylococcus epidermidis W23144     MAKKFNYKLPSMVALTLFGTAFTAHQANAAEQPQDQSNHKNVLDDQTALKQAEKAKSEVTQSTTNVSGTQTYQDPTQVQPEQDTQSTT−−−YDASLDEMSTYNEISSNQNQQSSSINDANQNQTNSSTKNQQE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ET−−−−NDLTQEDKTSTDTNQLQET−−−QSVADENEKDLETNASTEQQDKKM−−TASQPSENQAIETQTASN−−−−DNESQQKSQQVTSEQNETVTPKVSNTNASGYNFDYDDEDDDSSTD−−−−−−−−−−−−−−−−−−−−−−−HLEPVSL−−−NNVNATSKQTTSYKYK−−−−EPAQRVTTNTAKKETAS−−−−−−−−NQATI−−DTKQFTPFSATAQPRTVYSV−−−−SSQKTSSLPKYTPKVNSSINNYIRKKNMKAPRIEEDYTSYFPKYGYRNGVGRPEGIVVHDTANDNSTIDGEIAFMKRNYNSAFVHAFVDGNRIIETAPTDYLSWGAGPYGNQRFINVEIVHTHDYDSFARSMNNYADYAATQLQYYNLKPDSAENDGRGTVWTHAAISNFLGGTDHADPHQYLRSHNYSYAELYDLIYEKYLIKTGQVAPWGTTSTK−−−−−−−−−−PSQPSKPSGGTNNKLTVSANRGVAQIKPTNNGLYTTVYDSKGHKTDQVQKTLSVTKTATLGNNKFYLVEDYNSGKKYGWVKQGDVVYNTAKAPVKVNQTYNVKAGSTLYTVPWGTPKQVASKVSGTGNQTFKATKLQQIDKATYLYGTVNGKSGWISKYYLTSASKPSNPTKPS−−−−−−−−TNNQLTVTNNSGVAQINAKNSGLYTTVYDTKGKTTDQIQRTLSVTKAATLGDKKFYLVGDYNTGTNYGWVKQDEVIYNTAKSPVKINQTYNVKPGVKFHTVPWGTYNQVAGTVSGKGDQTFKATKQQQIDKATYLYGTVNGKSGWISKYYLTTPSKVQTL−−−−−−−−−−−−−−−−−−−−−−−−STQSTPAPKQVQSSTQTVNQIAQVKANNSGIRASVYDKTAKSGTKYANRTFLINKQRTEGNNTYVLLQDGTSNTPLGWVNINDVTTQNIGKQTQSIGKYSVKPTNNGLYSIAWGTKNQQLLAPNTLANQAFNASKAVYVGKDLYLYGTVNNRTGWIAAKDLIQNSTDAQATPYNYTFVINNSKSYFYMDPTKANRYSLKPYYEQTFTVIKQKNINGVKWYYGQLLDGKYVWIKSTDLVKEKIKYAYTGMTLNNAINIQSRLKYKPQVQNEAWKWSNANYSQIKNAMDTKRLANDSSLKYQFLRLDQPQYLSAQALNKLLKGKGVLENQGAAFSQAARKYGLNEIYLISHALVETGNGTSQLAKGGDVSKGKFTTKTGHKYHNVFGIGAFDNNALVDGIKYAKNAGWTSVSKAIIGGAKFIGNSYVKAGQNTLYKMRWNPASPGTHQYATDINWANVNAQVLKQFYDKIGEVGKYFEIPTYK
fig|979202.3.peg.612   Staphylococcus epidermidis NIHLM070     MAKKFNYKLPSMVALTLFGTAFTAHQANAAEQPQNQSNHKNVLDDQTALKQAEKAKSEVTQSTTNVSGTQTYQDPTQVQPKQDTQSTT−−−YDASLDEMSTYNEISSNQKQQSLSTDDANQNQTNSVTKNQQE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ET−−−−NDLTQEDKTSTDTNQLQET−−−QSVAKENEKDLGANANNEQQDKKM−−TASQPSENQAIETQTASN−−−−DNESQQKSQQVTSEQNETATPKVSNTNASGYNFDYDDEDDDSSTD−−−−−−−−−−−−−−−−−−−−−−−HLEPISL−−−NNVNATSKQTTSYKYK−−−−EPAQRVTTNTVKKETAS−−−−−−−−NQATI−−DTKQFTPFSATAQPRTVYSV−−−−SSQKTSSLPKYTPKVNSSINNYIRKKNMKAPRIEEDYTSYFPKYGYRNGVGRPEGIVVHDTANDNSTIDGEIAFMKRNYTNAFVHAFVDGNRIIETAPTDYLSWGAGPYGNQRFINVEIVHTHDYDSFARSMNNYADYAATQLQYYNLKPDSAENDGRGTVWTHAAISNFLGGTDHADPHQYLRSHNYSYAELYDLIYEKYLIKTKQVAPWGTTSTK−−−−−−−−−−PSQPSKPSGGTNNKLTVSANRGVAQIKPTNNGLYTTVYDSKGHKTDQVQKTLSVTKTATLGNNKFYLVEDYNSGKKYGWVKQGDVVYNTAKAPVKVNQTYNVKAGSTLYTVPWGTPKQVASKVSGTGNQTFKATKQQQIDKATYLYGTVNGKSGWISKYYLTTASKPSNPTKPS−−−−−−−−TNNQLTVTNNSGVAQINAKNSGLYTTVYDTKGKTTNQIQRTLSVTKAATLGDKKFYLVGDYNTGTNYGWVKQDEVIYNTAKSPVKINQTYNVKPGVKLHTVPWGTYNQVAGTVSGKGDQTFKATKQQQIDKATYLYGTVNGKSGWISKYYLTAPSKVQAL−−−−−−−−−−−−−−−−−−−−−−−−STQSTPAPKQVKPSTQTVNQIAQVKANNSGIRASVYDKTAKSGTKYANRTFLINKQRTQGNNTYVLLQDGTSNTPLGWVNINDVTTQNIGKQTQSIGKYSVKPTNNGLYSIAWGTKNQQLLAPNTLANQAFNASKAVYVGKDLYLYGTVNNRTGWIAAKDLIQNSTDAQSTPYNYTFVINNSKSYFYMDPTKANRYSLKPYYEQTFTVIKQKNINGVKWYYGQLLDGKYVWIKSTDLVKEKIKYAYTGMTLNNAINIQSRLKYKPQVQNEPLKWSNANYSQIKNAMDTKRLANDSSLKYQFLRLDQPQYLSAQALNKLLKGKGVLENQGAAFSQAARKYGLNEIYLISHALVETGNGTSQLAKGGDVSKGKFTTKTGHKYHNVFGIGAFDNNALVDGIKYAKNAGWTSVSKAIIGGAKFIGNSYVKAGQNTLYKMRWNPANPGTHQYATDINWANVNAQVLKQFYDKIGEVGKYFEIPTYK
fig|176280.10.peg.722   Staphylococcus epidermidis ATCC 12228     MAKKFNYKLPSMVALTLFGTAFTAHQANAAEQPQNQSNHKNVLDDQTALKQAEKAKSEVTQSTTNVSGTQTYQDPTQVQPKQDTQSTT−−−YDASLDEMSTYNEISSNQKQQSLSTDDANQNQTNSVTKNQQE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ET−−−−NDLTQEDKTSTDTNQLQET−−−QSVAKENEKDLGANANNEQQDKKM−−TASQPSENQAIETQTASN−−−−DNESQQKSQQVTSEQNETATPKVSNTNASGYNFDYDDEDDDSSTD−−−−−−−−−−−−−−−−−−−−−−−HLEPISL−−−NNVNATSKQTTSYKYK−−−−EPAQRVTTNTVKKETAS−−−−−−−−NQATI−−DTKQFTPFSATAQPRTVYSV−−−−SSQKTSSLPKYTPKVNSSINNYIRKKNMKAPRIEEDYTSYFPKYGYRNGVGRPEGIVVHDTANDNSTIDGEIAFMKRNYTNAFVHAFVDGNRIIETAPTDYLSWGAGPYGNQRFINVEIVHTHDYDSFARSMNNYADYAATQLQYYNLKPDSAENDGRGTVWTHAAISNFLGGTDHADPHQYLRSHNYSYAELYDLIYEKYLIKTKQVAPWGTTSTK−−−−−−−−−−PSQPSKPSGGTNNKLTVSANRGVAQIKPTNNGLYTTVYDSKGHKTDQVQKTLSVTKTATLGNNKFYLVEDYNSGKKYGWVKQGDVVYNTAKAPVKVNQTYNVKAGSTLYTVPWGTPKQVASKVSGTGNQTFKATKQQQIDKATYLYGTVNGKSGWISKYYLTTASKPSNPTKPS−−−−−−−−TNNQLTVTNNSGVAQINAKNSGLYTTVYDTKGKTTNQIQRTLSVTKAATLGDKKFYLVGDYNTGTNYGWVKQDEVIYNTAKSPVKINQTYNVKPGVKLHTVPWGTYNQVAGTVSGKGDQTFKATKQQQIDKATYLYGTVNGKSGWISKYYLTAPSKVQAL−−−−−−−−−−−−−−−−−−−−−−−−STQSTPAPKQVKPSTQTVNQIAQVKANNSGIRASVYDKTAKSGTKYANRTFLINKQRTQGNNTYVLLQDGTSNTPLGWVNINDVTTQNIGKQTQSIGKYSVKPTNNGLYSIAWGTKNQQLLAPNTLANQAFNASKAVYVGKDLYLYGTVNNRTGWIAAKDLIQNSTDAQSTPYNYTFVINNSKSYFYMDPTKANRYSLKPYYEQTFTVIKQKNINGVKWYYGQLLDGKYVWIKSTDLVKEKIKYAYTGMTLNNAINIQSRLKYKPQVQNEPLKWSNANYSQIKNAMDTKRLANDSSLKYQFLRLDQPQYLSAQALNKLLKGKGVLENQGAAFSQAARKYGLNEIYLISHALVETGNGTSQLAKGGDVSKGKFTTKTGHKYHNVFGIGAFDNNALVDGIKYAKNAGWTSVSKAIIGGAKFIGNSYVKAGQNTLYKMRWNPANPGTHQYATDINWANVNAQVLKQFYDKIGEVGKYFEIPIYK
fig|904323.3.peg.1294   Staphylococcus epidermidis VCU057     MAKKFNYKLPSMVALTLFGTAFTAHQANAAEQPQNQSNHKNVLDDQTALKQAEKAKSEVTQSTTNVSGTQTYQDPTQVQPKQDTQSTT−−−YDASLDEMSTYNEISSNQKQQSLSTDDANQNQTNSVTKNQQE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ET−−−−NDLTQEDKTSTDTNQLQET−−−QSVAKENEKDLGANANNEQQDKKM−−TASQPSENQAIETQTASN−−−−DNESQQKSQQVTSEQNETATPKVSNTNASGYNFDYDDEDDDSSTD−−−−−−−−−−−−−−−−−−−−−−−HLEPISL−−−NNVNATSKQTTSYKYK−−−−EPAQRVTTNTVKKETAS−−−−−−−−NQATI−−DTKQFTPFSATAQPRTVYSV−−−−SSQKTSSLPKYTPKVNSSINNYIRKKNMKAPRIEEDYTSYFPKYGYRNGVGRPEGIVVHDTANDNSTIDGEIAFMKRNYTNAFVHAFVDGNRIIETAPTDYLSWGAGPYGNQRFINVEIVHTHDYDSFARSMNNYADYAATQLQYYNLKPDSAENDGRGTVWTHAAISNFLGGTDHADPHQYLRSHNYSYAELYDLIYEKYLIKTKQVAPWGTTSTK−−−−−−−−−−PSQPSKPSGGTNNKLTVSANRGVAQIKPTNNGLYTTVYDSKGHKTDQVQKTLSVTKTATLGNNKFYLVEDYNSGKKYGWVKQGDVVYNTAKAPVKVNQTYNVKAGSTLYTVPWGTPKQVASKVSGTGNQTFKATKQQQIDKATYLYGTVNGKSGWISKYYLTTASKPSNPTKPS−−−−−−−−TNNQLTVTNNSGVAQINAKNSGLYTTVYDTKGKTTNQIQRTLSVTKAATLGDKKFYLVGDYNTGTNYGWVKQDEVIYNTAKSPVKINQTYNVKPGVKLHTVPWGTYNQVAGTVSGKGDQTFKATKQQQIDKATYLYGTVNGKSGWISKYYLTAPSKVQAL−−−−−−−−−−−−−−−−−−−−−−−−STQSTPAPKQVKPSTQTVNQIAQVKANNSGIRASVYDKTAKSGTKYANRTFLINKQRTQGNNTYVLLQDGTSNTPLGWVNINDVTTQNIGKQTQSIGKYSVKPTNNGLYSIAWGTKNQQLLAPNTLANQAFNASKAVYVGKDLYLYGTVNNRTGWIAAKDLIQNSTDAQSTPYNYTFVINNSKSYFYMDPTKANRYSLKPYYEQTFTVIKQKNINGVKWYYGQLLDGKYVWIKSTDLVKEKIKYAYTGMTLNNAINIQSRLKYKPQVQNEPLKWSNANYSQIKNAMDTKRLANDSSLKYQFLRLDQPQYLSAQALNKLLKGKGVLENQGAAFSQAARKYGLNEIYLISHALVETGNGTSQLAKGGDVSKGKFTTKTGHKYHNVFGIGAFDNNALVDGIKYAKNAGWTSVSKAIIGGAKFIGNSYVKAGQNTLYKMRWNPANPGTHQYATDINWANVNAQVLKQFYDKIGEVGKYFEIPIYK