(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00007202

fig|470137.4.peg.1801   Brucella suis ATCC 23445         AKKFAGLDLGSLLSGGAAYPSAVAGGASPTSGAATGTTPTTGATVDL−−SGDKQKFIDTLLPAAIEHGQRIGVDPRIIVAQAAQETGWGRSA−−−−−−−−−PGNNFFGIKS−−HGQGGGQNLTTHEVINGQRVKINDSFRTFASPQDSVAGYADFIASNK−−−−−−−RYRPMR−−−EAQGLDAQLQALGASGYATDPNYA−−−−−−−RSVGAIARSINLP−−−−−QQAQPQGVQVASLDPSIGMAQAYAPE−−−−−−−−−−−PQPQTAA−−−−−−−−−−−−−−−AAINQIAPQQ−−−−−−−−−−−−−−PVPEA−−−−−−−−−−−−−−−−−−−−−−−−KISDA−−−−−LLRQNDMALG−−−−−−−−−−−−−−−−−−−−−−GALAPQGQAPQQVADTSG−−YFPAAPSADSAPIMGSYAAPRQGGVNIQRLLEAA−−−−SDPWMNDAQR−−SVIGMALQQQMQ−−−−−−QNDPMRALQAQ
fig|224914.16.peg.95   Brucella melitensis bv. 1 str. 16M [WGS]         AKKFAGLDLGSLLSGGAAYPSAVAGGASPTSGAATGTTPTTGATVDL−−SGDKQKFIDTLLPAAIEHGQRIGVDPRIIVAQAAQETGWGRSA−−−−−−−−−PGNNFFGIKS−−HGQGGGQNLTTHEVINGQRVKINDSFRTFASPQDSVAGYADFIASNK−−−−−−−RYRPMR−−−EAQGLDAQLQALGASGYATDPNYA−−−−−−−RSVGAIARSINLP−−−−−QQAQPQGVQVASLDPSIGMAQAYAPE−−−−−−−−−−−PQPQTAA−−−−−−−−−−−−−−−AAINQIAPQQ−−−−−−−−−−−−−−PVPEA−−−−−−−−−−−−−−−−−−−−−−−−KISDA−−−−−LLRQNDMALG−−−−−−−−−−−−−−−−−−−−−−GALAPQGQAPQQVADTSG−−YFPAAPSADSAPIMGSYAAPRQGGVNIQRLLEAA−−−−SDPWMNDAQR−−SVIGMALQQQMQ−−−−−−QNDPMRALQAQ
fig|1160196.3.peg.192   Brucella abortus 90/50         AKKFAGLDLGSLLSGGAAYPSAVAGGASPTSGAATGTTPTTGATVDL−−SGDKQKFIDTLLPAAIEHGQRIGVDPRIIVAQAAQETGWGRSA−−−−−−−−−PGNNFFGIKS−−HGQGGGQNLTTHEVINGQRVKINDSFRTFASPQDSVAGYADFIASNK−−−−−−−RYRPMR−−−EAQGLDAQLQALGASGYATDPNYA−−−−−−−RSVGAIARSINLP−−−−−QQAQPQGVQVASLDPSIGMAQAYAPE−−−−−−−−−−−PQPQTAA−−−−−−−−−−−−−−−AAINQIAPQQ−−−−−−−−−−−−−−PVPEA−−−−−−−−−−−−−−−−−−−−−−−−KISDA−−−−−LLRQNDMALG−−−−−−−−−−−−−−−−−−−−−−GALAPQGQAPQQVADTSG−−YFPAAPSADSAPIMGSYAAPRQGGVNIQRLLEAA−−−−SDPWMNDAQR−−SVIGMALQQQMQ−−−−−−QNDPMRALQAQ
fig|262698.3.peg.768   Brucella abortus biovar 1 str. 9-941         AKKFAGLDLGSLLSGGAAYPSAVAGGASPTSGAATGTTPTTGATVDL−−SGDKQKFIDTLLPAAIEHGQRIGVDPRIIVAQAAQETGWGRSA−−−−−−−−−PGNNFFGIKS−−HGQGGGQNLTTHEVINGQRVKINDSFRTFASPQDSVAGYADFIASNK−−−−−−−RYRPMR−−−EAQGLDAQLQALGASGYATDPNYA−−−−−−−RSVGAIARSINLP−−−−−QQAQPQGVQVASLDPSIGMAQAYAPE−−−−−−−−−−−PQPQTAA−−−−−−−−−−−−−−−AAINQIAPQQ−−−−−−−−−−−−−−PVPEA−−−−−−−−−−−−−−−−−−−−−−−−KISDA−−−−−LLRQNDMALG−−−−−−−−−−−−−−−−−−−−−−GALAPQGQAPQQVADTSG−−YFPAAPSADSAPIMGSYAAPRQGGVNIQRLLEAA−−−−SDPWMNDAQR−−SVIGMALQQQMQ−−−−−−QNDPMRALQAQ
fig|1210453.3.peg.1790   Brucella suis S2-30         AKKFAGLDLGSLLSGGAAYPSAVAGGASPTSGAATGTTPTTGATVDL−−SGDKQKFIDTLLPAAIEHGQRIGVDPRIIVAQAAQETGWGRSA−−−−−−−−−PGNNFFGIKS−−HGQGGGQNLTTHEVINGQRVKINDSFRTFASPQDSVAGYADFIASNK−−−−−−−RYRPMR−−−EAQGLDAQLQALGASGYATDPNYA−−−−−−−RSVGAIARSINLP−−−−−QQAQPQGVQVASLDPSIGMAQAYAPE−−−−−−−−−−−PQPQTAA−−−−−−−−−−−−−−−AAINQIAPQQ−−−−−−−−−−−−−−PVPEA−−−−−−−−−−−−−−−−−−−−−−−−KISDA−−−−−LLRQNDMALG−−−−−−−−−−−−−−−−−−−−−−GALAPQGQAPQQVADTSG−−YFPAAPSADSAPIMGSYAAPRQGGVNIQRLLEAA−−−−SDPWMNDAQR−−SVIGMALQQQMQ−−−−−−QNDPMRALQAQ
fig|1247411.3.peg.1386   Brucella melitensis B115         AKKFAGLDLGSLLSGGAAYPSAVAGGASPTSGAATGTTPTTGATVDL−−SGDKQKFIDTLLPAAIEHGQRIGVDPRIIVAQAAQETGWGRSA−−−−−−−−−PGNNFFGIKS−−HGQGGGQNLTTHEVINGQRVKINDSFRTFASPQDSVAGYADFIASNK−−−−−−−RYRPMR−−−EAQGLDAQLQALGASGYATDPNYA−−−−−−−RSVGAIARSINLP−−−−−QQAQPQGVQVASLDPSIGMAQAYAPE−−−−−−−−−−−PQPQTAA−−−−−−−−−−−−−−−AAINQIAPQQ−−−−−−−−−−−−−−PVPEA−−−−−−−−−−−−−−−−−−−−−−−−KISDA−−−−−LLRQNDMALG−−−−−−−−−−−−−−−−−−−−−−GALAPQGQAPQQVADTSG−−YFPAAPSADSAPIMGSYAAPRQGGVNIQRLLEAA−−−−SDPWMNDAQR−−SVIGMALQQQMQ−−−−−−QNDPMRALQAQ
fig|470137.3.peg.1638   Brucella suis ATCC 23445         AKKFAGLDLGSLLSGGAAYPSAVAGGASPTSGAATGTTPTTGATVDL−−SGDKQKFIDTLLPAAIEHGQRIGVDPRIIVAQAAQETGWGRSA−−−−−−−−−PGNNFFGIKS−−HGQGGGQNLTTHEVINGQRVKINDSFRTFASPQDSVAGYADFIASNK−−−−−−−RYRPMR−−−EAQGLDAQLQALGASGYATDPNYA−−−−−−−RSVGAIARSINLP−−−−−QQAQPQGVQVASLDPSIGMAQAYAPE−−−−−−−−−−−PQPQTAA−−−−−−−−−−−−−−−AAINQIAPQQ−−−−−−−−−−−−−−PVPEA−−−−−−−−−−−−−−−−−−−−−−−−KISDA−−−−−LLRQNDMALG−−−−−−−−−−−−−−−−−−−−−−GALAPQGQAPQQVADTSG−−YFPAAPSADSAPIMGSYAAPRQGGVNIQRLLEAA−−−−SDPWMNDAQR−−SVIGMALQQQMQ−−−−−−QNDPMRALQAQ
fig|520489.3.peg.1690   Brucella suis bv. 5 str. 513         AKKFAGLDLGSLLSGGAAYPSAVAGGASPTSGAATGTTPTTGATVDL−−SGDKQKFIDTLLPAAIEHGQRIGVDPRIIVAQAAQETGWGRSA−−−−−−−−−PGNNFFGIKS−−HGQGGGQNLTTHEVINGQRVKINDSFRTFASPQDSVAGYADFIASNK−−−−−−−RYRPMR−−−EAQGLDAQLQALGASGYATDPNYA−−−−−−−RSVGAIARSINLP−−−−−QQAQPQGVQVASLDPSIGMAQAYAPE−−−−−−−−−−−PQPQTAA−−−−−−−−−−−−−−−AAINQIAPQQ−−−−−−−−−−−−−−PVPEA−−−−−−−−−−−−−−−−−−−−−−−−KISDA−−−−−LLRQNDMALG−−−−−−−−−−−−−−−−−−−−−−GALAPQGQAPQQVADTSG−−YFPAAPSADSAPIMGSYAAPRQGGVNIQRLLEAA−−−−SDPWMNDAQR−−SVIGMALQQQMQ−−−−−−QNDPMRALQAQ
fig|520459.3.peg.1341   Brucella ceti M644/93/1         AKKFAGLDLGSLLSGGAAYPSAVAGGASPTSGAATGTTPTTGATVDL−−SGDKQKFIDTLLPAAIEHGQRIGVDPRIIVAQAAQETGWGRSA−−−−−−−−−PGNNFFGIKS−−HGQGGGQNLTTHEVINGQRVKINDSFRTFASPQDSVAGYADFIASNK−−−−−−−RYRPMR−−−EAQGLDAQLQALGASGYATDPNYA−−−−−−−RSVGAIARSINLP−−−−−QQAQPQGVQVASLDPSIGMAQAYAPE−−−−−−−−−−−PQPQTAA−−−−−−−−−−−−−−−AAINQIAPQQ−−−−−−−−−−−−−−PVPEA−−−−−−−−−−−−−−−−−−−−−−−−KISDA−−−−−LLRQNDMALG−−−−−−−−−−−−−−−−−−−−−−GALAPQGQAPQQVADTSG−−YFPAAPSADSAPIMGSYAAPRQGGVNIQRLLEAA−−−−SDPWMNDAQR−−SVIGMALQQQMQ−−−−−−QNDPMRALQAQ
fig|520451.3.peg.2267   Brucella abortus bv. 3 str. Tulya         AKKFAGLDLGSLLSGGAAYPSAVAGGASPTSGAATGTTPTTGATVDL−−SGDKQKFIDTLLPAAIEHGQRIGVDPRIIVAQAAQETGWGRSA−−−−−−−−−PGNNFFGIKS−−HGQGGGQNLTTHEVINGQRVKINDSFRTFASPQDSVAGYADFIASNK−−−−−−−RYRPMR−−−EAQGLDAQLQALGASGYATDPNYA−−−−−−−RSVGAIARSINLP−−−−−QQAQPQGVQVASLDPSIGMAQAYAPE−−−−−−−−−−−PQPQTAA−−−−−−−−−−−−−−−AAINQIAPQQ−−−−−−−−−−−−−−PVPEA−−−−−−−−−−−−−−−−−−−−−−−−KISDA−−−−−LLRQNDMALG−−−−−−−−−−−−−−−−−−−−−−GALAPQGQAPQQVADTSG−−YFPAAPSADSAPIMGSYAAPRQGGVNIQRLLEAA−−−−SDPWMNDAQR−−SVIGMALQQQMQ−−−−−−QNDPMRALQAQ
fig|437685.3.peg.127   Brucella sp. UK5/01         AKKFAGLDLGSLLSGGAAYPSAVAGGASPTSGAATGTTPTTGATVDL−−SGDKQKFIDTLLPAAIEHGQRIGVDPRIIVAQAAQETGWGRSA−−−−−−−−−PGNNFFGIKS−−HGQGGGQNLTTHEVINGQRVKINDSFRTFASPQDSVAGYADFIASNK−−−−−−−RYRPMR−−−EAQGLDAQLQALGASGYATDPKYA−−−−−−−RSVGAIARSINLP−−−−−QQAQPQGVQVASLDPSIGMAQAYAPE−−−−−−−−−−−PQPQTAA−−−−−−−−−−−−−−−AAINQIAPQQ−−−−−−−−−−−−−−PVPEA−−−−−−−−−−−−−−−−−−−−−−−−KISDA−−−−−LLRQNDMALG−−−−−−−−−−−−−−−−−−−−−−GALAPQGQAPQQVADTSG−−YFPAAPSADSAPIMGSYAAPRQGGVNIQRLLEAA−−−−SDPWMNDAQR−−SVIGMALQQQMQ−−−−−−QNDPMRALQAQ
fig|1169228.3.peg.1590   Brucella melitensis UK3/06         AKKFAGLDLGSLLSGGAAYPSAVAGGASPTSGAATGTTPTTGATVDL−−SGDKQKFIDTLLPAAIEHGQRIGVDPRIIVAQAAQETGWGRSA−−−−−−−−−PGNNFFGIKS−−HGQGGGQNLTTHEVINGQRVKINDSFRTFASPQDSVAGYADFIASNK−−−−−−−RYRPMR−−−EAQGLDAQLQALGASGYATDPNYA−−−−−−−RSVGAIARSINLP−−−−−QQAQPQGVQVASLDPSIGMAQAYAPE−−−−−−−−−−−PQPQTAA−−−−−−−−−−−−−−−AAINQIAPQQ−−−−−−−−−−−−−−PVPEA−−−−−−−−−−−−−−−−−−−−−−−−KISDA−−−−−LLRQNDMALG−−−−−−−−−−−−−−−−−−−−−−GALAPQGQAPQQVADTSG−−YFPASPSADSAPIMGSYAAPRQGGVNIQRLLEAA−−−−SDPWMNDAQR−−SVIGMALQQQMQ−−−−−−QNDPMRALQAQ
fig|169963.1.peg.1207   Listeria monocytogenes EGD-e                                                           SKEQNFLNELSPRAQEIQEKHGILTSITLAQAILESDWGQSGLAQ−−−−−−KGNNLFGVKG−−KSPQPMVTMTTKEFVDGKWIEINANFRKYKDWNESLDSHAELFLNGTSWNKD−−KYNGVI−−−AADDYKKAAQELQSAGYATDPDYA−−−−−−−EKLINIIEKYDLA−−−−−−LYDRIEDKIYYDTKSTGFGNVKKD−−−−−VSGAIWTKPYGLS−−−−−−−−−−−GA−−LKVEEINYYK−−−−−−−−−REDLKLLREA−−−−−−−−−−−−−−−−−−−−−−−−KTDSG−−TWYQIAVDTEPIG−−−WV                                                                                                                     
fig|393127.4.peg.1048   Listeria monocytogenes Finland 1988                                                           SKEQNFLNELSPRAQEIQEKHGILTSITLAQAILESDWGQSGLAQ−−−−−−KGNNLFGVKG−−KSPQPMVTMTTKEFVDGKWIEINANFRKYKDWNESLDSHAELFLNGTSWNKD−−KYNGVI−−−AADDYKKAAQELQSAGYATDPDYA−−−−−−−EKLINIIEKYDLA−−−−−−LYDRIEDKIYYDTKSTGFGNVKKD−−−−−VSGAIWTKPYGLS−−−−−−−−−−−GA−−LKVEEINYYK−−−−−−−−−REDLKLLREA−−−−−−−−−−−−−−−−−−−−−−−−KTDSG−−TWYQIAVDTEPIG−−−WV                                                                                                                     
fig|267409.5.peg.274   Listeria monocytogenes str. 1/2a F6854                                                           SKEQNFLNELSPRAQEIQEKHGILTSITLAQAILESDWGQSGLAQ−−−−−−KGNNLFGVKG−−KSPQPMVTMTTKEFVDGKWIEINANFRKYKDWNESLDSHAELFLNGTSWNKD−−KYNGVI−−−AADDYKKAAQELQSAGYATDPDYA−−−−−−−EKLINIIEKYDLA−−−−−−LYDRIEDKIYYDTKSTGFGNVKKD−−−−−VSGAIWTKPYGLS−−−−−−−−−−−GA−−LKVEEINYYK−−−−−−−−−REDLKLLREA−−−−−−−−−−−−−−−−−−−−−−−−KTDSG−−TWYQIAVDTEPIG−−−WV                                                                                                                     
fig|393126.4.peg.1642   Listeria monocytogenes FSL R2-561                                                           SKEQNFLNELSPRAQEIQEKHGILTSITLAQAILESDWGQSGLAQ−−−−−−KGNNLFGVKG−−KSPQPMVTMTTKEFVDGKWIEINANFRKYKDWNESLDSHAELFLNGTSWNKD−−KYNGVI−−−AADDYKKAAQELQSAGYATDPDYA−−−−−−−EKLINIIEKYDLA−−−−−−LYDRIEDKIYYDTKSTGFGNVKKD−−−−−VSGAIWTKPYGLS−−−−−−−−−−−GA−−LKVEEINYYK−−−−−−−−−REDLKLLREA−−−−−−−−−−−−−−−−−−−−−−−−KTDSG−−TWYQIAVDTEPIG−−−WV                                                                                                                     
fig|393131.3.peg.941   Listeria monocytogenes J2818                                                           SKEQNFLNELSPRAQEIQEKHGILTSITLAQAILESDWGQSGLAQ−−−−−−KGNNLFGVKG−−KSPQPMVTMTTKEFVDGKWIEINANFRKYKDWNESLDSHAELFLNGTSWNKD−−KYNGVI−−−AADDYKKAAQELQSAGYATDPDYA−−−−−−−EKLINIIEKYDLA−−−−−−LYDRIEDKIYYDTKSTGFGNVKKD−−−−−VSGAIWTKPYGLS−−−−−−−−−−−GA−−LKVEEINYYK−−−−−−−−−REDLKLLREA−−−−−−−−−−−−−−−−−−−−−−−−KTDSG−−TWYQIAVDTEPIG−−−WV                                                                                                                     
fig|393133.3.peg.1134   Listeria monocytogenes 10403S                                                           SKEQNFLNELSPRAQEIQEKHGILTSITLAQAILESDWGQSGLAQ−−−−−−KGNNLFGVKG−−KSPQPMVTMTTKEFVDGKWIEINANFRKYKDWNESLDSHAELFLNGTSWNKD−−KYNGVI−−−AADDYKKAAQELQSAGYATDPDYA−−−−−−−EKLINIIEKYDLA−−−−−−LYDRIEDKIYYDTKSTGFGNVKKD−−−−−VSGAIWTKPYGLS−−−−−−−−−−−GA−−LKVEEINYYK−−−−−−−−−REDLKLLREA−−−−−−−−−−−−−−−−−−−−−−−−KTDSG−−TWYQIAVDTEPIG−−−WV                                                                                                                     
fig|393133.8.peg.341   Listeria monocytogenes 10403S                                                           SKEQNFLNELSPRAQEIQEKHGILTSITLAQAILESDWGQSGLAQ−−−−−−KGNNLFGVKG−−KSPQPMVTMTTKEFVDGKWIEINANFRKYKDWNESLDSHAELFLNGTSWNKD−−KYNGVI−−−AADDYKKAAQELQSAGYATDPDYA−−−−−−−EKLINIIEKYDLA−−−−−−LYDRIEDKIYYDTKSTGFGNVKKD−−−−−VSGAIWTKPYGLS−−−−−−−−−−−GA−−LKVEEINYYK−−−−−−−−−REDLKLLREA−−−−−−−−−−−−−−−−−−−−−−−−KTDSG−−TWYQIAVDTEPIG−−−WV                                                                                                                     
fig|637381.3.peg.1254   Listeria monocytogenes 08-5923                                                           SKEQNFLNELSPRAQEIQEKHGILTSITLAQAILESDWGQSGLAQ−−−−−−KGNNLFGVKG−−KSPQPMVTMTTKEFVDGKWIEINANFRKYKDWNESLDSHAELFLNGTSWNKD−−KYNGVI−−−AADDYKKAAQELQSAGYATDPDYA−−−−−−−EKLINIIEKYDLA−−−−−−LYDRIEDKIYYDTKSTGFGNVKKD−−−−−VSGAIWTKPYGLS−−−−−−−−−−−GA−−LKVEEINYYK−−−−−−−−−REDLKLLREA−−−−−−−−−−−−−−−−−−−−−−−−KTDSG−−TWYQIAVDTEPIG−−−WV                                                                                                                     
fig|393124.3.peg.810   Listeria monocytogenes FSL N3-165                                                           SKEQNFLNELSPRAQELQEKHGILTSITLAQAILESDWGQSGLAQ−−−−−−KGNNLFGVKG−−KSPQPMVTMTTKEFVDGKWIEINANFRKYKDWNESLDSHAELFLNGTSWNKD−−KYNGVI−−−AADDYKKAAQELQSAGYATDPDYA−−−−−−−EKLINIIEKYDLA−−−−−−LYDRIEDKIYYDTKSTGFGNVKKD−−−−−VSGAIWTKPYGLS−−−−−−−−−−−GA−−LKVEEINYYK−−−−−−−−−REDLKLLREA−−−−−−−−−−−−−−−−−−−−−−−−KTDSG−−TWYQIAVDTEPIG−−−WV                                                                                                                     
fig|1126011.4.peg.1235   Listeria monocytogenes 07PF0776                                                           SKEQNFLNELSPRAQEIQEKHGILTSITLAQAILESDWGQSGLAQ−−−−−−KGNNLFGVKG−−KSPQPMVTMTTKEFVDGKWIEINANFRKYKDWNESLDSHAELFLKGTSWNKD−−KYNGVI−−−AADDYKKAAQELQSAGYATDPDYA−−−−−−−EKLINIIEKYDLA−−−−−−LYDRIEDKIYYDTKSTGFGNVKKD−−−−−VSGAIWTKPYGLS−−−−−−−−−−−GA−−LKVEEINYYK−−−−−−−−−REDLKLLREA−−−−−−−−−−−−−−−−−−−−−−−−KTDSG−−VWYQIAIDTEPIG−−−WV                                                                                                                     
fig|267410.6.peg.494   Listeria monocytogenes str. 4b H7858                                                           SKEQNFLNELSPRAQEIQEKHGILTSITLAQAILESDWGQSGLAQ−−−−−−KGNNLFGVKG−−KSPQPMVTMTTKEFVDGKWIEINANFRKYKDWNESLDSHAELFLKGTSWNKD−−KYNGVI−−−AADDYKKAAQELQSAGYATDPDYA−−−−−−−EKLINIIEKYDLA−−−−−−LYDRIEDKIYYDTKSTGFGNVKKD−−−−−VSGAIWTKPYGLS−−−−−−−−−−−GA−−LKVEEINYYK−−−−−−−−−REDLKLLREA−−−−−−−−−−−−−−−−−−−−−−−−KTDSG−−VWYQIAIDTEPIG−−−WV                                                                                                                     
fig|393117.3.peg.1022   Listeria monocytogenes FSL J1-194                                                           SKEQNFLNELSPRAQEIQEKHGILTSITLAQAILESDWGQSGLAQ−−−−−−KGNNLFGVKG−−KSPQPMVTMTTKEFVDGKWIEINANFRKYKDWNESLDSHAELFLKGTSWNKD−−KYNGVI−−−AADDYKKAAQELQSAGYATDPDYA−−−−−−−EKLINIIEKYDLA−−−−−−LYDRIEDKIYYDTKSTGFGNVKKD−−−−−VSGAIWTKPYGLS−−−−−−−−−−−GA−−LKVEEINYYK−−−−−−−−−REDLKLLREA−−−−−−−−−−−−−−−−−−−−−−−−KTDSG−−VWYQIAVDTEPIG−−−WV                                                                                                                     
fig|393121.3.peg.1039   Listeria monocytogenes FSL J2-071                                                           SKEQNFLNELSPRAQEIQEKHGILTSITLAQAILESDWGQSGLAQ−−−−−−KGNNLFGVKG−−KSPQPMVTMTTKEFVDGKWIEINANFRKYKDWNESLDSHAELFLKGTSWNKD−−KYNGVI−−−AADDYKKAAQELQSAGYATDPDYA−−−−−−−EKLINIIEKYDLA−−−−−−LYDRIEDKIYYDTKSTGFGNVKKD−−−−−VSGAIWTKPYGLS−−−−−−−−−−−GA−−LKVEEINYYK−−−−−−−−−REDLKLLREA−−−−−−−−−−−−−−−−−−−−−−−−KTDSG−−VWYQIAVDTEPIG−−−WV                                                                                                                     
fig|393121.7.peg.1026   Listeria monocytogenes FSL J2-071                                                           SKEQNFLNELSPRAQEIQEKHGILTSITLAQAILESDWGQSGLAQ−−−−−−KGNNLFGVKG−−KSPQPMVTMTTKEFVDGKWIEINANFRKYKDWNESLDSHAELFLKGTSWNKD−−KYNGVI−−−AADDYKKAAQELQSAGYATDPDYA−−−−−−−EKLINIIEKYDLA−−−−−−LYDRIEDKIYYDTKSTGFGNVKKD−−−−−VSGAIWTKPYGLS−−−−−−−−−−−GA−−LKVEEINYYK−−−−−−−−−REDLKLLREA−−−−−−−−−−−−−−−−−−−−−−−−KTDSG−−VWYQIAVDTEPIG−−−WV                                                                                                                     
fig|393125.3.peg.1360   Listeria monocytogenes FSL R2-503                                                           SKEQNFLNELSPRAQEIQEKHGILTSITLAQAILESDWGQSGLAQ−−−−−−KGNNLFGVKG−−KSPQPMVTMTTKEFVDGKWIEINANFRKYKDWNESLDSHAELFLKGTSWNKD−−KYNGVI−−−AADDYKKAAQELQSAGYATDPDYA−−−−−−−EKLINIIEKYDLA−−−−−−LYDRIEDKIYYDTKSTGFGNVKKD−−−−−VSGAIWTKPYGLS−−−−−−−−−−−GA−−LKVEEINYYK−−−−−−−−−REDLKLLREA−−−−−−−−−−−−−−−−−−−−−−−−KTDSG−−VWYQIAVDTEPIG−−−WV                                                                                                                     
fig|401650.12.peg.2113   Listeria monocytogenes HPB2262                                                           SKEQNFLNELSPRAQEIQEKHGILTSITLAQAILESDWGQSGLAQ−−−−−−KGNNLFGVKG−−KSPQPMVTMTTKEFVDGKWIEINANFRKYKDWNESLDSHAELFLKGTSWNKD−−KYNGVI−−−AADDYKKAAQELQSAGYATDPDYA−−−−−−−EKLINIIEKYDLA−−−−−−LYDRIEDKIYYDTKSTGFGNVKKD−−−−−VSGAIWTKPYGLS−−−−−−−−−−−GA−−LKVEEINYYK−−−−−−−−−REDLKLLREA−−−−−−−−−−−−−−−−−−−−−−−−KTDSG−−VWYQIAVDTEPIG−−−WV                                                                                                                     
fig|401650.3.peg.791   Listeria monocytogenes Aureli 1997                                                           SKEQNFLNELSPRAQEIQEKHGILTSITLAQAILESDWGQSGLAQ−−−−−−KGNNLFGVKG−−KSPQPMVTMTTKEFVDGKWIEINANFRKYKDWNESLDSHAELFLKGTSWNKD−−KYNGVI−−−AADDYKKAAQELQSAGYATDPDYA−−−−−−−EKLINIIEKYDLA−−−−−−LYDRIEDKIYYDTKSTGFGNVKKD−−−−−VSGAIWTKPYGLS−−−−−−−−−−−GA−−LKVEEINYYK−−−−−−−−−REDLKLLREA−−−−−−−−−−−−−−−−−−−−−−−−KTDSG−−VWYQIAVDTEPIG−−−WV                                                                                                                     
fig|393123.7.peg.1603   Listeria monocytogenes FSL N1-017                                                           SKEQNFLNKLSPRAQEIQAEHGILTSITLAQAILESDWGQSGLAQ−−−−−−EGNNLFGVKG−−KAPQPMVTMTTKEFVDGKFIEIKANFRKYKDWNESLDAHAELFLKGTSWNKD−−KYNGVI−−−AADDYKKAAQELQSAGYATDPDYA−−−−−−−EKLISIIERYDLD−−−−−−LYDRISDKIQYDTKSTGYGKVKKD−−−−−VSGAIWTKPYGLA−−−−−−−−−−−GA−−LKVEEINYYK−−−−−−−−−RENLKILREA−−−−−−−−−−−−−−−−−−−−−−−−KTDSG−−VWYQISVENDPIG−−−WV                                                                                                                     
fig|552536.6.peg.1425   Listeria monocytogenes HCC23                                                           SKEQNFLNKLSPRAQEIQAEHGILTSITLAQAILESDWGQSGLAQ−−−−−−EGNNLFGVKG−−KAPQPMVTMTTKEFVDGKFIEIKANFRKYKDWNESLDAHAELFLKGTSWNKD−−KYNGVI−−−AADDYKKAAQELQSAGYATDPDYA−−−−−−−EKLISIIERYDLD−−−−−−LYDRISDKIQYDTKSTGYGKVKKD−−−−−VSGAIWTKPYGLA−−−−−−−−−−−GA−−LKVEEINYYK−−−−−−−−−RENLKILREA−−−−−−−−−−−−−−−−−−−−−−−−KTDSG−−VWYQISVENDPIG−−−WV                                                                                                                     
fig|1002366.3.peg.1782   Listeria innocua ATCC 33091                                                           SKEQNFLNELSPRAQEIQAEHGILTSITLAQAILESNWGQSDLAQ−−−−−−QGNNLFGVKG−−KAPQPMVNMTTKEFVDGKWIEIKANFRKYKDWNESLEAHAELFLKGTSWNKD−−KYNGVI−−−KADDYKKAAEELQTAGYATDPGYA−−−−−−−EKLINIIEKYDLA−−−−−−LYDRIDDKIYYDAKSTGYGNVKKD−−−−−VSGAIWTRPYGLS−−−−−−−−−−−GA−−QKVEEINYYK−−−−−−−−−REDLKLLREA−−−−−−−−−−−−−−−−−−−−−−−−KTDSG−−VWYQISVKNDPIG−−−WV                                                                                                                     
fig|272626.9.peg.1206   Listeria innocua Clip11262                                                           SKEQNFLNELSPRAQEIQAEHGILTSITLAQAILESNWGQSDLAQ−−−−−−QGNNLFGVKG−−KAPQPMVNMTTKEFVDGKWIEIKANFRKYKDWNESLEAHAELFLKGTSWNKD−−KYNGVI−−−KADDYKKAAEELQTAGYATDPGYA−−−−−−−EKLINIIEKYDLA−−−−−−LYDRIDDKIYYDAKSTGYGNVKKD−−−−−VSGAIWTRPYGLS−−−−−−−−−−−GA−−QKVEEINYYK−−−−−−−−−REDLKLLREA−−−−−−−−−−−−−−−−−−−−−−−−KTDSG−−VWYQISVKNDPIG−−−WV                                                                                                                     
fig|272626.1.peg.1168   Listeria innocua Clip11262                                                           SKEQNFLNELSPRAQEIQAEHGILTSITLAQAILESNWGQSDLAQ−−−−−−QGNNLFGVKG−−KAPQPMVNMTTKEFVDGKWIEIKANFRKYKDWNESLEAHAELFLKGTSWNKD−−KYNGVI−−−KADDYKKAAEELQTAGYATDPGYA−−−−−−−EKLINIIEKYDLA−−−−−−LYDRIDDKIYYDAKSTGYGNVKKD−−−−−VSGAIWTRPYGLS−−−−−−−−−−−GA−−QKVEEINYYK−−−−−−−−−REDLKLLREA−−−−−−−−−−−−−−−−−−−−−−−−KTDSG−−VWYQISVKNDPIG−−−WV                                                                                                                     
fig|386043.9.peg.1178   Listeria welshimeri serovar 6b str. SLCC5334                                                           SKEQNFLNKLSPHAQEIQEKHGILTSITLAQAILESDWGQSGLAE−−−−−−KGNNLFGVKG−−KSPQPMVTMTTKEFEDGKWIEIKANFRKYKDWNESLDAHAALFLNGTTWNKD−−KYNGVV−−−AADNYKKAAQELQTAGYATDPDYA−−−−−−−EKLISIIEAHELQ−−−−−−LYDRIDDKIYYDTKATGYGNVKDD−−−−−VSGAIWTRPYGLS−−−−−−−−−−−GA−−QKVEEINYYK−−−−−−−−−REDLTLLREA−−−−−−−−−−−−−−−−−−−−−−−−KTDSG−−IWYQIAVKEEPIG−−−WVKKELIE                                                                                                               
fig|683837.3.peg.1094   Listeria seeligeri serovar 1/2b str. SLCC3954                                                           SKEQNFLNELSPHAQEIQEKHGILTSITLAQAILESDWGQSGLAQ−−−−−−KANNLFGVKG−−KPPQPIVTMSTKEFVDGEWIEVDANFRKYKDWNESLDAHAELFLNGTTWNAD−−KYNGVV−−−AADDYKKAAQELQTAGYATDPDYA−−−−−−−EKLTTIIESHDLQ−−−−−−LYDRINDKIYYDIKSTGYGKVKKD−−−−−VSGAVWTRPYGLS−−−−−−−−−−−GA−−QKVEEINYYK−−−−−−−−−REDLNLLREA−−−−−−−−−−−−−−−−−−−−−−−−KTDSG−−TWYQIAVNNEPIG−−−WVKQELIE                                                                                                               
fig|525367.9.peg.113   Listeria grayi DSM 20601                                                           TKEQNFINELSVHAQEIQAKHNILTSVTLAQAILESNWGESELAS−−−−−−SANNLFGVKS−−TTSKPHVSMKTKEFEKGKWKEITANFRKYRDWEESLDDHAALFLNGTSWHRD−−KYRSVI−−−TAKNYKQAAHALREAGYATDPGYT−−−−−−−EKLIELVEKYHLE−−−−−−KYDRISDKIYYNAKADRQAKVKAG−−−−−VDETIWSRPYGLK−−−−−−−−−−−GA−−QPLESTKYYQ−−−−−−−−−RDKLQITREV−−−−−−−−−−−−−−−−−−−−−−−−KTDSG−−VWVQLHQKDKNIG−−−WIQSKYLE                                                                                                               
fig|326423.3.peg.2845   Bacillus amyloliquefaciens FZB42                                                             QQVFIDSLSGHAQILYEKYHVLPSITLAQAILESDWGNSELAG−−−−−−KARNLFGVKG−−DYKGKHVTMKTDEFEKGKRKTIRAKFRKYSTFFESMDDHAKLFVNGTSWNKK−−KYKPVI−−−EADNYKTAAAALQKSGYATDPGYA−−−−−−−EKIKDVIETYNLN−−−−−−EYDKINASL−−−KAVDMKGAIKDH−−−−−AIEDVWSKPSKER−−−−−−−−−−−HS−−IKLASAQKFT−−−−−−−−−GQHIKVVSEK−−−−−−−−−−−−−−−−−−−−−−−−QNGES−−VWYQIQVKDELIG−−−WVDQTAVQLS                                                                                                             
fig|655816.3.peg.3081   Bacillus subtilis subsp. spizizenii str. W23                         IVSIPLALFVLATT−−−−LSKPIETSKEPEE−−IDEQQVFIDSLSGHAQILYEKYHVLPSITIAQAILESDWGNSELAA−−−−−−QANNLFGVKG−−NYKGHHVTMETDEFEKGKRKTIRAKFRKYSTYFESMDDHAQLFVRGTSWNKK−−KYKPVL−−−EAGNYKEAATALQTSGYATDPEYA−−−−−−−DKISAIVEKYDLD−−−−−−EYDEVNPSL−−−KSVDLKASIKDS−−−−−AVQDIWSKPSTDD−−−−−−−−−−−RS−−IKLTSAQSYV−−−−−−−−−GKDIKVVSKK−−−−−−−−−−−−−−−−−−−−−−−−QKGQS−−VWYQFQINDKLIG−−−WIDDSAVEI                                                                                                              
fig|1233100.3.peg.3111   Bacillus subtilis XF-1                        FLVSIPLALFVLATT−−−−LSKPIEISKETEE−−IDEQQVFIDSLSGHAQILYEKYHVLPSITIAQAILESDWGNSELAA−−−−−−KANNLFGVKG−−NYKGHHVTMETDEVEKGKRKTIRAKFRKYSTFFESMDDHAQLFVRGTSWNKK−−KYKPVL−−−EAGNYKEAATALQTSGYATDPDYA−−−−−−−DKISAIVEKYDLD−−−−−−EYDEVNPSL−−−KSVDLNASIKDS−−−−−AVQDVWSKPSTDD−−−−−−−−−−−RS−−IRLTSAQSYV−−−−−−−−−GKDIKVVSKK−−−−−−−−−−−−−−−−−−−−−−−−QKGQS−−VWYQFQINDKLIG−−−WIDDSAVEI                                                                                                              
fig|224308.49.peg.3122   Bacillus subtilis subsp. subtilis str. 168 [WGS]                        FLVSIPLALFVLATT−−−−LSKPIEISKETEE−−IDEQQVFIDSLSGHAQILYEKYHVLPSITIAQAILESDWGNSELAA−−−−−−KANNLFGVKG−−NYKGHHVTMETDEVEKGKRKTIRAKFRKYSTFFESMDDHAQLFVRGTSWNKK−−KYKPVL−−−EAGNYKEAATALQTSGYATDPDYA−−−−−−−DKISAIVEKYDLD−−−−−−EYDEVNPSL−−−KSVDLNASIKDS−−−−−AVQDVWSKPSTDD−−−−−−−−−−−RS−−IRLTSAQSYV−−−−−−−−−GKDIKVVSKK−−−−−−−−−−−−−−−−−−−−−−−−QKGQS−−VWYQFQINDKLIG−−−WIDDSAVEI                                                                                                              
fig|575595.3.peg.1539   Lactobacillus crispatus 125-2-CHN            MKKRLLTSFAAAAMLTSVAVPAVNTTM−−−−−MNQASSQRVSAA−−TADQTAFLNKAAKQAVKAAKKYGTLPSVMIAQAITESGWGKSGLAV−−−−−−NANNLFGMKADDSWTGETYTAKTREEDKNGKSYYITAKFRKYPSFEQSFEDNGSKLRNGVSWDPL−−RYKGTWIENASTYAAATKALTGTYATDSKYD−−−−−−−KALNSHITSSNLT−−−−−−KYDPVTVNTTRTYTAGKDSSTY−−−−−−−−−−−−−−NWPTAPS−−−−−−−−−−−VA−−SAIGSVK−−A−−−−−−−−−GEKVVVTKTI−−−−−−−−−−−−−−−−−−−−−−−−TFHDG−−SSRMYIDGR−−−G−−−WVNGSVLDKSSSA−−−TKEPVTQAPKNV                                                                                           
fig|575598.3.peg.1848   Lactobacillus crispatus SJ-3C-US            MKKRLLTSFAAAAMLTSVAVPAVNTTM−−−−−MNQASSQRVSAA−−TADQTAFLNKAAKQAVKAAKKYGTLPSVMIAQAITESGWGKSGLAV−−−−−−NANNLFGMKADDSWTGETYTAKTREEDKNGKSYYITAKFRKYPSFEQSFEDNGSKLRNGVSWDPL−−RYKGTWIENASTYAAATKALTGTYATDSKYD−−−−−−−KALNSHITSSNLT−−−−−−KYDPVTVNTTRTYTAGKDSSTY−−−−−−−−−−−−−−NWPTAPS−−−−−−−−−−−VA−−SAIGSVK−−A−−−−−−−−−GEKVVVTKTI−−−−−−−−−−−−−−−−−−−−−−−−TFHDG−−SSRMYIDGR−−−G−−−WVNGSVLDKSSSA−−−TKEPVTQAPKNV                                                                                           
fig|575597.3.peg.1601   Lactobacillus crispatus MV-3A-US            MKKRLLTSFAAAAMLTPVAVPAVNTTM−−−−−MNQASSQRVSAA−−TADQTAFLNKAAKQAVKAAKKYGTLPSVMIAQAITESGWGKSGLAV−−−−−−NANNLFGMKADDSWTGETYTAKTREEDKNGKSYYITAKFRKYPSFEQSFEDNGSKLRNGVSWDPL−−RYKGTWIENASTYAAATKALTGTYATDSKYD−−−−−−−KALNSHITSSNLT−−−−−−KYDPVTVNTTRTYTAGKDSSTY−−−−−−−−−−−−−−NWPTAPS−−−−−−−−−−−VA−−SAIGSVK−−A−−−−−−−−−GEKVVVTKTI−−−−−−−−−−−−−−−−−−−−−−−−TFHDG−−SSRMYIDGR−−−G−−−WVNGSVLDKSSSA−−−TKEPVTQAPKNV                                                                                           
fig|748671.3.peg.174   Lactobacillus crispatus ST1            MKKRLLTSFAAAAMLTSVAVPAVNTTM−−−−−MNQASSQRVSAA−−TADQTAFLNKAAKQAVKAAKKYGTLPSVMIAQAITESGWGKSGLAV−−−−−−NANNLFGMKADDSWTGETYTAKTREEDKNGKSYYITAKFRKYPSFEQSFEDNGSKLRNGVSWDPL−−RYKGTWIENASTYASATKALTGTYATDSKYD−−−−−−−RALNSHITSLNLT−−−−−−KYDPVTINTTRTYTAGKDSSTY−−−−−−−−−−−−−−NWPTAPS−−−−−−−−−−−VA−−SAIGSVK−−A−−−−−−−−−GEKVVVTKTI−−−−−−−−−−−−−−−−−−−−−−−−TFHDG−−SSRMYIDGR−−−G−−−WVNGSVLDKSSSA−−−TKEPVTQAPKNVKPVSKNLMHNAYVYDQNGKKL                                                                      
fig|525365.3.peg.1929   Lactobacillus ultunensis DSM 16047            MKKRLLTSIASAVMLTSIAVPVVNEIV−−−−−IDNISSQKVMAA−−−DYQADFLKKTAKQATKVAKKYGVYPSVMIAQAIVESGWGQSGLAV−−−−−−NANNLFGMKADNNWPGASYASKTREETKSGKSYYINGKFKKYNSLEESFEDNGQRLREGVSWQPL−−RYQGAWLENANTYAAATKALTGTYATANNYN−−−−−−−TALNSRIVAHNLY−−−−−−KYDPIISNVTKTYIVDKSGSTY−−−−−−−−−−−−−−NWPTDPS−−−−−−−−−−−VA−−QVINSVN−−Q−−−−−−−−−GEKVTVIKTI−−−−−−−−−−−−−−−−−−−−−−−−TFNDG−−SSRMYIDGK−−−G−−−WIDGSYLGKSTSK−−−NKSPITQAPKGATKVSKNLMHNAYIYNKEGKRVKGKIFKVNGKEGFKLIDTYGTQTIK−−−−GKTYYRVGESEYIAAGNVDGTLRFLKHNSYVYNQ       
fig|272621.3.peg.80   Lactobacillus acidophilus NCFM            MKKRLLTSIASAAMLTTVATPVVNNVM−−−−−MTTAHSQKVSAATTDEQAAFLNKAAKQAVKAAKKYGTYPSVMIAQAILESGWGQSALAT−−−−−−EANNLFGMKADDSWPGETYSAKTREEGTNGKSYYIVAKFRKYNSFEESFEDNGKKLREGVSWQPL−−RYKGTWLENANTYADATKSLTGTYATDSKYD−−−−−−−SSLNSRITDHNLN−−−−−−QYDPIVSKTAKVYTVSKSGSVY−−−−−−−−−−−−−−NWPTDHS−−−−−−−−−−−VA−−SPVGTVK−−K−−−−−−−−−GERVVATKTI−−−−−−−−−−−−−−−−−−−−−−−−TYNDG−−STRMYLEGK−−−G−−−WINGTSLGKGNSK−−−SSEPITQAPKGATKVDKTLMHNAYVYDNKGTKIKGKMFKLNEEEDVKMISTYGTKTIK−−−−GKTYYRVGENE                              
fig|405566.6.peg.200   Lactobacillus helveticus DPC 4571            MKKRLLTSIAAAVVLTSTIAPASNISG−−−−−ITDFRSQKVSAA−−TDAQTEFLNKAAKQAVKAAKKYGTYPSVMIAQAIVESGWGQSALAV−−−−−−NANNLFGMKASGWSGPTYSAKTREEGKDGKSYYITAAFRKYNSFEESFEDNGKKLRNGVTWQPL−−RYQGAWLENANTYAEATKALTGTYATDSKYD−−−−−−−VALDSRITSHNLN−−−−−−QYDPVISKTTKHYTVEKSGSVY−−−−−−−−−−−−−−NWPTDQS−−−−−−−−−−−VA−−KAVGSVK−−S−−−−−−−−−GEKVTVTKTI−−−−−−−−−−−−−−−−−−−−−−−−TFHDD−−SSRMYIEGK−−−G−−−WINGTSLTKGKTT−−−TSEPSTQAPKGATKIEKNLMHNAYVYDAKGK                                                                        
fig|585520.4.peg.357   Lactobacillus helveticus DSM 20075            MKKRLLTSIAAAVVLTSTIAPASNISA−−−−−ITDLRSQKVSAA−−TDAQTEFLNKAAKEAVKAAKKYGTYPSVMIAQAIIESGWGQSGLAV−−−−−−NSNNLFGMKADDSWSGESYLARTREEKDGKSYYINAIFRKYNSLKESFEDNGKKLREGVSWQPL−−RYKGAWLENANTYAEATKALTGTYATDSKYD−−−−−−−IALNSRITSHNLN−−−−−−QYDPVISKTTKHYTVEKSGSVY−−−−−−−−−−−−−−NWPTDHS−−−−−−−−−−−VA−−KAVGSVK−−S−−−−−−−−−GEKVTVTKTI−−−−−−−−−−−−−−−−−−−−−−−−TFHDG−−SSRMYIEGK−−−G−−−WINGTSLTKGKTT−−−TSEPSTQAPKGATKVEKNLMHNAYVYDAKGK                                                                        
fig|585524.3.peg.844   Lactobacillus amylolyticus DSM 11664            MKKKLITGFVAAAVLSGTAIPAINNLS−−−−NFKTVQGHTVKAATLTATESVFLTKAATQAQKAAKKYGVYPSVMIAQAIVESDWGKSTLAT−−−−−−EANNLFGMKAGDDWTGATYSATTREEDSSGKSYYITASFRKYTSYEDSFDDNGKKLRLGVSWQPT−−RYSDAWIENASSYAAATKALTGTYATDQNYN−−−−−−−TNLDQQITQYNLT−−−−−−KYDPTISKTAKSYKVATTAATY−−−−−−−−−−−−−−TWPTDHS−−−−−−−−−−−VS−−TKSGSIK−−K−−−−−−−−−GETVTVDKTI−−−−−−−−−−−−−−−−−−−−−−−−TYYNG−−SKRMHIAGK−−−G−−−WVNSTVLE                                                                                                               
fig|596326.3.peg.1167   Lactobacillus jensenii 208-1            MKTKKITGVATAALLASVAVPVTNNLA−−−−−−NIETSYTVKA−−−ATKEQAFLNTAVPNAEVASARYGTYTSVMLAQAILESGWGVSSLAT−−−−−−QANNLFGMKG−−SYNGQSYYADTAEWAAGTGYYNINAGFRKYPSWEASFEDNGYLLRTGTYGYSN−−RYRMAWVENAANYQVATQGLKDGGYATDPNYP−−−−−−−RSLNNVIQYYGLN−−−−−−QYDPSIDNTTRVMKVTSNGTVY−−−−−−−−−−−−−−SGPASPN−−−−−−−−−−−VV−−SATGSVT−−A−−−−−−−−−GQVITVDKTI−−−−−−−−−−−−−−−−−−−−−−−−TYKNG−−MSYMHTGN−−−−G−−−WISGSLLAGGSSQSPVNEKPGTSSNSGSPIAKITYSSPVYVWEGPNKNITSRTLSVGSSW−−−−−KIFGKTTVN−−−−GETWYNLGGNQWILAKYVYATGLS                 
fig|440497.10.peg.711   Lactobacillus jensenii 1153                                                                                       LAQSILESGWGASLLAT−−−−−−QANNLFGMKG−−SYNGQTYYTNTSEWASGTGYYNINAGFRKYPSWAASFEDNGYKLRTGTTDNPS−−RYRMAWIENAANYQVATQGLKDGGYATSPTYP−−−−−−−QSLNRVISSYGLN−−−−−−QYDPSVDTTTKTMRVLSNGTVY−−−−−−−−−−−−−−SGPADSS−−−−−−−−−−−VV−−SATGNIT−−A−−−−−−−−−GQVVTVDKTV−−−−−−−−−−−−−−−−−−−−−−−−TYKNG−−LSYMHISN−−−−G−−−WINGSLLTGSSTQATTTEKAGTTTDAGNAAIKVVYTSAIAEWKNPGSGVVGYLQKGTTQ−−−−−TVVGKIQVN−−−−GAWWYKLSSGNWVPGEYVYVTGASRIPTIDNNVVNQNTKVK
fig|575607.3.peg.840   Lactobacillus jensenii SJ-7A-US            MKTKKITGVATAALLASVAVPVTNNLA−−−−−−NIQTSYTAKAV−−TGQQQAFLNTAIPNAEAASARYGTYTSVMLAQSILESGWGASLLAT−−−−−−QANNLFGMKG−−SYNGQTYYTNTSEWASGTGYYNINAGFRKYPSWAASFEDNGYKLRTGTTDNPS−−RYRMAWIENAANYQVATQGLKDGGYATSPTYP−−−−−−−QSLNRVISSYGLN−−−−−−QYDPSVDTTTKTMRVLSNGTVY−−−−−−−−−−−−−−SGPADSS−−−−−−−−−−−VV−−SATGNIT−−A−−−−−−−−−GQVVTVDKTV−−−−−−−−−−−−−−−−−−−−−−−−TYKNG−−LSYMHISN−−−−G−−−WINGSLLTGSSTQATTTEKAGTTTDAGNAAIKVVYTSAIAEWKNPGSGVVGYLQKGTTQ−−−−−TVVGKIQVN−−−−GAWWYKLSSGNWVPGEYVYVTGASRIPTIDNNVVNQNTKVK
fig|596326.3.peg.2120   Lactobacillus jensenii 208-1            MKTKKITGVATAALLASVAVPVTNNLA−−−−−−NIQTSYTAKAV−−TGQQQAFLNTAIPNAEAASARYGTYTSVMLAQSILESGWGASLLAT−−−−−−QANNLFGMKG−−SYNGQTYYTNTSEWASGTGYYNINAGFRKYPSWAASFEDNGYKLRTGTTDNPS−−RYRMAWIENAANYQVATQGLKDGGYATSPTYP−−−−−−−QSLNRVISSYGLN−−−−−−QYDPSVDTTTKTMRVLSNGTVY−−−−−−−−−−−−−−SGPADSS−−−−−−−−−−−VV−−SATGNIT−−A−−−−−−−−−GQVVTVDKTV−−−−−−−−−−−−−−−−−−−−−−−−TYKNG−−LSYMHISN−−−−G−−−WINGSLLTGSSTQATTTEKAGTTTDAGNAAIKVVYTSAIAEWKNPGSGVVGYLQKGTTQ−−−−−TVVGKIQVN−−−−GAWWYKLSSGNWVPGEYVYVTGASRIPTIDNNVVNQNTKVK
fig|713605.5.peg.154   Lactobacillus iners AB-1                TITSAVTAILIAGAGISVDNILN−−−−−−TNSQTHQVVD−−−ATTQQEFLNKAIPAATKASSKYGTYTSVMLAQAILESNWGNSQLAQ−−−−−−EPNNNLFGIKG−−SYQGNSVSFSTSEFSDDNGYYTVDANFRKYPTYHESFDDNGNLLRNGLNG−−−−−YYSDTWIENAQSSSDATNGLQGKYATAPNYA−−−−−−−QSLDKIISQYNLT−−−−−−KYDPKITDVNERKVIQKTCSVT−−−−−−−−−−−−−−SAPVESS−−−−−−−−−−−VG−−KLVKTLH−−R−−−−−−−−−GDVVDVTKYI−−−−−−−−−−−−−−−−−−−−−−−−AYGNG−−VKYALTNY−−−−G−−−WIDAIAIVPIVSQAPVAKMSGVSVVNKIVKINYIPKYGIAVWQKPAHHVVGKYLAHGTSW−−−−−RVDRQISIN−−−−NHLWYRVGTN                               
fig|525330.3.peg.1375   Lactobacillus johnsonii ATCC 33200              KRTFTGIATAALITTAGISVTNNLKPDNPLKTGEGTVQA−−−−−ATYQQEFLDKAIPAATTASSKYGTYTSVMLAQATVESAWGQSSLAQ−−−−−−EPNNNLFGIKG−−SYNGQSVNMNTGEYGNGGYYTTNARFRKYPSYTESFEDNGALLRNQMGN−−−−−YYSGTWVENSNNYAQATQNGLQGKYATDPNYA−−−−−−−KTLNSVIATNGFD−−−−−−KYDPVTQVVNENRTVAQTTPVM−−−−−−−−−−−−−−SAPVDPS−−−−−−−−−−−VG−−TQVDTAR−−V−−−−−−−−−GQNVNVTKYI−−−−−−−−−−−−−−−−−−−−−−−−TYNNG−−VKRAFIGN−−−−G−−−WINALA                                                                                                                 
fig|257314.1.peg.157   Lactobacillus johnsonii NCC 533              KRTFTGIATAALITTAGISVTNNLKPDNPLKTGEGTVQA−−−−−ATYQQEFLDKAIPAATTASSKYGTYTSVMLAQATVESAWGQSGLAQ−−−−−−EPNNNLFGIKG−−SYNGQSVNMNTGEYGNGGYYTTNAGFRKYPSYTESFEDNGALLRNQMGN−−−−−YYSGTWVENSNNYAQATQNGLQGKYATDPNYA−−−−−−−KTLNSVIATNGFD−−−−−−KYDPVTQVVNENRTVAQTTPVM−−−−−−−−−−−−−−SAPVDPS−−−−−−−−−−−VG−−TQVDTAR−−V−−−−−−−−−GQNVNVTKYI−−−−−−−−−−−−−−−−−−−−−−−−TYNNG−−VKRAFIGN−−−−G−−−WINALA                                                                                                                 
fig|633699.4.peg.163   Lactobacillus johnsonii FI9785              KRTFTGIATAALITTAGISVTNNLKPDNPLKTGEGTVQA−−−−−ATYQQEFLDKAIPAATTASSKYGTYTSVMLAQATVESAWGQSGLAQ−−−−−−EPNNNLFGIKG−−SYNGQSVNMNTGEYGNGGYYTTNAGFRKYPSYTESFEDNGALLRNQMGN−−−−−YYSGTWVENSNNYAQATQNGLQGKYATDPNYA−−−−−−−KTLNSVIATNGFD−−−−−−KYDPVTQIVNENRTVAQTTPVM−−−−−−−−−−−−−−SAPVDPS−−−−−−−−−−−VG−−TQVDTAR−−V−−−−−−−−−GQNVNVTKYI−−−−−−−−−−−−−−−−−−−−−−−−TYNNG−−VKRAFIGN−−−−G−−−WINALA                                                                                                                 
fig|525326.3.peg.1444   Lactobacillus gasseri JV-V03              KRTFTGIATAALITTAGISVTNNLKPENPLKTGEGTVQA−−−−−ATYQQEFLNKAIPAATTASSKYGTYTSVMLAQAAVESAWGQSGLAQ−−−−−−SPNNNLFGIKG−−SYNGQSVNMNTGEYGSNGYYTTNAGFRKYPSYTESFEDNGSLLRNQMGN−−−−−YYSGTWVENSKNYAQATQNGLQGKYATAPNYA−−−−−−−QTLNSVIAANGFD−−−−−−KYDPVTQVVNENRTVAQTTPIM−−−−−−−−−−−−−−SAPVDAS−−−−−−−−−−−VG−−TQVGTAR−−T−−−−−−−−−GQNVNVTKYI−−−−−−−−−−−−−−−−−−−−−−−−TYNNG−−VKRAYIGT−−−−G−−−WINALA                                                                                                                 
fig|630527.3.peg.1498   Lactobacillus gasseri 202-4              KRTFTGIATAALITTAGISVTNNLKPENPLKTGEGTVQA−−−−−ATYQQEFLNKAIPAATTASSKYGTYTSVMLAQAAVESAWGQSGLAQ−−−−−−APNNNLFGIKG−−SYKGQSVNMNTGEYGSNGYYTTNAGFRKYPSYTESFEDNGSLLRNQMGN−−−−−YYSGTWVENSNNYAQATQNGLQGKYATAPNYA−−−−−−−KTLNSVIAANGFD−−−−−−KYDPVTQVVNENRTVAQTTPIM−−−−−−−−−−−−−−SAPVDAS−−−−−−−−−−−VG−−TQVGTAR−−T−−−−−−−−−GQNVNVTKYI−−−−−−−−−−−−−−−−−−−−−−−−TYNNG−−VKRAYIGT−−−−G−−−WINALA                                                                                                                 
fig|324831.13.peg.158   Lactobacillus gasseri ATCC 33323              KRTFTGIATAALITTAGISVTNNLKPENPLKTGEGTVQA−−−−−ATYQQEFLNKAIPAATTASSKYGTYTSVMLAQAAVESAWGQSGLAQ−−−−−−APNNNLFGIKG−−SYKGQSVNMNTGEYGSNGYYTTNAGFRKYPSYTESFEDNGSLLRNQMGN−−−−−YYSGTWVENSNNYAQATQNGLQGKYATAPNYA−−−−−−−KTLNSVIAANGFD−−−−−−KYDPVTQVVNENRTVAQTTPIM−−−−−−−−−−−−−−SAPVDAS−−−−−−−−−−−VG−−TQVGTAR−−T−−−−−−−−−GQNVNVTKYI−−−−−−−−−−−−−−−−−−−−−−−−TYNNG−−VKRAYIGT−−−−G−−−WINALA                                                                                                                 
fig|387344.13.peg.667   Lactobacillus brevis ATCC 367                                                TKGTSHAA−−TTDPQTFISTLKSPVTTVANQYKLYPSVMMAQAALESAWGTSTLTT−−−−−−TANNYFGIKG−−SYNGASVTMKTAEYDSNGQLYYTNANFRKYPSAKASMTDNAKLLRNGTSYNTS−−IYSGTWRENAATYADAANALTGTYATAPTYG−−−−−−−SSLISIIKQYGLN−−−−−−TLLDASASDSSSSNSNSGSTPK−−−−−−−−PKPVVYSKATYYG−−−−−−−−−−−ASGTQTARLSGQYATYRLYNHVKGTRANITKTAWSKVAAGKNVLVYLDMRGVKKDASTGKKT−−TWYRIRFAKNTSAKKYWVYTKALTLPTVK−−−−−−YTSGTAAVKVNNTVSGSYYDHVFNSPYLAKSM−−−GALNKLTAKSYVADKQAIKTQDGYKSTWYRIKVG−−KQAYWIAA                     
fig|66692.6.peg.3304   Bacillus clausii KSM-K16                                  SSSAGLSAGTINSQLLSDKGIL−−QGQGQAFIN−−−−−−−−ASKLYGVNEIYLISHALLETGNGKSQLATGVQVNGKTVYNMYGIG−−AYDGNAVSAGAQYAYNQG−−−−−−−−−−−WFTPEDAIIGGARFVSSNYFARGQNTLYKMRWNPANPGTYQ−−−−−−−−−−YATDVGWAVKQTHHMSNLYSLVDDYEMTFDVPVYKNQPTGDAGNDKLEQLPTGTFGTTT−−−−−ARLNVRTGPGTSH−−−−−−−−−−−−−−−SIVTTL−−−−−−−−−−−−−DKDTKVELLA−−−−−−−−−−−−−−−−−−−−−−−−−−KQG−−NWYQIAVDNTTG−−−FVSGDYLKLDKPS−−−−−−EDNVEDSDQELISYGETTARLNLRSQPNTSSNVLTTLALGQKLEILKK−−−−−−−−−−−EGNWYRVRAG−−HQSGWVSAD                    
fig|565653.4.peg.758   Enterococcus gallinarum EG2                                                          SNTQQAFIQQVGPMAQQVAIVNDLYASVMIAQAILESGWGQSTLTT−−−−−−QANNMFGIKG−−SYNGQYVEMRTMEDDGNGNLYEIVAKFRKYPSLKESFEDNAHVLKTTSFSPGVYFYSGAWKSNTSSYRDATQWLQGRYATDTTYA−−−−−−−GKLNNLIETYNLI−−−−−−QFDSATGGGSGNGNNTNNSEQTINKQFKTMAALNIRSDASTSA−−−−−−−−−−−−−−−SVVGSLANNT−−−−−−−−−TFKAVAQKQG−−−−−−−−−−−−−−−−−−−−−−−−TSVNGNSTWYRVEGK−−−−G−−−WVSAAYVTEVGSN−−−−−−−NNSNNSEQTINKQFKTTAALNIRSDASTSASVVGSLANNTTFKAVAQKQGTSVNG−−−NSTWYRVEGK−−−−−GWVSA                     
fig|565654.4.peg.1021   Enterococcus casseliflavus EC10                                                          SNNQQAFIQQVGPMAQEVAGANDLYASVMIAQAILESGWGQSTLTT−−−−−−LANNMFGIKG−−SYNGQFVEMQTMEDDGNGNLYPIIARFRKYPSLKESFQDNANVLRTTSFSPGVFFYHGAWKSNTNSYRDATQWLQGRYATDTSYA−−−−−−−SKLNNLIETHNLT−−−−−−QYDTSSGGGSNDNNSNNSEQAINKQFRTNAALNIRSDASTSA−−−−−−−−−−−−−−−SIVGSLAANA−−−−−−−−−TFEAVAQKTG−−−−−−−−−−−−−−−−−−−−−−−−TSVNGNTTWYRIQGR−−−−G−−−WVSAAHVT                                                                                                               
fig|565652.4.peg.1087   Enterococcus casseliflavus EC30                                                          SNNQQAFIQQVGPMAQEVAGANDLYASVMIAQAILESGWGQSTLTT−−−−−−LANNMFGIKG−−SYNGQFVEMQTMEDDGNGNLYPIIARFRKYPSLKESFQDNANVLRTTSFSPGVFFYHGAWKSNTNSYRDATQWLQGRYATDTSYA−−−−−−−SKLNNLIETHNLT−−−−−−QYDTSSGGGSNDNNSNNSEQAINKQFRTNAALNIRSDASTSA−−−−−−−−−−−−−−−SIVGSLAANA−−−−−−−−−TFEAVAQKTG−−−−−−−−−−−−−−−−−−−−−−−−TSVNGNTTWYRIQGR−−−−G−−−WVSAAHVT                                                                                                               
fig|525367.9.peg.83   Listeria grayi DSM 20601                                       QSNRAAQARVATFAAPV−−QSKQEKFFASISGYAQKLSQKYNVYASVMMAQSALESAWGESGLSK−−−−−−KANNFFGVKG−−KYKGQSVIVETREFSNGKWITIKAEFRKYPSFYESMEDNASKLRNGVSWDHN−−YYKGTWYENTKSYKDSTKWLTGRYATDPDYN−−−−−−−KKLDSIIEKYGLT−−−−−−KYDKYDTILYNKAVNYKRTILNS−−−−−KTYYFYSDIYHTN−−−−−−−−−−PKV−−KKLENAGNYA−−−−−−−−−NKEVQVVREA−−−−−−−−−−−−−−−−−−−−−−−−KTDRA−−TWLQVKYGSRILG−−−WVNKNAGTIYDPI−−−−−−TSQKNVQVNAQSKKGYP−−IYNKIYGTASGVKQVAKSDTYVKNELQVSKEAVTK−−−−RGTWAEVKKSGKVLGWVDKKALT−−−−−−−−YFDAVTSNK
fig|683837.3.peg.966   Listeria seeligeri serovar 1/2b str. SLCC3954                                                          TSFQQKFINSISSQAMELCKKYKLYPSVMIAQASLESNWGRSELGT−−−−−−APNYNLFGIKG−−SYNGKSVTMKTWEYSDSKGWYQIDAKFAKYPSYKESLEDNAKKLRNGPSWDSS−−YYKGAWRENAKTYKDATAWLQGRYATDNTYA−−−−−−−SKLNSLISQYNLT−−−−−−QYDTLYDTIKSQKNVSEDAKVVKA−−−−−DGHGVYSGIYNTS−−−−−−−−−−−AASGKKLSTGAPYN−−−−−−−−−NKNVKILKEG−−−−−−−−−−−−−−−−−−−−−−−−TTSRG−−TWVQFSSNNKVIG−−−WMDKRAFVYYPKA−−−−−−TNVKSLNLTGKITAGSTNGLWSEVPGTVNAKKLATTAGAYQNKDAKIIKQGQIS−−−−GRTYYQFQVGGKTIGWLDARAF                  
fig|393121.7.peg.2579   Listeria monocytogenes FSL J2-071                                                             QQTFINSISAQAMDLCKKYNLYPSVMIAQAALESNWGRSELGK−−−−−−APNYNLFGIKG−−SYNGKSVTMKTWEYSDSKGWYQINANFAKYPSHKESLEDNAKKLRNGPSWDSS−−YYKGAWRENAKTYKDATAWLQGRYATDNTYA−−−−−−−SKLNTLISSYNLT−−−−−−QYDTLYDTIKQQKNVSEDAKVVKA−−−−−DGHGVYSGIYNTS−−−−−−−−−−−AASGKKLSTGAPYN−−−−−−−−−NKDVKILKEG−−−−−−−−−−−−−−−−−−−−−−−−TTSRG−−TWVQFSLNNKVIG−−−WMDKRAFVYYPKA−−−−−−TNVKTLNLTGKITAGSTNGLWSEVPGTVNAKKLATTAGAYQNKDAKVIKQGQIS−−−−GRTYYQFQVNGKTIGWLDARAFH−−−−−−I−−YDKI    
fig|267409.5.peg.401   Listeria monocytogenes str. 1/2a F6854                                                                                                                    MFGIKG−−SYNGKSVTMKTWEYSDSKGWYQINANFAKYPSHKESLEDNAKKLRNGPSWDSS−−YYKGAWRENAKTYKDATAWLQGRYATDNTYA−−−−−−−SKLNTLISSYNLT−−−−−−QYDTLYDTIKQQKNVSEDAKVVKA−−−−−DGHGVYSGIYNTS−−−−−−−−−−−AASAKKLSTGAPYN−−−−−−−−−NKDVKILKEG−−−−−−−−−−−−−−−−−−−−−−−−TTSRG−−TWVQFSLNNKVIG−−−WMDKRAFVYYPKA−−−−−−TNVKTLNLTGKITAGSTNGLWSEVPGTVNAKKLATTAGAYQNKDAKIIKQGQIS−−−−GRTYYQFQVGGKTIGWLDARAFH−−−−−−V−−YDKI    
fig|169963.1.peg.1068   Listeria monocytogenes EGD-e                                                             QQTFINSISTQAMDLCKKYNLYPSVMIAQAALESNWGRSELGK−−−−−−APNYNLFGIKG−−SYNGKSVTMKTWEYSDSKGWYQINANFAKYPSHKESLEDNAKKLRNGPSWDSS−−YYKGAWRENAKTYKDATAWLQGRYATDNTYA−−−−−−−SKLNTLISSYNLT−−−−−−QYDTLYDTIKQQKNVSEDAKVVKA−−−−−DGHGVYSGIYNTS−−−−−−−−−−−AASAKKLSTGAPYN−−−−−−−−−NKDVKILKEG−−−−−−−−−−−−−−−−−−−−−−−−TTSRG−−TWVQFSLNNKVIG−−−WMDKRAFVYYPKA−−−−−−TNVKTLNLTGKITAGSTNGLWSEVPGTVNAKKLATTAGAYQNKDAKIIKQGQIS−−−−GRTYYQFQVGGKTIGWLDARAFH−−−−−−V−−YDKI    
fig|393124.3.peg.689   Listeria monocytogenes FSL N3-165                                                             QQTFINSISTQAMDLCKKYNLYPSVMIAQAALESNWGRSELGK−−−−−−APNYNLFGIKG−−SYNGKSVTMKTWEYSDSKGWYQINANFAKYPSHKESLEDNAKKLRNGPSWDSS−−YYKGAWRENAKTYKDATAWLQGRYATDNTYA−−−−−−−SKLNTLISSYNLT−−−−−−QYDTLYDTIKQQKNVSEDAKVVKA−−−−−DGHGVYSGIYNTS−−−−−−−−−−−AASAKKLSTGAPYN−−−−−−−−−NKDVKILKEG−−−−−−−−−−−−−−−−−−−−−−−−TTSRG−−TWVQFSLNNKVIG−−−WMDKRAFVYYPKA−−−−−−TNVKTLNLTGKITAGSTNGLWSEVPGTVNAKKLATTAGAYQNKDAKIIKQGQIS−−−−GRTYYQFQVGGKTIGWLDARAFH−−−−−−V−−YDKI    
fig|393126.4.peg.1763   Listeria monocytogenes FSL R2-561                                                             QQTFINSISTQAMDLCKKYNLYPSVMIAQAALESNWGRSELGK−−−−−−APNYNLFGIKG−−SYNGKSVTMKTWEYSDSKGWYQINANFAKYPSHKESLEDNAKKLRNGPSWDSS−−YYKGAWRENAKTYKDATAWLQGRYATDNTYA−−−−−−−SKLNTLISSYNLT−−−−−−QYDTLYDTIKQQKNVSEDAKVVKA−−−−−DGHGVYSGIYNTS−−−−−−−−−−−AASAKKLSTGAPYN−−−−−−−−−NKDVKILKEG−−−−−−−−−−−−−−−−−−−−−−−−TTSRG−−TWVQFSLNNKVIG−−−WMDKRAFVYYPKA−−−−−−TNVKTLNLTGKITAGSTNGLWSEVPGTVNAKKLATTAGAYQNKDAKIIKQGQIS−−−−GRTYYQFQVGGKTIGWLDARAFH−−−−−−V−−YDKI    
fig|393131.3.peg.811   Listeria monocytogenes J2818                                                             QQTFINSISTQAMDLCKKYNLYPSVMIAQAALESNWGRSELGK−−−−−−APNYNLFGIKG−−SYNGKSVTMKTWEYSDSKGWYQINANFAKYPSHKESLEDNAKKLRNGPSWDSS−−YYKGAWRENAKTYKDATAWLQGRYATDNTYA−−−−−−−SKLNTLISSYNLT−−−−−−QYDTLYDTIKQQKNVSEDAKVVKA−−−−−DGHGVYSGIYNTS−−−−−−−−−−−AASAKKLSTGAPYN−−−−−−−−−NKDVKILKEG−−−−−−−−−−−−−−−−−−−−−−−−TTSRG−−TWVQFSLNNKVIG−−−WMDKRAFVYYPKA−−−−−−TNVKTLNLTGKITAGSTNGLWSEVPGTVNAKKLATTAGAYQNKDAKIIKQGQIS−−−−GRTYYQFQVGGKTIGWLDARAFH−−−−−−V−−YDKI    
fig|393133.8.peg.464   Listeria monocytogenes 10403S                                                             QQTFINSISTQAMDLCKKYNLYPSVMIAQAALESNWGRSELGK−−−−−−APNYNLFGIKG−−SYNGKSVTMKTWEYSDSKGWYQINANFAKYPSHKESLEDNAKKLRNGPSWDSS−−YYKGAWRENAKTYKDATAWLQGRYATDNTYA−−−−−−−SKLNTLISSYNLT−−−−−−QYDTLYDTIKQQKNVSEDAKVVKA−−−−−DGHGVYSGIYNTS−−−−−−−−−−−AASAKKLSTGAPYN−−−−−−−−−NKDVKILKEG−−−−−−−−−−−−−−−−−−−−−−−−TTSRG−−TWVQFSLNNKVIG−−−WMDKRAFVYYPKA−−−−−−TNVKTLNLTGKITAGSTNGLWSEVPGTVNAKKLATTAGAYQNKDAKIIKQGQIS−−−−GRTYYQFQVGGKTIGWLDARAFH−−−−−−V−−YDKI    
fig|637381.3.peg.1124   Listeria monocytogenes 08-5923                                                             QQTFINSISTQAMDLCKKYNLYPSVMIAQAALESNWGRSELGK−−−−−−APNYNLFGIKG−−SYNGKSVTMKTWEYSD