(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00007654

fig|66692.3.peg.3078   Bacillus clausii KSM-K16                          LNLSSSAGLS−−−−−−−−AGTINSQLLSDKGILQGQGQAFINASKLYGVNEIY−−−LISHALLETGNGKSQLATGVQVNGKTVYNMYGIGAYDGNAVSAGAQYAYNQGWF−−−−−−−−−−TPEDAIIGGARFVSSNYFARGQNTLYKMRW−−−−−−−−−−−−−NPANPGTYQYATDVGWAVKQTHHMSNLYSLVDDY−−−−−−−−−−−EMTFDVPVYK−−−NQPTGDAGNDK−−−−LEQLPTGTFGTTTARLNVRTGPGTSHSIVTTLDKDTK−−−VELLA−−KQGNWYQIAVDNTTGFVSGDYL−−KLDKPSEDNVEDSDQELISYGETTARLNLR−−−−−−−−SQPNTSSNVLTTLALGQKL−−−−−EILKKEGNWYRVRAGHQSGWVSADYVK−−−−−−−ISSNGVDKESPSLGSATT−−−−TARLNLRSGAGTNHSIITTLTKGQKVELLKK−−−−−QG−−−GWYQVKAGNRTGWV−−−SADYLNVNG−−−−−−−−−−−−−−−−−−−−−−SGNVDNA−−−−−−−−−−−PSSGSATTTARLNLRSGAGTNHSIITTLTKGQKVELLKK−−−−QGGWYQVKAGNRTGWVSADYLNV
fig|1126011.4.peg.1107   Listeria monocytogenes 07PF0776     INKKWMKIVMIPMLVVPMYGLTTVGGQLQDSLTGENSFVKEVEAATTASQQAFIDKIAPAAQASQEKY−−−HLLSSITLAQAILESGWGKSGLAT−−−−−−QGYNLFGIKGKYNGQSVIMTTSEYVNGEWIKIDAEFRKYPSWNESVTDHTLLLVNG−−TSWNKDLYKKVVDATDYKVAA−−−MELQKAGY−−−ATS−−−−−−−PTYGASLIQVIENY−−−−−−−−−−−DLAKYDVLYDKILTQKSTSGKATV−−−−TSPTGNGVWTLP−−YKVKGVQSVSPASTYANKDID−−−LVSVATTKRGTYYQFKYNGKVVGWVDGKAL−−TIYDSVNY−−−DKVNVGRAKITSPVSNGIWS−−−KPYNVYGREFVTNATTYAQQEIKLLREAQTAKGTY−−YQFSINNKTIGWIDKRALTIYPYDSIISSKNVNLDGQITNPTGNGIWTKAYKLEGTTSVAQ−−−ATKYANKDVKISQQIETQHG−−−TYYNISIDGKAIGWL−−−DRNAITLYD−−−QEEYNKTVAIDAVVKNVKGNAVWTE−−−−−−−−−−−PYRTVGT−−KLIG−−−−−−−−−−−PAETYLNKEVEVVREAKTPKGTYYQFKSGGKVIGWLDKKAFDV
fig|401650.3.peg.664   Listeria monocytogenes Aureli 1997     INKKWMKIVMIPMLVVPMYGLTTVGGQLQDSLTGENSFVKEVEAATTASQQAFIDKIAPAAQASQEKY−−−HLLSSITLAQAILESGWGKSGLAT−−−−−−QGYNLFGIKGKYNGQSVIMTTSEYVNGEWIKIDAEFRKYPSWNESVTDHTLLLVNG−−TSWNKDLYKKVVDATDYKVAA−−−MELQKAGY−−−ATS−−−−−−−PTYGASLIQVIENY−−−−−−−−−−−DLAKYDVLYDKILTQKSTSGKATV−−−−TSPTGNGVWTLP−−YKVKGVQSVSPASTYANKDID−−−LVSVATTKRGTYYQFKYNGKVVGWVDGKAL−−TIYDSVNY−−−DKVNVGRAKITSPVSNGIWS−−−KPYNVYGREFVTNATTYAQQEIKLLREAQTAKGTY−−YQFSINNKTIGWIDKRALTIYPYDSIISSKNVNLDGQITNPTGNGIWTKAYKLEGTTSVAQ−−−ATKYANKDVKISQQIETQHG−−−TYYNISIDGKAIGWL−−−DRNAITLYD−−−QEEYNKTVAIDAVVKNVKGNAVWTE−−−−−−−−−−−PYRTVGT−−KLIG−−−−−−−−−−−PAETYLNKEVEVVREAKTPKGTYYQFKSGGKVIGWLDKKAFDV
fig|401650.12.peg.2388   Listeria monocytogenes HPB2262              MIPMLVVPMYGLTTVGGQLQDSLTGENSFVKEVEAATTASQQAFIDKIAPAAQASQEKY−−−HLLSSITLAQAILESGWGKSGLAT−−−−−−QGYNLFGIKGKYNGQSVIMTTSEYVNGEWIKIDAEFRKYPSWNESVTDHTLLLVNG−−TSWNKDLYKKVVDATDYKVAA−−−MELQKAGY−−−ATS−−−−−−−PTYGASLIQVIENY−−−−−−−−−−−DLAKYDVLYDKILTQKSTSGKATV−−−−TSPTGNGVWTLP−−YKVKGVQSVSPASTYANKDID−−−LVSVATTKRGTYYQFKYNGKVVGWVDGKAL−−TIYDSVNY−−−DKVNVGRAKITSPVSNGIWS−−−KPYNVYGREFVTNATTYAQQEIKLLREAQTAKGTY−−YQFSINNKTIGWIDKRALTIYPYDSIISSKNVNLDGQITNPTGNGIWTKAYKLEGTTSVAQ−−−ATKYANKDVKISQQIETQHG−−−TYYNISIDGKAIGWL−−−DRNAITLYD−−−QEEYNKTVAIDAVVKNVKGNAVWTE−−−−−−−−−−−PYRTVGT−−KLIG−−−−−−−−−−−PAETYLNKEVEVVREAKTPKGTYYQFKSGGKVIGWLDKKAFDV
fig|272626.1.peg.1054   Listeria innocua Clip11262     INKKWMKIVMIPMLVVPMYGLTTVSGQLQNSLTGENSFVKDAQAATTASQQAFIDKIAPAAQASQEKY−−−HLLSSITLAQAILESGWGKSGLAT−−−−−−QGYNLFGIKGKYNGQSVIMSTSEYVNGEWIKIDAEFRKYPSWNESVTDHTLLLVNG−−TSWNKNLYKKVVDATDYKVAA−−−NELQKAGY−−−ATS−−−−−−−PTYAASLIRVIETY−−−−−−−−−−−DLAKYDVLYDKILTQKSTSGKATV−−−−TSPTGNGVWTLP−−YKVKGVQSVSPASTYANKDID−−−LVSVATTKRGTYYQFKYNGKVIGWVDGKAL−−TIYDSVNY−−−DKVNVGRAKITSAPGNGIWS−−−KPYNVYGREFVTNATTYAQQEIKLLREAQTAKGTY−−YQFSINNKTIGWIDKRALTIYPYDSVISSKAVNLDGQITNPTGNGIWTKAYKLEGTTSVAQ−−−ATQYANQDVKISEVVETQHG−−−TYYNISIGGRAIGWL−−−DKNAITLYD−−−QAEYNKAVTLDGTIKNVQGNAIWTE−−−−−−−−−−−PYRTAGT−−KLVA−−−−−−−−−−−QAEKYANKDVQIVREAKTPRGTYYQFKSGGNVIGWLDVKAFDM
fig|882097.3.peg.1047   Listeria monocytogenes SLCC2376     INKKWMKIVMIPMLVVPMYGLTTVGGQLQDSLTGKNSFVKDAEAATTASQQAFIDKIAPAAQASQEQY−−−HLLSSITLAQAILESGWGKSGLAT−−−−−−KGYNLFGIKGKYNGQSVIMSTSEYVNGQWIKVDAEFRKYPSWNESVTDHTLLLVNG−−TSWNKNLYKKVVDATDYKVAA−−−MELQKAGY−−−ATS−−−−−−−PTYGASLIQVIENY−−−−−−−−−−−DLAKYDVLYDKILTQKSTSGKATV−−−−TSPTGNGVWTLP−−YKVKGVKSVSPASTYANKDID−−−LVSVATTKRGTYYQFKYNGKVVGWVDAKAL−−TIYDSVNY−−−DKVNVGRAKITSPVSNGIWS−−−KPYNVYGREFVTNATTYAQQEIKLLREAQTAKGTY−−YQFSINNKTIGWIDKRALTIYPYDSIVSSKNVSLDGQITNPTGNGIWSKAYKLEGTTSVAP−−−ASNYANQDVNINQQIETQHG−−−IYYNININGKNIGWL−−−DQKAITLYD−−−EEEYNKAVSFDGTIKNVKSNTIWTK−−−−−−−−−−−PYRTVGT−−KSVG−−−−−−−−−−−PAETYLNKDVQIIREAKTPKGIYYQFKSSGKVIGWLDQKAFDV
fig|563174.3.peg.1116   Listeria monocytogenes L99     INKKWMKIVMIPMLVVPMYGLTTVGGQLQDSLTGKNSFVKDAEAATTASQQAFIDKIAPAAQASQEQY−−−HLLSSITLAQAILESGWGKSGLAT−−−−−−KGYNLFGIKGKYNGQSVIMSTSEYVNGQWIKVDAEFRKYPSWNESVTDHTLLLVNG−−TSWNKNLYKKVVDATDYKVAA−−−MELQKAGY−−−ATS−−−−−−−PTYGASLIQVIENY−−−−−−−−−−−DLAKYDVLYDKILTQKSISGKATV−−−−TSPTGNGVWTLP−−YKVKGVKSVSPASTYANKDID−−−LVSVATTKRGTYYQFKYNGKVVGWVDAKAL−−TIYDSVNY−−−DKVNVGRAKITSPVSNGIWS−−−KPYNVYGREFVTNATTYAQQEIKLLREAQTAKGTY−−YQFSINNKTIGWIDKRALTIYPYDSIVSSKNVSLDGQITNPTGNGIWSKAYKLEGTTSVAP−−−ASNYANQDVNINQQIETQHG−−−IYYNININGKNIGWL−−−DQKAITLYD−−−EEEYNKAVSFDGTIKNVKSNTIWTK−−−−−−−−−−−PYRTVGT−−KSVG−−−−−−−−−−−PAETYLNKDVQIIREAKTPKGIYYQFKSSGKVIGWLDQKAFDV
fig|386043.9.peg.1060   Listeria welshimeri serovar 6b str. SLCC5334     INKKWMKIVMIPMLVVPMYGVTTLGSQLQDSLTGKNSFVKDVEAATTEQQTFINKLAPAAQASQEKY−−−KLLSSITLAQGILESNWGKSGLAT−−−−−−KGNNLFGIKGKYNNQSVIMQTSEYVNGQWIKVDAEFRKYPSWNESVTDHTLLLVNG−−TSWNRDLYKKVVNATDYKVAA−−−NELQKAGY−−−ATD−−−−−−−PNYASSLIRVIETY−−−−−−−−−−−DLAKYDVLYDKILTQKSISEKATV−−−−TNPTGNGIWSLP−−YKVKGVASVGPASGYANKDID−−−LISVATTKRGTYYQFKYNGKVIGWLDGKAL−−TIYDKVNY−−−DKSYVGRAKISSPTSNGIWS−−−KPYNIYGREFVANATTYAQQEIKLLREAQTAKGTY−−YQFSINNKIIGWIDKRALTIYPYDSIISSKNVNLAGQITNPTGNGIWSKAYKLEGTTSVAP−−−ASKYANQDVNINQQIETQHG−−−SYYNISINGKNIGWL−−−DQKALTLYD−−−VEEYNKAVSFDGTIKNVKSNTIWTK−−−−−−−−−−−PYRTVGT−−KSVG−−−−−−−−−−−PAEAYLNKDVQIIREAKTPKGTYYQFKSAGKVIGWLDQKAFEI
fig|349519.10.peg.1415   Leuconostoc citreum KM20                                                                                                          KGYQLAGMSNQYKGQQVIIAGVANVSGKDWSLISFNGTQY−−WIDSQALNTNF−−−−−−−−−THDMNQKVFVNTTSNLDGLFLNAPYRQPGYKLAGLA−−−−−−−KNYNNQTVTVSQQYFDDQGTVWSQVVLGGQTVWVDNHALAQMQVSDTSQQLYVNSNGRNDGLFLNAP−−YRGQGSQLIGMTADYNGQHVQ−−−VTKQGQDAYGAQWRLITLNNQQVWVDSRALSTTIMQAMND−−−DMYVNSNQRTDGLWLN−−−−−−APYTMSGAKWAGDTRSANG−−−RYVHISKAYSNEVGNTYYLTNLNGQSTWIDKRAFTATFDQVVALNAT−−−−IVARQRPDGMFKTAPYGEAGAQFVDY−−−VTNYNQQTVPVTKQHSDAQGN−−−QWYLATVNGTQYWI−−−DQRSF−−−−−−−SPVVTKVVDYQAKIVPRTTRDGVFSGA−−−−−−−−−−PYGEVNA−−KLVN−−−−−−−−−−−MATAYQNQVVHATGEYTNASGITWSQFALSGQEDKLWIDKRALQ 
fig|387344.13.peg.667   Lactobacillus brevis ATCC 367                                            KGTSHAATTDPQTFISTLKSPVTTVANQY−−−KLYPSVMMAQAALESAWGTSTLTT−−−−−−TANNYFGIKGSYNGASVTMKTAEYDSNGQLYYTNANFRKYPSAKASMTDNAKLLRNG−−TSYNTSIYSGTWRENAATYADA−−−ANALTGTY−−−ATA−−−−−−−PTYGSSLISIIKQY−−−−−−−−−−−GL−−−NTLLDASASDSSSSNSNSG−−−−STPKPKPVVYSKATYYGASGTQTARLSGQYATYRLYNHVKGTRANITKTAWSKVAAGKNVLVYLDMRGV−−KKDASTGK−−−KTTWYRIRFAKNTSAKKY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WVYTKALTLPTVKYTSGTAAVKVNNTVSGSYYDHVFNSPYLAKSMGALNK−−−LT−−AKSYVADKQAIKTQDGYKSTWYRIKVGKQAYWIAATETAAAPQYD−−−AVTYSAASGTKKLSAKYSKYTLYNHVKKTHFNQKTYKWPAGSK−−KGTK−−−−−−−−−−−VTVNFKGVK−−−−−−−TAYKTTWYRIQFNGSQTNYWVDARAL  
fig|333990.5.peg.1313   Carnobacterium sp. AT7                          INVTKAAYEKYLNDNKGNNQAQPRPFKTNQEFIDFITPYAVEIANAYGKDKLYASVMIAQAAHESAFGQSLLAS−−−−−−PPYYNLFGIKGSYNGQTIPMGTWEDVNGGIINITANFRDYPSYYESMMDYADLLRTG−−LTGSPNFYAKAWVKNTNSYKDA−−−TKYLTGTY−−−ATD−−−−−−−TQYNIKVNNIIEQY−−−−−−−−−−−NLTQYDTYIVDTELKNTVNVSYDA−−−−LISLNGYTIDTKP−−WGTSGFQNVDKTNTYLGTNVQ−−−VVKE−−TTNGKYGLISYNGTILGWVDKKTL−−EISVNIED−−−VSSSVPVSYKAKISKSGYSIDTLPWGTSGYQTLAKSTDYVGQEIEVVK−−−EAKNGTY−−SLISLNGELLGWIDSKAISTYDVEVNIPASHTTSYEAIINETGYSIDTKPWGTSGYYTLNH−−−TSDYLGRTIEVVKE−−−TDNN−−−QYVLVSHDGKSLGWV−−−DKKALKTYEVVTNVSSSQPVNYKAVVDKTSYSIDTM−−−−−−−−−−−PWGTAGY−−QTIA−−−−−−−−−−−KTTDYIGTEVDVIRK−−−−KGSYVLISVNGEAIGWVDQKALKS
fig|683837.3.peg.2497   Listeria seeligeri serovar 1/2b str. SLCC3954     MNKKLIKSGIIMLILAFFVLSINVGAETGDI−−−−−−−−EDSQIALSSQQQAFIDEILPAAQEGLRDE−−−KLLTSVTLAQAILESNWGESGLSK−−−−−−KSNNLFGIKGDYKGKSVSMATMEASGP−−−−TTANFRVYPSWKESIEDHTDLITNS−−−−−−−ERYKGAVGETDYRKAL−−−QEIKDGGY−−−ATD−−−−−−−PGYVDKLATIIERY−−−−−−−−−−−NLTQYDVVYDEIESHHKIAAIGKV−−−−APNKSQEIIWSAP−−YHTINSEKIGTLENYSNRNLE−−−ISWQAKTKNGLWYFIRENNKDVGWVNSTAL−−NLTYHQNE−−−NEDVSLTKYVDDLNAHVYR−−−−−−−LPSPEKQFDKGSIASYDRKALHADKKITRDGYAWFRLSEGDSEIGWVRADKLNDRLYDRITEQNVYSGYANVENSATDSVWTKPYNTKNAEKIAP−−−LSDYTKAKLELVTRAKVGNT−−−LWYQFKVDGHLVGWA−−−SEKDLNIIY−−−TPNSEKPTTQVAYVKSPEAIIYNK−−−−−−−−−−−PVETTSTELKEVG−−−−−−−−−−−−−−FYYGKLLSVDKEATVLSERWLHLKDNENSLGWIKATDIQS
fig|272626.1.peg.2720   Listeria innocua Clip11262     MERKFIKPGIILLIVAFLVVSLNVGAETGNS−−−−−−−−RVAQNSLTSSQQAFIDEILPAAEDGYRDG−−−KLLTSVTLAQAILESNWGKSGLSK−−−−−−NSNNLFGIKGQYEGKSISMGTMEASGA−−−−TTADFRVYPSWKESIEDHTNLITQN−−−−−−−ARYQGAVGETDYRKAL−−−QAIKDGGY−−−ATA−−−−−−−PDYVSKLVAIIERY−−−−−−−−−−−NLDQYDVVYDKIEYQNKIAAIGTV−−−−NANKEQETIWSAP−−FNTTNSEEVGTLANYTNRNLE−−−ISWEAKTEKGLWYFLRENNKDIGWVNSSAL−−TLSYHQNN−−−DENVDTTKYVDDLNAHIYR−−−−−−−LPNPEQQFDNGTIAKYDRKALHADKKITRDGYAWFRLSESSKVIGWVRSDKLNDRLYDRITEQNSFDGYATVSKSATDNVWSAPFNTKNAEKLAP−−−LSDYDTQKLELVTRAKVGNT−−−LWYEFKIDGEVVGWV−−−SEKDVNIIY−−−TPEAEKPITQVSYLKNPAAMLYNK−−−−−−−−−−−PVEATSAETKAVG−−−−−−−−−−−−−−FYYGKLLIVDKEATIQDEQWVHIKENNNSLGWIKATDIQS
fig|386043.9.peg.2549   Listeria welshimeri serovar 6b str. SLCC5334     MERKFIKTGIIMLIVAFLVVSLNVGAETGNS−−−−−−−−RTAQVALSSSQQSFIDEILPAAQDGYQNG−−−KLLTSVTLAQAILESNWGESGLSK−−−−−−NSNNLFGIKGTYEGKSVSMDTMEASGA−−−−TTANFRVYPSWKESIEDHTDLITQN−−−−−−−DRYKGAVGETDYRKSL−−−QAIKDGGY−−−ATD−−−−−−−PEYVSKLVAIIERY−−−−−−−−−−−NLDQYDIVYDKIESHHKVAAIGTV−−−−SPNKTQETIWSAP−−FNTANSEEVGKLASYSNRNLE−−−VSWEAKTEKGLWYFLRENNKDIGWVNSNAL−−NLSYHQKN−−−DENINATKYVDDMGAHIYR−−−−−−−LPSPEKQFDNGTIAQYDKKTLHADKKITRDGYAWFRLSESNEVIGWVRADKLNDRLYDRITEQTTYNGYATVNKAATDNVWSAPFNTKNSNKIAP−−−LTDYNAAKLELVSRAKVANT−−−IWYEFKLDGKLIGWT−−−SEKDLNIIY−−−TPENEKPTTQVAYVKNPTAMLYNK−−−−−−−−−−−PVETTSTQTKEIG−−−−−−−−−−−−−−FYYGKLLAVDKEATIQAEKWVHIKDSNNSLGWIKAEDIQR
fig|882097.3.peg.2485   Listeria monocytogenes SLCC2376     MDRKFIKPGIILLIVAFLVVSINVGAETGGN−−−−−−−−RTAQAHLTTSQQAFIDKILPAAQDGYRDG−−−KLLTSVTLAQAILESNWGESGLSQ−−−−−−NSNNLFGIKGAYEGNSVSMGTMEASGA−−−−TTANFRVYPSWKESIEDHTALITEN−−−−−−−ERYQGAVGETDYRKAL−−−QAIKDGGY−−−ATD−−−−−−−PDYVSKLVAIIERY−−−−−−−−−−−NLDAYDVIYDKIESNQALKAIGTV−−−−ADTKEQEVIYSAP−−YNTENASEVGTLKNYTGRNLE−−−ISWEAKTEKGLWYFIRENNEDIGWVNSSAL−−NISYHQKE−−−DENVQLTKYVDDLNAHIYR−−−−−−−LPNPEKQFDNGTIAKYDRKALQADKKITRGGYAWFRLSEGGETIGWVRADKLNDRLFDRITEQTSYDGYAIVSKSATDNVWSEPFNTKNAEKLAP−−−LTDYDNEKLELVTRAKVGNT−−−LWYQFKLDGKVVGWA−−−SEKDLNVFY−−−TPAKEEPVKQVAYVKDPTAKLYNK−−−−−−−−−−−PVESTSTNPKAVG−−−−−−−−−−−−−−FYYGKLLAVDKTANILGEDWLHVKDSHNSLGWIKANDING
fig|563174.3.peg.2673   Listeria monocytogenes L99     MDRKFIKPGIILLIVAFLVVSINVGAETGGN−−−−−−−−RTAQANLTTSQQAFIDEILPAAQDGYRDG−−−KLLTSVTLAQAILESNWGESGLSQ−−−−−−NSNNLFGIKGAYEGKSVSMGTMEASGA−−−−TTANFRVYPSWKESIEDHTALITEN−−−−−−−ERYQGAVGETDYRKAL−−−QAIKDGGY−−−ATD−−−−−−−PDYVSKLVAIIERY−−−−−−−−−−−NLDAYDVIYDKIESNQALTAIGTV−−−−ADTKEQEVIYSAP−−YNTENASEVGTLKNYTGRNLE−−−ISWEAKTGKGLWYFIRENNEDIGWVNSSAL−−NISYHQKE−−−DENVQLTKYVDDLNAHIYR−−−−−−−LPNPEKQFDNGTIAKYDRKALQADKKITRGGYAWFRLSEGGETIGWVRADKLNDRLFDRITEQTSYDGYAIVSKSATDNVWSEPFNTKNAEKLAP−−−LTDYDNEKLELVTRAKVGNT−−−LWYQFKLDGKVVGWA−−−SEKDLNVFY−−−TPAKEEPVKQVAYVKDPTAKLYNK−−−−−−−−−−−PVESTSTNPKAVG−−−−−−−−−−−−−−FYYGKLLAVDKTANILGEDWLHVKDSHNSLGWIKANDING
fig|637381.3.peg.271   Listeria monocytogenes 08-5923     MDRKFIKPGIILLIVAFLVVSINVGAETGGS−−−−−−−−RTAQVNLTTSQQAFIDEILPAAQDGYRDG−−−KLLTSVTLAQAILESNWGESGLSQ−−−−−−NSNNLFGIKGTYKGKSVSMGTMEASGS−−−−TTANFRVYPSWKESIEDHTALITEN−−−−−−−ARYQDAVDETDYRKAL−−−QAIKDGGY−−−ATD−−−−−−−PDYVSKLVAIIERY−−−−−−−−−−−NLDKYDVIYDKIESNQSLAAIGTV−−−−AENKKQEVIWSAP−−YNTENANKIGTLENYSGRNLE−−−ISWEAKTEKGLWYFIRENNKDIGWINSNAL−−KISYHQKE−−−DENVHLTKYVDDLSAHVYR−−−−−−−LPSPEKQFDNGTIAKYDRKALEADKKITRGGYAWFRISEGEKVIGWVRADKLNDRLYDRITEQTSYDGYALVSKSATDNVWTAPFNTKNAEKLAP−−−LADYNNEKLEIVTRAKAGNT−−−LWYQFKVDGKLVGWA−−−SEKDLNVFY−−−TPAKEEPVKQVAYVKDPTAKLYNK−−−−−−−−−−−PVESTSTNPKAVG−−−−−−−−−−−−−−FYYGKLLAVDKTATILGEDWLHLKDSQNSLGWIKAIDINS
fig|932920.3.peg.2730   Listeria monocytogenes serotype 1/2c str. SLCC2372     MDRKFIKPGIILLIVAFLVVSINVGAETGGS−−−−−−−−RTAQVNLTTSQQAFIDEILPAAQDGYRDG−−−KLLTSVTLAQAILESNWGESGLSQ−−−−−−NSKNLFGIKGTYKGKSVSMGTMEASGS−−−−TTANFRVYPSWKESIEDHTALITEN−−−−−−−ARYQDAVDETDYRKAL−−−QAIKDGGY−−−ATD−−−−−−−PDYVSKLVAIIERY−−−−−−−−−−−NLDKYDVIYDKIESNQSLAAIGTV−−−−AENKKQEVIWSAP−−YNTENANKIGTLENYSGRNLE−−−ISWEAKTEKGLWYFIRENNKDIGWINSNAL−−KISYHQKE−−−DENVHLTKYVDDLSAHVYR−−−−−−−LPSPEKQFDNGTIAKYDRKALQVDKKITRGGYAWFRISEGEKVIGWVRADKLNDRLYDRITEQTSYDGYALVSKSATDNVWTAPFNTKNAEKLAP−−−LADYNNEKLEIVTRAKAGNT−−−LWYQFKVDGKLVGWA−−−SEKDLNVFY−−−TTAKEEPVKQVAYVKDPTAKLYNK−−−−−−−−−−−PVESTSTNPKAVG−−−−−−−−−−−−−−FYYGKLLAVDKTATILGEDWLHLKDSQNSLGWIKAIDINS
fig|393127.4.peg.1216   Listeria monocytogenes Finland 1988     MDRKFIKPGIILLIVAFLVVSINVGAETGGS−−−−−−−−RTAQVNLTTSQQAFIDEILPAAQDGYRDD−−−KLLTSVTLAQAILESNWGESGLSQ−−−−−−NSNNLFGIKGTYKGKSVSMGTMEASGS−−−−TTANFRVYPSWKESIEDHTALITEN−−−−−−−ARYQDAVGETNYRKAL−−−QAIKDGGY−−−ATD−−−−−−−PDYVSKLVAIIERY−−−−−−−−−−−NLDKYDVIYDKIDSNQSLAAIGTV−−−−AENKKQEVIWSAP−−YNTEDANKIGTLENYSGRNLE−−−ISWEAKTEKGLWYFIRENNKDIGWVNSNAL−−KINYHQKE−−−DENVHLTKYVDDLSAHVYR−−−−−−−LPSPEKQFDNGTIAKYDRKALQVDKKITRGGYAWFRISEGEKVIGWVRADKLNDRLYDRITEQTSYDGYALVSKSATDNVWTAPFNTKNAEKLAP−−−LADYNNEKLEIVTRAKAGNT−−−LWYQFKVDGKLVGWA−−−SEKDLNVFY−−−TPAKEEPVKQVAYVKDPTVKLYNK−−−−−−−−−−−PVESTSTNPKAVG−−−−−−−−−−−−−−FYYGKLLAVDKTATILGEDWLHLKDSQNSLGWIKAIDINS
fig|267409.5.peg.2445   Listeria monocytogenes str. 1/2a F6854     MDRKFIKPGIILLIVAFLVVSINVGAETGGS−−−−−−−−RTAQVNLTTSQQAFIDEILPAAQDGYRDG−−−KLLTSVTLAQAILESNWGESGLSQ−−−−−−NSNNLFGIKGTYKGKSVSMGTMEASGS−−−−TTANFRVYPSWKESIEDHTALITEN−−−−−−−ARYQDAVGETNYRKAL−−−QAIKDGGY−−−ATD−−−−−−−PDYVSKLVAIIERY−−−−−−−−−−−NLDKYDVIYDKIDSNQSLAAIGTV−−−−AENKKQEVIWSAP−−YNTEDANKIGTLENYSGRNLE−−−ISWEAKTEKGLWYFIRENNKDIGWVNSNAL−−KINYHQKE−−−DENVHLTKYVDDLSAHVYR−−−−−−−LPSPEKQFDNGTIAKYDRKALQVDKKITRGGYAWFRISEGEKVIGWVRADKLNDRLYDRITEQTSYDGYALVSKSATDNVWTAPFNTKNAEKLAP−−−LADYNNEKLEIVTRAKAGNT−−−LWYQFKVDGKLVGWA−−−SEKDLNVFY−−−TPAKEEPVKQVAYVKDPTAKLYNK−−−−−−−−−−−PVESTSTNPKAVG−−−−−−−−−−−−−−FYYGKLLAVDKTATILGEDWLHLKDSQNSLGWIKAIDINS
fig|879090.3.peg.2577   Listeria monocytogenes SLCC7179     MDRKFIKPGIILLIVAFLVVSINVGAETGGS−−−−−−−−RTAQVNLTTSQQAFIDEILPAAQDGYRDG−−−KLLTSVTLAQAILESNWGESGLSQ−−−−−−NSNNLFGIKGTYKGKSVSMGTMEASGS−−−−TTANFRVYPSWKESIEDHTALITEN−−−−−−−ARYQDAVGETNYRKAL−−−QAIKDGGY−−−ATD−−−−−−−PDYVSKLVAIIERY−−−−−−−−−−−NLDKYDVIYDKIESNQSLAAIGTV−−−−AENKEQEVIWSAP−−YNTENANKIETLENYSGRNLE−−−ISWEAKTEKGLWYFIRENNKDIGWVNSNAL−−KISYHQKE−−−DENVHLTKYVDDLSAHVYR−−−−−−−LPSPEKQFDNGTIAKYDRKALQVDKKITRGGYAWFRISEGEKVIGWVRADKLNDRLYDRITEQTSYDGYALVSKSATDNVWTAPFNTKNAEKLAP−−−LADYNNEKLEIVTRAKAGNT−−−LWYQFKVDGKLVGWA−−−SEKDLNVFY−−−TPAKEEPVKQVAYVKDPTAKLYNK−−−−−−−−−−−PVESTSTNPKAVG−−−−−−−−−−−−−−FYYGKLLAVDKTATILGEDWLHLKDSQNSLGWIKAIDINS
fig|393133.3.peg.2680   Listeria monocytogenes 10403S     MDRKFIKPGIILLIVAFLVVSINVGAETGGS−−−−−−−−RTAQVNLTTSQQAFIDEILPAAQDGYRDG−−−KLLTSVTLAQAILESNWGESGLSQ−−−−−−NSNNLFGIKGTYKGKSVSMGTMEASGS−−−−TTANFRVYPSWKESIEDHTALITEN−−−−−−−ARYQDAVGETNYRKAL−−−QAIKDGGY−−−ATD−−−−−−−PDYVSKLVAIIERY−−−−−−−−−−−NLDKYDVIYDKIDSNQSLAAIGTV−−−−AENKKQEVIWSAP−−YNTENANKIGTLENYSGRNLE−−−ISWEAKTEKGLWYFIREKNKDIGWINSNAL−−KISYHQKE−−−DENVHLTKYVDDLSAHVYR−−−−−−−LPSPEKQFDNGTIAKYDRKALEADKKITRGGYAWFRISEGEKVIGWVRADKLNDRLYDRITEQTSYDGYALVSKSATDNVWTAPFNTKNAEKLAP−−−LADYDNEKLELVTRAKAGNT−−−LWYQFKVDGKLVGWA−−−SEKDLNVFY−−−TPAKEEPVKQVAYVKDPTAKLYNK−−−−−−−−−−−PVESTSTNPKAVG−−−−−−−−−−−−−−FYYGKLLAVDKTATILGEDWLHLKDSQNSLGWIKAIDINS
fig|393117.3.peg.2878   Listeria monocytogenes FSL J1-194     MDRKFIKPGIILLIVAFLVVSINVGAETGGS−−−−−−−−RTAQVNLTTSQQAFIDEILPAAQDGYRDG−−−KLLTSVTLAQAILESNWGESGLSQ−−−−−−NSNNLFGIKGTYKGKSVSMGTMEASGS−−−−TTANFRVYPSWKESIEDHTALITEN−−−−−−−ARYQDAVGETNYRKAL−−−QAIKDGGY−−−ATD−−−−−−−PDYVSKLVAIIERY−−−−−−−−−−−NLDKYDVIYDKIESNQSLAAIGTV−−−−AENKEQEVIWSAP−−YNTENANKIGTLENYLGRNLE−−−ISWEAKTEKGLWYFIRENNKDIGWINSNAL−−KISYHQKE−−−DENVHLTKYVDDLSAHVYR−−−−−−−LPSPEKQFDNGTIAKYDRKALEVDKKTTRGGYAWFRISEGEKVIGWVRADKLNDRLYDRITEQTSYDGYALVSKSATDNVWTAPFNTKNAEKLAP−−−LADYDNEKLELVTRAKAGNT−−−LWYQFKVDGKLVGWA−−−SEKDLNVFY−−−TPAKEEPVKQVAYVKDPTAKLYNK−−−−−−−−−−−PVESTSTNPKAVG−−−−−−−−−−−−−−FYYGKLLAVDKTATILGEDWLHLKDRQNSLGWIKAIDINS
fig|401650.3.peg.2647   Listeria monocytogenes Aureli 1997     MDRKFIKPGIILLIVAFLVVSINVGAETGGS−−−−−−−−RTAQVNLTTSQQAFIDEILPAAQDGYRDG−−−KLLTSVTLAQAILESNWGESGLSQ−−−−−−NSNNLFGIKGTYKGKSVSMGTMEASGS−−−−TTANFRVYPSWKESIEDHTALITEN−−−−−−−ARYQDAVGETNYRKAL−−−QAIKDGGY−−−ATD−−−−−−−PDYVSKLVAIIERY−−−−−−−−−−−NLDKYDVIYDKIESNQSLAAIGTV−−−−AENKEQEVIWSAP−−YNTENANKIGTLENYLGRNLE−−−ISWEAKTEKGLWYFIRENNKDIGWINSNAL−−KISYHQKE−−−DENVHLTKYVDDLSAHVYR−−−−−−−LPSPEKQFDNGTIAKYDRKALEVDKKITRGGYAWFRISEGEKVIGWVRADKLNDRLYDRITEQTSYDGYALVSKSATDNVWTAPFNTKNAEKLAP−−−LADYDNEKLELVTRAKAGNT−−−LWYQFKVDGKLVGWA−−−SEKDLNVFY−−−TPAKEEPVKQVAYVKDPTAKLYNK−−−−−−−−−−−PVESTSTNPKAVG−−−−−−−−−−−−−−FYYGKLLAVDKTATILGEDWLHLKDRQNSLGWIKAIDINS
fig|1126011.4.peg.2567   Listeria monocytogenes 07PF0776     MDRKFIKPGIILLIVAFLVVSINVGAETGGS−−−−−−−−RTAQVNLTTSQQAFIDEILPAAQDGYRDG−−−KLLTSVTLAQAILESNWGESGLSQ−−−−−−NSNNLFGIKGTYKGESVSMGTMEASGS−−−−TTANFRVYPSWKESIEDHTALITEN−−−−−−−ARYQDAVGETNYRKAL−−−QAIKDGGY−−−ATD−−−−−−−PDYVSKLVAIIERY−−−−−−−−−−−NLDKYDVIYDKIESNQSLAAIGTV−−−−AENKEQEVIWSAP−−YNTENANKIGTLENYLGRNLE−−−ISWEAKTEKGLWYFIRENNKDIGWINSNAL−−KISYHQKE−−−DENVHLTKYVDDLSAHVYR−−−−−−−LPSPEKQFDNGTIAKYDRKALEVDKKITRGGYAWFRISEGEKVIGWVRADKLNDRLYDRITEQTSYDGYALVSKSATDNVWTAPFNTKNAEKLAP−−−LADYDNEKLELVTRAKAGNT−−−LWYQFKVDGKLVGWA−−−SEKDLNVFY−−−TPAKEEPVKQVAYVKDPTAKLYNK−−−−−−−−−−−PVESTSTNPKAVG−−−−−−−−−−−−−−FYYGKLLAVDKTATILGEDWLHLKDRQNSLGWIKAIDINS
fig|267410.6.peg.2063   Listeria monocytogenes str. 4b H7858                                                                             MLTSVTLAQAILESNWGESGLSQ−−−−−−NSNNLFGIKGTYKGESVSMGTMEASGS−−−−TTANFRVYPSWKESIEDHTALITEN−−−−−−−ARYQDAVGETNYRKAL−−−QAIKDGGY−−−ATD−−−−−−−PDYVSKLVAIIERY−−−−−−−−−−−NLDKYDIIYDKIESNQSLAAIGTV−−−−AENKEQEVIWSAP−−YNTENANKIGTLENYLGRNLE−−−ISWEAKTEKGLWYFIRENNKDIGWINSNAL−−KISYHQKE−−−DENVHLTKYVDDLSAHVYR−−−−−−−LPSPEKQFDNGTIAKYDRKALEVDKKITRGGYAWFRISEGEKVIGWVRADKLNDRLYDRITEQTSYDGYALVSKSATDNVWTAPFNTKNAEKLAP−−−FADYDNEKLELVTRAKAGNT−−−LWYQFKVDGKLVGWA−−−SEKDLNVFY−−−TPAKEEPVKQVAYVKDPTAKLYNK−−−−−−−−−−−PVESTSTNPKAVG−−−−−−−−−−−−−−FYYGKLLAVDKTATILGEDWLHLKDRQNSLGWIKAIDINS
fig|1639.165.peg.2674   Listeria monocytogenes serotype 1/2b str. SLCC2755     MDRKFIKPGIILLIVAFLVVSINVGAETGGS−−−−−−−−RTGQVNLTTSQQAFIDEILPAAQDGYRDG−−−KLLTSVTLAQAILESNWGESGLSQ−−−−−−NSNNLFGIKGTYKGESVSMGTMEASGS−−−−TTANFRVYPSWKESIEDHTALITEN−−−−−−−ARYQDAVGETNYRKAL−−−QAIKDGGY−−−ATD−−−−−−−PDYVSKLVAIIERY−−−−−−−−−−−NLDKYDVIYDKIESNQSLAAIGTV−−−−AENKEQEVIWSAP−−YNTENANKIGTLENYLGRNLE−−−ISWEAKTEKGLWYFIRENNKDIGWINSNAL−−KISYHQKE−−−DENVHLTKYVDDLSAHVYR−−−−−−−LPSPEKQFDNGTIAKYDRKALEVDKKITRGGYAWFRISEGEKVIGWVRADKLNDRLYDRITEQTSYDGYALVSKSATDNVWTAPFNTKNAEKLAP−−−LADYDNEKLELVTRAKAGNT−−−LWYQFKVDGKLVGWA−−−SEKDLNVFY−−−TPAKEEPVKQVAYVKDPTAKLYNK−−−−−−−−−−−PVESTSTNPKAVG−−−−−−−−−−−−−−FYYGKLLAVDKTATILGEDWLHLKDRQNSLGWIKAIDINS