(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00006454

fig|525378.3.peg.2225   Staphylococcus epidermidis M23864:W1                                                   IHFVNNGFEYNFTSNGTNWSWSY−−−−−−−−−−−−−−−−−−−−−−−QA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AGSQSSSADYTQSYNQESSNQSVSSNTQSSNTNVEAVSAPTTSH−−−−−HNYSTSTTSYS−−−−−−−−−−−−−−−−APSSSSA−−−−−STGGSVKAQFLAAGGTEAAWNAIVMP−−−−ESGGNPNAVNPAGYRGLGQTM−−−−−−−−−ESW−−−−GTGSVASQTKGMINYANS        
fig|596319.3.peg.60   Staphylococcus warneri L37603                                                                   EAGSTSA−−−−−−−−−−−−−−−−−−−−−−−QT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SNTAVQSADYTTSYNQEAGTQSVSSNQQSSNTNVEAVSAPTTSNNGSSHNYSTKTTSYS−−−−−−−−−−−−−−−−APSTSSA−−−−−STGGSTKAQFLANGGTEEAWNAIVMP−−−−ESGGNPNAVNPAGYRGLGQTM−−−−−−−−−ESW−−−−GTGSVASQTKGMINYANS        
fig|553212.3.peg.56   Staphylococcus capitis SK14                                                                                                 QV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GSTTQSSADYTESYSQESSNQSVSSNQQSSNTSVKAVSAPTTST−−−−−HNYSTSTTSYS−−−−−−−−−−−−−−−−APSSSA−−−−−STGGSTKAQFLAAGGTEELWNAIVMP−−−−ESGGNVNASN−−GQYHGLGQTN−−−−−−−−−QSW−−−−GYGSVSNQTKGMIN            
fig|904334.3.peg.1597   Staphylococcus epidermidis VCU116                                                                                                 QV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GSTTQSSADYTESYSQESSNQSVSSNQQSSNTSVKAVSAPTTST−−−−−HNYSTSTTSYS−−−−−−−−−−−−−−−−APSSSA−−−−−STGGSTKAQFLAAGGTEELWNAIVMP−−−−ESGGNVNASN−−GQYHGLGQTN−−−−−−−−−QSW−−−−GYGSVSNQTKGMIN            
fig|904334.4.peg.1595   Staphylococcus capitis VCU116                                                                                                 QV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GSTTQSSADYTESYSQESSNQSVSSNQQSSNTSVKAVSAPTTST−−−−−HNYSTSTTSYS−−−−−−−−−−−−−−−−APSSSA−−−−−STGGSTKAQFLAAGGTEELWNAIVMP−−−−ESGGNVNASN−−GQYHGLGQTN−−−−−−−−−QSW−−−−GYGSVSNQTKGMIN            
fig|585506.3.peg.1348   Weissella paramesenteroides ATCC 33313             VLTALTVAGIATAAMATDVSADT−−−−−−−YTVKSGDTLSSIAANH−−NTTVDRILNVNKI−−ADA−−−−−−−−−NLIFVGEQFEL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DDQVAASTPAVTPASSAVATQQSAATSVASVAPAASQATSQAAPASSAATTQTTSTS−−−−−−−−−−−−−−−−−−−−−−−−−SASGSTYDQFIAAGGTSALWTSVVMP−−−−ESGGNVNASN−−GQYHGLGQTN−−−−−−−−−QSW−−−−GYGSVASQTQGMLN            
fig|585506.3.peg.266   Weissella paramesenteroides ATCC 33313             ALAVAGVASVFVAGTSIVNAAST−−−−−−−YTVKEGDTLSEVANKF−−NMTVDDLVKSNNL−−KDA−−−−−−−−−NMIFVDQKIEVPDSQSVAETDVDASSDSAANDAASLAMSQAASSAAASSAAAASSAAAASSAAASQAAAQKAAASEAAVSAAATSTTTASTQQAASATTSVASTS−−−−−−−−−−−−−SSSASAS−−−−−AAGGSVKAQFLANGGTEALWDSVVMP−−−−ESGGNPNAVSPNGYQGLGQTK−−−−−−−−−EGW−−−−GTGSVASQTAGMVN            
fig|525364.3.peg.1657   Lactobacillus salivarius ATCC 11741           TAVIASAAALTGVFASATVANADT−−−−−−−−VTVKSGDTVSKLAKDY−−NTTVDAIVNTNKL−−SNA−−−−−−−−−NLIFVGQKLEI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GEATQADNNQQAA−−−−−−−−−−−QSQQSQQVAPA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ASSQQAT−−−−−TNYNTNSNYTSSVSGNEQAAKEWIAAR−−−−ESGGNYGARN−−−−−−−−−−−−−−−−−−−−−−−−−−−−G                          
fig|586220.3.peg.1215   Leuconostoc mesenteroides subsp. cremoris ATCC 19254            TLTIAAGVAGALAFGGAHASADTTD−−−−−−YVVQLGDTLNKISAKY−−NVSVDKIAAQNNI−−SNV−−−−−−−−−NWIVTGQHLSF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ATDDTT−−−−−−−−−−−−−−−−−STQAASTTTAAAD−−−−−−−−−TSSTTQAASTTSSTDNTAST−−−−−−−−−−−STQTAST−−−−−TTAATSSTTTSSSSSSETAALNALIAR−−−−ESSGNVNATN−−GQYYGLGQLS−−−−−−−−AQARAIYGGNTADYNDQLNAMKAYIA        
fig|203120.7.peg.1830   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293            TLTIAAGVAGALAFGGAHASADTTD−−−−−−YVVQSGDTLNKISAKY−−NVSVDKIAAQNNI−−SNV−−−−−−−−−NWIVTGQHLSF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ATDDTT−−−−−−−−−−−−−−−−−STQTASTTTAAAD−−−−−−−−−TSSTTQAASTTSSTDNTAST−−−−−−−−−−−STQTAST−−−−−TTAATSSTTTSSSSSSETAALNALIAR−−−−ESSGNVNATN−−GQYYGLGQLS−−−−−−−−AQARSIYGGNTADYNDQLNAMKAYIA        
fig|502347.3.peg.1003   Escherichia albertii TW07627              IVMLLSTGLLLAGCSGSKSSNTETYSGSVYTVKRGDTLYRISRTT−−GTSVKELARLNGI−−SPP−−−−−−−−−YTIEVGQKLKL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GGAKSSSGSRKSTAK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−STTKTVA−−−−−−−−−−−−−−−VTPSSAVPKSSWPPVGQRCWLWPTTGKVIVPYSTAD                                                   
fig|479435.4.peg.1855   Kribbella flavida DSM 17836            TLSIAGLGAGITAVGAGAAFA−−TD−−−−−−YTVKSGDTLSEIAQAN−−GTDWHQLAELNGL−−DNP−−−−−−−−−DLILIGQTLKL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DGVNKAAVTERRSTAKTERKTERRSERKVEARSER−−−−−−−−−−KTERKSERKSERKSERKARTS−−−−−−−−−−RSESTRG−−−−−GNGGSVS−−−−−−−−−−MSAAWRKVAQC−−−−ESGGNPRAVNPTGKYHGLFQFDRQTWRSVGGSGL−−−−PSNASAAEQLMRAKKLYSQRGASPW  
fig|278197.12.peg.1281   Pediococcus pentosaceus ATCC 25745         LSIALLSGAAIGAAMITTGGSANADEI−−−−−−−YTVKSGDTLSEISYAFNLNGDYNSIAKANNI−−KNV−−−−−−−−−DVINVGQKLVITNG−−−−−−−−−−−−−−−−−−−−−−−−−−−−GDIKKATKSEVKSLPEVAKNTNAANAA−−−−−−−−−−−−−−−−−−TTSTTNNTTTTNNAASTQTTAKSSYVAPAQSSTTTSS−−−−−SNGGSVAQQMAAKTGVSAATWQRIINR−−−−ESGGNANAVNASSGAYGYFQLL−−−−−−−−GHGE−−−−HAGMSTSEQVNMAASVYKAQGMSAWG 
fig|1306952.3.peg.824   Pediococcus acidilactici D3                           SGSANADEI−−−−−−−YTVKSGDTLSEISYAFNLNGNYDAIAQANHI−−KDV−−−−−−−−−NFITVGQKLVIKDN−−−−−−−−−−−−−−−−−−−−−−−−−−−−GSIQKATKSEIKSLPEVDKDTNAAAA−−−−−−−−−−−−−−−−−−−TKQATPAKTATPKATSTKTASYS−−−−−−−−−−−−−GN−−−−−SSVSSVANEMASRTGVSAAKWQQIIMR−−−−ESGGNANVSNASSGAYGLFQLL−−−−−−−−GHGE−−−−HAGMSVAEQINMATNVYNAQGLSAWG 
fig|342451.11.peg.296   Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305                                                                  QSASSNTI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QDVTAQATTHTNETSANEVRTQQQSSNTEVAAVEAP−−−−−KASSNTNVQTAQTSTSTKSTT−−−−−−−−−−TTTTTST−−−−−SSIDAIANQMAERTGVSASQWKGVIQR−−−−ESGGNANAVNASSGAYGLFQLL−−−−−−−−GHGE−−−−HAGMSVQDQMDKAVEVYNNQGAGAW  
fig|349123.6.peg.793   Lactobacillus reuteri 100-23             VGVASVLLGISFANGVSADTTDASADTNANNGDGSEQTDHNLVLNSANNQTLKEATAANQA−−−−−−−−−−−−−−−−−−−−SGATA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TSQNPAGDVQTPAANEYEAAVNAAVASQTAQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NNTVESA−−−−−AVANSANSVTTSAASVTQPTSTSTVSQ−−−−QSAASQTAVETSAAPEST                                               
fig|365659.3.peg.1068   Streptococcus mitis B6         VSVGAASVVIGALYLAMGAGVVHAETN−−−−−−−TTTDGGASHSSPSPEPETSQPNSLTSSSYGAEPAQ−−−−−−−−−−NPDASGKSTES−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TTPKEKENKETLATNNTKPVENKEINNVAQPTEAS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TSANTRGRRVRREVGDAPAGGTSNTSTGTETP−−−−−−−DG−−−−SSTGNNEALN−−SALTGRKGAT                                           
fig|1042402.4.peg.809   Lactococcus lactis subsp. cremoris CNCM I-1631            VAISTGLVASFMFIGGGIAHADTP−−−−−−−−−−−−−KSTHEVAIEVINGNYGNGDTRVTNL−−−−−−−−−−−−−−−−−−QSKGFDV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KAIQTE−−−−−−−−−−−−−VNNILTGTTTQVSA−−−−−−−−−−−−TTKTAEEQPTKVTSVAPTQATQSVSGGL−−NMSQTSGQVDIQALANYMASNTANAAGYSASEWAYIITH−−−−ESNGGIDSVNSSSGAYGAFQLL−−−−−−−−GHGE−−−−YAGMTLAEQIAMASKL           
fig|684738.3.peg.1831   Lactococcus lactis subsp. lactis KF147            VAISTGLVASFMFIGGGIAHADTP−−−−−−−−−−−−−KSTHEVAIEVINGNYGNGDTRVTNL−−−−−−−−−−−−−−−−−−QSKGFDV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KAIQTE−−−−−−−−−−−−−VNNILTGTTTQVSA−−−−−−−−−−−−TTKTAEEQPTKVTSVAPTQVTQSVSGGL−−NMSQTSGQVDIQALANYMASNTANAAGYSASEWAYIITH−−−−ESNGGIDSVNSSSGAYGAFQLL−−−−−−−−GHGE−−−−YAGMTLAEQIAMASKL           
fig|272622.10.peg.2003   Lactococcus lactis subsp. cremoris SK11            VAISTGLVASFMFIGGGIAHADTP−−−−−−−−−−−−−KSTHEVAIEVINGNYGNGDARVTNL−−−−−−−−−−−−−−−−−−KTKGFDV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KAIQTE−−−−−−−−−−−−−VNNILTGTTTQVSA−−−−−−−−−−−−TAKTTEEQPTKVTSAAPAQAAESVSGGL−−NMSQTSGQIDIQALANYMASNTANAAGYSASEWAYIITH−−−−ESNGMADSVNSSSGAYGAFQLL−−−−−−−−GHGE−−−−YAGMTLAEQIAMASKL           
fig|746361.3.peg.787   Lactococcus lactis subsp. cremoris NZ9000            VAISTGLVASFMFIGGGIAHADTP−−−−−−−−−−−−−KSTHEVAIEVINGNYGNGDARVTNL−−−−−−−−−−−−−−−−−−KTKGFDV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KAIQTE−−−−−−−−−−−−−VNNILTGTTTQVSA−−−−−−−−−−−−TAKTAEEQPTKVTSAAPAQAAESVSGGL−−NMSQTSGQIDIQALANYMASNTANAAGYSASEWAYIITH−−−−ESNGMADSVNSSSGAYGAFQLL−−−−−−−−GHGE−−−−YAGMTLAEQIAMASKL           
fig|889932.4.peg.2525   Lactobacillus plantarum subsp. plantarum ST-III                             NANADST−−−−−−−YTVKSGDSVWAIAQKF−−NTTINHVETTNNI−−KG−−−−−−−−−−HYILPGQKLSI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KTSSTSSDNN−−−−−−−−−−−−−−−−−−TSSTTSNTTSSSAS−−−TTSSSSTSNTTATTTSTSSTDST−−−−−−−−TSSYTGS−−−−−NLKSYVLSQMQSRTGVSASTWNTIITR−−−−ESNWQPYVRNSSSGAYGLFQNM−−−−−−−−−−−H−−−−ISSGSVEEQVNAAVALYEAQGMAAW  
fig|644042.3.peg.2437   Lactobacillus plantarum JDM1         VSTIVTTSAAAAGLLFAGVLNANADST−−−−−−−YTVKSGDSVWAIAQKF−−NTTINHVETTNNI−−KG−−−−−−−−−−HYILPGQKLSI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KTSSTSSDNN−−−−−−−−−−−−−−−−−−TSSTTSNTTSSSAS−−−TTSSSSTSNTTVTTTSTSSTDST−−−−−−−−TSSYTGS−−−−−NLKSYVLSQMQSRTGVSASTWNTIITR−−−−ESNWQPYVRNSSSGAYGLFQNM−−−−−−−−−−−H−−−−ISSGSVEEQVNAAVALYEAQGMAAW  
fig|525338.3.peg.2814   Lactobacillus plantarum subsp. plantarum ATCC 14917         VSTIVTTSAAAAGLLFAGVLNANADST−−−−−−−YTVKSGDSVWAIAQKF−−NTTINHVETTNNI−−KG−−−−−−−−−−HYILPGQKLSI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TSSSAS−−−TTSSSSTSNTTATTTSTSSTDST−−−−−−−−TSSYTGS−−−−−NLKSYVLSQMQSRTGVSASTWNTIITR−−−−ESNWQPYVRNSSSGAYGLFQNM−−−−−−−−−−−H−−−−ISSGSVEEQVNAAVALYEAQGMAAW  
fig|525338.3.peg.2813   Lactobacillus plantarum subsp. plantarum ATCC 14917           TILTTSAATVGLLLAGTVSAHADAT−−−−−−−YTVKKGDCVWAISQEY−−KTTIESIETANNI−−HG−−−−−−−−−−HLILPGQQLRI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PGVNAQDLTSQAPAAPFVSAPVQQAPVTTPTQPA−−ETQAA−−−TTTQTTPAQTNETVASAPATTPA−−−−−−−−TESYSGD−−−−−NLQSYVLGQMQARTGVDAGTWNHIINR−−−−ESNWQPHVVNGASGAYGLFQNI−−−−−−−−−−−H−−−−ISGGSVQQQIDAAVNLYHAQGMQAW  
fig|644042.3.peg.2438   Lactobacillus plantarum JDM1           TILTTSAATVGLLLAGTVSAHADAT−−−−−−−YTVKKGDCVWAISQEY−−KTTIESIETANNI−−HG−−−−−−−−−−HLILPGQQLRI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PGVNAQDLTSQAPATPVVSAPVQQAPVTTPTQPA−−ETQAA−−−TTTQTTPAQTNETVASAPATTPA−−−−−−−−TESYSGD−−−−−NLQSYVLGQMQARTGVDAGTWNHIINR−−−−ESNWQPHVVNGASGAYGLFQNI−−−−−−−−−−−H−−−−ISGGSVQQQIDAAVNLYHAQGMQAW  
fig|889932.4.peg.2526   Lactobacillus plantarum subsp. plantarum ST-III           TILTTSAATVGLLLAGTVSAHADAT−−−−−−−YTVKKGDCVWAISQEY−−KTTIESIETANNI−−HG−−−−−−−−−−HLILPGQQLRI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PGVNAQDLTSQAPATPVVSAPVQQAPVTTPTQPA−−ETQAA−−−TTTQTTPAQTNETVASAPATTPA−−−−−−−−TESYSGD−−−−−NLQSYVLGQMQARTGVDAGTWNHIINR−−−−ESNWQPHVVNGASGAYGLFQNI−−−−−−−−−−−H−−−−ISGGSVQQQIDAAVNLYHAQGMQAW  
fig|525310.3.peg.1574   Lactobacillus brevis subsp. gravesensis ATCC 27305           TILATSAAAVGLFFAGAAGANASTT−−−−−−−YTVKSGDSVWAISQQF−−GSSINAIEGANSI−−SN−−−−−−−−−−HLIMPGQKLVI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PDGTSTTAA−−−−−−−−−−−−−−TTNTTSA−−ATQST−−−TNTQQKASYSQPAANTTANTTSAS−−−−−−−SNASYDS−−−−−STKSAVLSQMASRTGVSAATWDAIISR−−−−ESNWQPSVRNSSSGAYGLFQNM−−−−−−−−−−−H−−−−INGGSVQQQVDAAVSLYNQQGMSAW  
fig|525318.3.peg.1587   Lactobacillus buchneri ATCC 11577           TILATSAAAVGLFFAGAAGANASTT−−−−−−−YTVKSGDSVWAISQQF−−GSSINAIEGANSI−−SN−−−−−−−−−−HLIMPGQKLVI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PDGTSTTAA−−−−−−−−−−−−−−TTNTTSA−−ATQST−−−TNTQQKASYSQPAANTTANTTSAS−−−−−−−SNASYGS−−−−−STKSAVLSQMASRTGVSAATWDAIISR−−−−ESNWQPSVRNSSSGAYGLFQNM−−−−−−−−−−−H−−−−INGGSVQQQVDAAVSLYNQQGMSAW  
fig|290402.34.peg.342   Clostridium beijerincki beijerinckii NCIMB 8052                                                      SSKKSKENGNAESNGNTKEV−−−−−−−−−−−−−−−−−−−−KGETT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SSEKLN−−−−SKENINLNNAARVGQTYVTGQNLEEIPM−−−−−−−−−−−−−−−−−−−−VLTNNYIGFTRNSESALSNKSGAD−−−−IKKIYSAVDDAAKKYGVDPNLILAVIKQ−−−−ESDFDPNSTSGVGAAGLMQIMP                                         
fig|272626.9.peg.748   Listeria innocua Clip11262                                                       AKQSATTFETKLNERLNAT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KQTTTTNVQTVTDAELARAREAYEALINKSETKQTPSARSSVTTETPAATTGELTNWNNYQIKPISAENEG−−−−−−KYSDLIKTAATKYGVPEALIKRVIQV−−−−ESNFNPNVVSSAGATGLMQLM−−−−−−−−−YG                                
fig|525367.9.peg.852   Listeria grayi DSM 20601                                                  EQVITARKAEFNQAMTANQTAQNP−−−−−−−−−−−−−−−−−−−−KAFQS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ALEQQSMETAEKASPSSNKATSLDQQMAYAQSVYEAILAQG−−−−−−−−−−−−TTAAPAVSQPVKTTAANISSSPQSVSSAH−−−−DGKYATEIAAASKKYDVPESLIRKVIEV−−−−ESNFNPNAVSSAGATGLMQLM−−−−−−−−−YGE                               
fig|864564.3.peg.1238   Parascardovia denticolens DSM 10105                                            TIKKNDPTLAQGTTKVQTEGKEGTMEITNL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VTKNGTKTLSSNTISEYVKTVPTNKIILVGTKQPEAP−−−−−−−−KVSTNSNSNSSSSGSNSAPKASSNNYGTTLAQGDYQS−−−−−−−−−YAHSQVLARKWGEDQFTCLVLLWQR−−−−ESGWRVNAANPSGAYGIPQAL−−−PGSKMGPGW−−−−QTDAKVQ                    
fig|467705.8.peg.19   Streptococcus gordonii str. Challis substr. CH1                          TGVVAKADT−−−−−−−YTVKAGDTLSKIAKEK−−STTVESLIKLNKL−−ENP−−−−−−−−−DLIFENQVLEL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GDTKANKKAPAVAPAPGPATQANQAAPAPVA−−−−−−−−−−−−−−−−−−−−−−−TITVPAPSANYSTYNSTPVLANGNTAG−−−−−ETGTYAAARMAELTGVSASTWEAIIAR−−−−ESNGQVNAYNASGASGLFQTM−−−−−−−−−PGW−−−−GSTATVEDQIQSAYNAYNAQGLSAWNY
fig|467705.9.peg.18   Streptococcus gordonii str. Challis substr. CH1                          TGVVAKADT−−−−−−−YTVKAGDTLSKIAKEK−−STTVESLIKLNKL−−ENP−−−−−−−−−DLIFENQVLEL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GDTKANKKAPAVAPAPGPATQANQAAPAPVA−−−−−−−−−−−−−−−−−−−−−−−TITVPAPSANYSTYNSTPVLANGNTAG−−−−−ETGTYAAARMAELTGVSASTWEAIIAR−−−−ESNGQVNAYNASGASGLFQTM−−−−−−−−−PGW−−−−GSTATVEDQIQSAYNAYNAQGLSAWNY
fig|469609.3.peg.34   Streptococcus sp. 2_1_36FAA                          TGVVAKADT−−−−−−−YTVKAGDTLSKIAKEK−−STTVESLIKLNKL−−ENP−−−−−−−−−DLIFENQVLEL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GDTKANKKAPAVAAAPGPATQTNQAAPAPVA−−−−−−−−−−−−−−−−−−−−−−−TITVPAPSANYTTYNSTPVLSNGNTAG−−−−−ETGTYAAARMAELTGVSASTWEAIIAR−−−−ESNGQVNAYNASGASGLFQTM−−−−−−−−−PGW−−−−GSTATVEDQIQSAYNAYNAQGLSAWNY
fig|888820.3.peg.1845   Streptococcus sanguinis SK1056            TLTGAVAAAAFLVSGIA−−NAET−−−−−−−YTVEAGDTLSAIANEK−−NTTLEKLVELNKI−−ADP−−−−−−−−−NHIRVGQILEL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GNSAKT−−−−−−−−−−−−−−−−−−SETSVAATA−−−−−−−−−−−−−−−−−−TPVNNYAAPAATANSAATSGGLVLSNGNTAG−−−−−ATGSYAASRMAEMTGVPASTWEAIIAR−−−−ESNGQVDAYNPSGASGLFQTM−−−−−−−−−PGW−−−−GSTATVDDQIQSAYSAYSAQGLSAWGY
fig|1095733.3.peg.1655   Streptococcus parasanguinis F0449              TSLISAASLFISGIATVNAET−−−−−−−YEVKSGDTLSKIALEN−−NTSLENIISTNNL−−TNE−−−−−−−−−DLIYAGQIIEL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GERSKSMVDKVAPQEQAKPAESAPTATATAQTA−−−−−−−−−−−−−−−−−−QKQTTYAANAAVTSAQSTNGGIVLSNGNTAG−−−−−EQGAYAASRMAEMTGVPASTWEAIIAR−−−−ESNGQVNAANASGASGLFQTM−−−−−−−−−PGW−−−−GSTATVDDQIQAAYNAYNSQGLSAWGY
fig|760570.3.peg.1362   Streptococcus parasanguinis ATCC 15912              TSLISAASLFISGIATVNAET−−−−−−−YEVKSGDTLSKIALEN−−NTSLENIISTNNL−−TNE−−−−−−−−−DLIYAGQIIEL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GERSKSMVDKVAPQEQAKPAESAPTATATAQTA−−−−−−−−−−−−−−−−−−QKQTTYAANAAVTSAQSTNGGIVLSNGNTAG−−−−−EQGAYAASRMAEMTGVPASTWEAIIAR−−−−ESNGQVNAANASGASGLFQTM−−−−−−−−−PGW−−−−GSTATVDDQIQAAYNAYNSQGLSAWGY
fig|450394.6.peg.1571   Staphylococcus aureus subsp. aureus USA300_TCH959                                                  TTSYNQGSN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VQSV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SYNAQS−−−−−−−−−−−−−−−−−−SNSNVEAVSAPT−−−−−−−−−−−−YHNYSTSTT−−−−−−−−−−−−−SSSVRLSNGNTAG−−−−−ATGSSAAQIMAQRTGVSASTWAAIIAR−−−−ESNGQVNAYNPSGASGLFQTM−−−−−−−−−PGW−−−−GPTNTVDQQINAAVKAYKAQGLGAWGF
fig|452948.4.peg.439   Staphylococcus aureus 930918-3                                                  TTSYNQGSN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VQSV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SYNAQS−−−−−−−−−−−−−−−−−−SNSNVEAVSAPT−−−−−−−−−−−−YHNYSTSTT−−−−−−−−−−−−−SSSVRLSNGNTAG−−−−−ATGSSAAQIMAQRTGVSASTWAAIIAR−−−−ESNGQVNAYNPSGASGLFQTM−−−−−−−−−PGW−−−−GPTNTVDQQINAAVKAYKAQGLGAWGF
fig|1028799.3.peg.2330   Staphylococcus aureus subsp. aureus VC40                                                  TTSYNQGSN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VQSV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SYNAQS−−−−−−−−−−−−−−−−−−SNSNVEAVSAPT−−−−−−−−−−−−YHNYSTSTT−−−−−−−−−−−−−SSSVRLSNGNTAG−−−−−ATGSSAAQIMAQRTGVSASTWAAIIAR−−−−ESNGQVNAYNPSGASGLFQTM−−−−−−−−−PGW−−−−GPTNTVDQQINAAVKAYKAQGLGAWGF
fig|455227.3.peg.1183   Staphylococcus aureus D30                                                  TTSYNQGSN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VQSV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SYNAQS−−−−−−−−−−−−−−−−−−SNSNVEAVSAPT−−−−−−−−−−−−YHNYSTSTT−−−−−−−−−−−−−SSSVRLSNGNTAG−−−−−ATGSSAAQIMAQRTGVSASTWAAIIAR−−−−ESNGQVNAYNPSGASGLFQTM−−−−−−−−−PGW−−−−GPTNTVDQQINAAVKAYKAQGLGAWGF
fig|904747.3.peg.302   Staphylococcus aureus subsp. aureus 21266                                                  TTSYNQGSN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VQSV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SYNAQS−−−−−−−−−−−−−−−−−−SNSNVEAVSAPT−−−−−−−−−−−−YHNYSTSTT−−−−−−−−−−−−−SSSVRLSNGNTAG−−−−−ATGSSAAQIMAQRTGVSASTWAAIIAR−−−−ESNGQVNAYNPSGASGLFQTM−−−−−−−−−PGW−−−−GPTNTVDQQINAAVKAYKAQGLGAWGF
fig|548473.6.peg.606   Staphylococcus aureus subsp. aureus TCH60                                                  TTSYNQGSN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VQSV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SYNAQS−−−−−−−−−−−−−−−−−−SNSNVEAVSAPT−−−−−−−−−−−−YHNYSTSTT−−−−−−−−−−−−−SSSVRLSNGNTAG−−−−−ATGSSAAQIMAQRTGVPASTWAAIIAR−−−−ESNGQVNAYNPSGASGLFQTM−−−−−−−−−PGW−−−−GPTNTVDQQINAAVKAYKAQGLGAWGF
fig|904728.3.peg.1860   Staphylococcus aureus subsp. aureus 21195                                                  TTSYNQGSN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VQSV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SYNAQS−−−−−−−−−−−−−−−−−−SNSNVEAVSAPT−−−−−−−−−−−−YHNYSTSTT−−−−−−−−−−−−−SSSVRLSNGNTAG−−−−−ATGSSAAQIMAQRTGVPASTWAAIIAR−−−−ESNGQVNAYNPSGASGLFQTM−−−−−−−−−PGW−−−−GPTNTVDQQINAAVKAYKAQGLGAWGF
fig|931436.3.peg.2742   Staphylococcus aureus subsp. aureus CIG1242                                                  TTSYNQGSN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VQSV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SYNAQS−−−−−−−−−−−−−−−−−−SNSNVEAVSAPT−−−−−−−−−−−−YHNYSTSTT−−−−−−−−−−−−−SSSVRLSNGNTAG−−−−−ATGSSAAQIMAQRTGVPASTWAAIIAR−−−−ESNGQVNAYNPSGASGLFQTM−−−−−−−−−PGW−−−−GPTNTVDQQINAAVKAYKAQGLGAWGF
fig|1169265.3.peg.503   Staphylococcus aureus M1109                                                  TTSYNQGSD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VQSV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SYNAQS−−−−−−−−−−−−−−−−−−SNSNVEAVSAPT−−−−−−−−−−−−YHNYSTSTT−−−−−−−−−−−−−SSSVRLSNGNTAG−−−−−ATGSSAAQIMAQRTGVSASTWAAIIAR−−−−ESNGQVNAYNPSGASGLFQTM−−−−−−−−−PGW−−−−GPTNTVDQQINAAVKAYKAQGLGAWGF
fig|1169274.3.peg.2522   Staphylococcus aureus M1309                                                  TTSYNQGSD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VQSV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SYNAQS−−−−−−−−−−−−−−−−−−SNSNVEAVSAPT−−−−−−−−−−−−YHNYSTSTT−−−−−−−−−−−−−SSSVRLSNGNTAG−−−−−ATGSSAAQIMAQRTGVSASTWAAIIAR−−−−ESNGQVNAYNPSGASGLFQTM−−−−−−−−−PGW−−−−GPTNTVDQQINAAVKAYKAQGLGAWGF
fig|889933.4.peg.2348   Staphylococcus aureus subsp. aureus ECT-R 2                                                  TTSYNQGSD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VQSV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SYNAQS−−−−−−−−−−−−−−−−−−SNSNVEAVSAPT−−−−−−−−−−−−YHNYSTSTT−−−−−−−−−−−−−SSSVRLSNGNTAG−−−−−ATGSSAAQIMAQRTGVSASTWAAIIAR−−−−ESNGQVNAYNPSGASGLFQTM−−−−−−−−−PGW−−−−GPTNTVDQQINAAVKAYKAQGLGAWGF
fig|904731.3.peg.789   Staphylococcus aureus subsp. aureus 21201                                                  TTSYNQGSD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VQSV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SYNAQS−−−−−−−−−−−−−−−−−−SNSNVEAVSAPT−−−−−−−−−−−−YHNYSTSTT−−−−−−−−−−−−−SSSVRLSNGNTAG−−−−−ATGSSAAQIMAQRTGVSASTWAAIIAR−−−−ESNGQVNAYNPSGASGLFQTM−−−−−−−−−PGW−−−−GPTNTVDQQINAAVKAYKAQGLGAWGF
fig|505321.3.peg.1512   Staphylococcus aureus subsp. aureus str. CF-Marseille                                                  TTSYNQGSD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VQSV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SYNAQS−−−−−−−−−−−−−−−−−−SNSNVEAVSAPT−−−−−−−−−−−−YHNYSTSTT−−−−−−−−−−−−−SSSVRLSNGNTAG−−−−−ATGSSAAQIMAQRTGVSASTWAAIIAR−−−−ESNGQVNAYNPSGASGLFQTM−−−−−−−−−PGW−−−−GPTNTVDQQINAAVKAYKAQGLGAWGF
fig|1158485.3.peg.659   Staphylococcus aureus M1311                                                  TTSYNQGSN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VQSV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SYNAQS−−−−−−−−−−−−−−−−−−SNSNVEAVSAPT−−−−−−−−−−−−YHNYSTSTT−−−−−−−−−−−−−SSSVRLSNGNTAG−−−−−ATGSSAAQIMAQRTGVSAATWAAIIAR−−−−ESNGQVNAYNPSGASGLFQTM−−−−−−−−−PGW−−−−GPTNTVDQQINAAVKAYKAQGLSAWGF
fig|553583.3.peg.2436   Staphylococcus aureus A9635                                                  TTSYNQGSN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VQSV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SYNAQS−−−−−−−−−−−−−−−−−−SNSNVEAVSAPT−−−−−−−−−−−−YHNYSTSTT−−−−−−−−−−−−−SSSVRLSNGNTAG−−−−−ATGSSAAQIMAQRTGVSAATWAAIIAR−−−−ESNGQVNAYNPSGASGLFQTM−−−−−−−−−PGW−−−−GPTNTVDQQINAAVKAYKAQGLSAWGF
fig|904730.3.peg.75   Staphylococcus aureus subsp. aureus 21200                                                  TTSYNQGSN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VQSV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SYNAQS−−−−−−−−−−−−−−−−−−SNSNVEAVSAPT−−−−−−−−−−−−YHNYSTSTT−−−−−−−−−−−−−SSSVRLSNGNTAG−−−−−ATGSSAAQIMAQRTGVSAATWAAIIAR−−−−ESNGQVNAYNPSGASGLFQTM−−−−−−−−−PGW−−−−GPTNTVDQQINAAVKAYKAQGLSAWGF
fig|1158477.3.peg.1921   Staphylococcus aureus M1216                                                  TTSYNQGSN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VQSV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SYNAQS−−−−−−−−−−−−−−−−−−SNSNVEAVSAPT−−−−−−−−−−−−YHNYSTSTT−−−−−−−−−−−−−SSSVRLSNGNTAG−−−−−ATGSSAAQIMAQRTGVSASTWAAIIAR−−−−ESNGQVNAYNPSGASGLFQTM−−−−−−−−−PGW−−−−GPTNTVDQQINAAVKAYKAQGLSAWGF
fig|1118959.3.peg.2439   Staphylococcus aureus subsp. aureus M013                                                  TTSYNQGSN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VQSV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SYNAQS−−−−−−−−−−−−−−−−−−SNSNVEAVSAPT−−−−−−−−−−−−YHNYSTSTT−−−−−−−−−−−−−SSSVRLSNGNTAG−−−−−ATGSSAAQIMAQRTGVSASTWAAIIAR−−−−ESNGQVNAYNPSGASGLFQTM−−−−−−−−−PGW−−−−GPTNTVDQQINAAVKAYKAQGLSAWGF
fig|273036.6.peg.2571   Staphylococcus aureus RF122                                                  TTSYNQGSN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VQSV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SYNAQS−−−−−−−−−−−−−−−−−−SNSNVEAVSAPT−−−−−−−−−−−−YHNYSTSTT−−−−−−−−−−−−−SSSVRLSNGNTAG−−−−−ATGSSAAQIMAQRTGVSASTWAAIIAR−−−−ESNGQVNAYNPSGASGLFQTM−−−−−−−−−PGW−−−−GPTNTVDQQINAAVKAYKAQGLSAWGF
fig|904738.3.peg.1043   Staphylococcus aureus subsp. aureus 21235                                                  TTSYNQGSN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VQSV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SYNAQS−−−−−−−−−−−−−−−−−−SNSNVEAVSAPT−−−−−−−−−−−−YHNYSTSTT−−−−−−−−−−−−−SSSVRLSNGNTAG−−−−−ATGSSAAQIMAQRTGVSASTWAAIIAR−−−−ESNGQVNAYNPSGASGLFQTM−−−−−−−−−PGW−−−−GPTNTVDQQINAAVKAYKAQGLSAWGF
fig|698737.3.peg.416   Staphylococcus lugdunensis HKU09-01                                             DSQPSTQGYTEGST−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QAV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SSNAQA−−−−−−−−−−−−−−−−−−SNTNVQAVSAPR−−−−−−−−−−−−−SSYQTSTTSYSAPA−−TSSYSSSVRLSNGNTAG−−−−−ATGSSAAAIMAQRTGVPASTWSAIIAR−−−−ESNGQANARNASGASGLFQTM−−−−−−−−−PGW−−−−GSTATVNDQINAAVRAYKAQGLSAWGM
fig|904346.3.peg.1134   Staphylococcus lugdunensis VCU139                                             DSQPSTQGYTEGST−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QAV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SSNAQA−−−−−−−−−−−−−−−−−−SNTNVQAVSAPR−−−−−−−−−−−−−SSYQTSTTSYSAPA−−TSSYSSSVRLSNGNTAG−−−−−ATGSSAAAIMAQRTGVPASTWSAIIAR−−−−ESNGQANARNASGASGLFQTM−−−−−−−−−PGW−−−−GSTATVNDQINAAVRAYKAQGLSAWGM
fig|176279.9.peg.2080   Staphylococcus epidermidis RP62A                                             AVAGSDADYTESSS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NQEV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SANTQS−−−−−−−−−−−−−−−−−−SNTNVQAVSAPT−−−−−−−−−SSESRSYSTSTTSYSAPSHNYSSHSSSVRLSNGNTAG−−−−−SVGSYAAAQMAARTGVSASTWEHIIAR−−−−ESNGQLHARNASGAAGLFQTM−−−−−−−−−PGW−−−−GSTGSVNDQINAAYKAYKAQGLSAWGM
fig|904328.3.peg.503   Staphylococcus epidermidis VCU105                                             AVAGSDADYTESSS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NQEV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SANTQS−−−−−−−−−−−−−−−−−−SNTNVQAVSAPT−−−−−−−−−SSESRSYSTSTTSYSAPSHNYSSHSSSVRLSNGNTAG−−−−−SVGSYAAAQMAARTGVSASTWEHIIAR−−−−ESNGQLHARNASGAAGLFQTM−−−−−−−−−PGW−−−−GSTGSVNDQINAAYKAYKAQGLSAWGM
fig|979217.3.peg.1556   Staphylococcus epidermidis NIHLM008                                             AVAGSDADYTESSS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NQEV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SANTQS−−−−−−−−−−−−−−−−−−SNTNVQAVSAPT−−−−−−−−−SSESRSYSTSTTSYSAPSHNYSSHSSSVRLSNGNTAG−−−−−SVGSYAAAQMAARTGVSASTWEHIIAR−−−−ESNGQLHARNASGAAGLFQTM−−−−−−−−−PGW−−−−GSTGSVNDQINAAYKAYKAQGLSAWGM
fig|525376.3.peg.1825   Staphylococcus epidermidis W23144                                                      TESSS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NQEV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SSNAQS−−−−−−−−−−−−−−−−−−SNTNVQAVSAPT−−−−−−−−−SSESRSYSTSTTSYSAPSHNYSSHSSSVRLSNGNTAG−−−−−SVGSYAAAQMAARTGVSASTWEHIIAR−−−−ESNGQLHARNASGAAGLFQTM−−−−−−−−−PGW−−−−GSTGSVNDQINAAYKAYKAQGLSAWGM
fig|904344.3.peg.1985   Staphylococcus epidermidis VCU128                                                      TESSS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NQEV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SSNAQS−−−−−−−−−−−−−−−−−−SNTNVQAVSAPT−−−−−−−−−SSESRSYSTSTTSYSAPSHNYSSHSSSVRLSNGNTAG−−−−−SVGSYAAAQMAARTGVSASTWEHIIAR−−−−ESNGQLHARNASGAAGLFQTM−−−−−−−−−PGW−−−−GSTGSVNDQINAAYKAYKAQGLSAWGM
fig|546270.5.peg.521   Gemella haemolysans ATCC 10379         VATVDTIKIARTGKTTETKK−−EVIK−−−−−−−FETKEEKDDSKYVDEK−−VTKVEGKNGEKEV−−TYN−−−−−−−−−−−VVREKGKEV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SREVAS−−−−−−−−−−−−−−−−−−EKVITEATAKVVVVGTKQRTAAQQQEVAAAKQSYAAPAQSYSAPGGSVVLSNGNTAG−−−−−AEGAAAAQEMARRTGVPASTWEHIIAR−−−−ESNGQVGARNASGASGLFQTM−−−−−−−−−PGW−−−−GSTATVQDQINAATRAYQAQGLSAWGM
fig|1074130.3.peg.1741   Streptococcus mutans TCI-154          FWVLPFFVGFASL−−−−−−−−−−−−−−−−−−−−FTGESVNTEAHIKKSE−−SVLAHT−−−−−−−−−−−−−−−−−−−−−−−−−−AQAQEV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SQDQQTTSAELTSA−−−−PSEAASSEAITEVA−−−−−−−−−−−−−ATEPTDNVNYNTAYASQAAQVANVNHNGNLANGNTAG−−−−−ATGSEAAAQMAAATGVSQSTWEYIIAR−−−−ESNGQVTAANGSGASGLFQTM−−−−−−−−−PGW−−−−GSTATVQDQVNSAINAYKAQGLSAWGM
fig|1257042.3.peg.1905   Streptococcus mutans NCTC 11060          FWVLPFFVGFASL−−−−−−−−−−−−−−−−−−−−FTGESVNTEAHIKKSE−−SVLAHT−−−−−−−−−−−−−−−−−−−−−−−−−−AQAQEV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SQDQQTTSAELTSA−−−−PSEAASSEAITEVA−−−−−−−−−−−−−ATEPTDNVNYNTAYASQAAQVANVNHNGNLANGNTAG−−−−−ATGSEAAAQMAAATGVSQSTWEYIIAR−−−−ESNGQVTAANGSGASGLFQTM−−−−−−−−−PGW−−−−GSTATVQDQVNSAINAYKAQGLSAWGM
fig|210007.7.peg.1908   Streptococcus mutans UA159          FWVLPFFVGFASF−−−−−−−−−−−−−−−−−−−−FTGESVNTEAHIKKSE−−SVLAHT−−−−−−−−−−−−−−−−−−−−−−−−−−AQAQEV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SQDQQTTSAELTSA−−−−PSEAASSEAITEVA−−−−−−−−−−−−−ATEPTDNVNYNTAYASQAAQVANVNHNGNLANGNTAG−−−−−ATGSEAAAQMAAATGVSQSTWEYIIAR−−−−ESNGQVTAANGSGASGLFQTM−−−−−−−−−PGW−−−−GSTATVQDQVNSAINAYKAQGLSAWGM
fig|322159.7.peg.1910   Streptococcus thermophilus LMD-9                          GLVNAFSDSVIPTPSTTSTTSESTADLVKSTE−−VSSIKE−−−NKEK−−−−−−−−−−−−−−−−−−−−−−VEE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SKAQSETMTETVGA−−−−−SEKPQSESATTAS−−−−−−−−−−−−−−−−IDATFTQNNGAASSVASSTTGNGSVIISNGNTAG−−−−−EIGSYAAAQMAAVTGVPQSTWESIIAR−−−−ESNGDYTVASSSGASDLFQTM−−−−−−−−−PGW−−−−GSTATVEDQIQSALNAYNAQGLSAWNY
fig|299768.6.peg.1990   Streptococcus thermophilus CNRZ1066                 VSLSSLVNKGLVNAFSDSVILTPSTTSTTSESTADLVKSTE−−VSSIKE−−−NKEK−−−−−−−−−−−−−−−−−−−−−−VEE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SKAQSETMTETVGA−−−−−SEKPQSESATTAS−−−−−−−−−−−−−−−−IDATFTQNNGAASSVAASTTGNGSVIISNGNTEG−−−−−EIGSYAAAQMAAVTGVPQSTWESIIAR−−−−ESNGDYTVASSSGASGFFQTM−−−−−−−−−PGW−−−−GSTATVEDQIQSALNAYNAQGLSAWNY
fig|596322.3.peg.1439   Streptococcus salivarius SK126     VAIVTSFIVILAVSLSTLINKGLVNAFSDSVTPAPSTASTTSESTADLVKSTE−−ISSSKENKANKEK−−−−−−−−−−−−−−−−−−−−−−VEE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SKPQSETTGESVEA−−−−−AEKSQSDTATTGAA−−−−−−−−−−−−STNTDTTSTQNTGTAPSVAA−−TGSGSVVLSNGNTAG−−−−−EVGSYAAAQMAAATGVPQSTWESIIAR−−−−ESNGDHTAANGSGASGLFQTM−−−−−−−−−PGW−−−−GSTATVEDQIQSALNAYNAQGLSAWNY
fig|471872.6.peg.479   Streptococcus infantarius subsp. infantarius ATCC BAA-102                    MVVVLIPKIEAFAETITTRSEAGAAKAVSTSSESSEVS−−STSISSTTAESEE−−−−−−−−−−−−−−−−−SSSSSSEE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TEEVEASSTEEVQE−−−−−SESSYAEVAPAND−−−−−−−−−−−−−−−−−−−NTTTVAAATTPSSTTSQTAPSVASNGNTAG−−−−−AVGSDAAAQMAAATGVPQSTWEVIIAR−−−−ESNGDPTVANASGASGLFQTM−−−−−−−−−PGW−−−−GSTATVQDQIATAIKVYNTQGLSAWGY
fig|545774.3.peg.1880   Streptococcus gallolyticus subsp. gallolyticus TX20005         VSVLGATLSLAMIIFLIPKIELFSDTFTTHAEAEVVKSTSTS−−−−−−L−−SSTLNQTVTSTTS−−−−−−−−−−−−−−−−−SESSSAEV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SEVSEEPATEEATE−−−−−VEEVYTESEEPVVE−−−−−−−−−−−−−−−−−−−DTTATESASYTTTSSEVVDATTASNGNTAG−−−−−TVGTEAAAQMAAATGVPQSTWEAIIAR−−−−ESNGDPSVTNASGASGLFQTM−−−−−−−−−PGW−−−−GSTATVQDQITAAINAYNAQGLSAWGY
fig|218495.3.peg.1697   Streptococcus uberis 0140J         SFGILGFAVALLALVFA−−−−−−−−−−−−−−−−−FSSKKVDTESYAKKSE−−SKVVKNVTKSQST−−SSS−−−−−−−−−TQKVEASTEQS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SSSQEQATPDTSVATQSVPVEQVAQPTPTPSTE−−−−−−−−−−−−−−−−VAQQVVPAQPSVPTTQYAATPVTYYQSNGNTAG−−−−−AIGSQAAAQMAAATGVPQSTWEAIIAR−−−−ESNGNPYVSNASGASGLFQTM−−−−−−−−−PGW−−−−GSTATVQDQINSAISAYNAQGLSAWGY
fig|1349.21.peg.983   Streptococcus uberis         SFGILGFAVALLALVFA−−−−−−−−−−−−−−−−−FSSKKVDTESYAKKSE−−SKVVKNVTKSQST−−SSS−−−−−−−−−TQKVEASTEQS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SSSQEQATPDTSVATQSVPVEQVAQPTPTPSTE−−−−−−−−−−−−−−−−VAQQVVPAQPSVPTTQYAATPVTYYQSNGNTAG−−−−−AIGSQAAAQMAAATGVPQSTWEAIIAR−−−−ESNGNPYVSNASGASGLFQTM−−−−−−−−−PGW−−−−GSTATVQDQINSAISAYNAQGLSAWGY
fig|1154854.3.peg.593   Streptococcus agalactiae STIR-CD-26         AITLVALFSCILAVTVI−−−−−−−−−−−−−−−−−FKSSQVTTESLSKADK−−VRVAKKSKMTKATSKSKVEDVKQAPKPSQASNEAPKSS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SQSTEANSQQQVTASEEAAVEQAVVTENTPATS−−−−−−−−−−−−−−−−−−QAQQAYAVTETTYRPAQHQTSGQVLSNGNTAG−−−−−AIGSAAAAQMAAATGVPQSTWEHIIAR−−−−ESNGNPNVANASGASGLFQTM−−−−−−−−−PGW−−−−GSTATVQNQVNSAIKAYRAQGLSAWGY
fig|1156939.3.peg.44   Streptococcus agalactiae ZQ0910         AITLVALFSCILAVTVI−−−−−−−−−−−−−−−−−FKSSQVTTESLSKADK−−VRVAKKSKMTKATSKSKVEDVKQAPKPSQASNEAPKSS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SQSTEANSQQQVTASEEAAVEQAVVTENTPATS−−−−−−−−−−−−−−−−−−QAQQAYAVTETTYRPAQHQTSGQVLSNGNTAG−−−−−AIGSAAAAQMAAATGVPQSTWEHIIAR−−−−ESNGNPNVANASGASGLFQTM−−−−−−−−−PGW−−−−GSTATVQNQVNSAIKAYRAQGLSAWGY
fig|1266069.3.peg.1968   Streptococcus agalactiae CF01173         AITLVALFSCILAVTVI−−−−−−−−−−−−−−−−−FKSSQVTTESLSKADK−−VRVAKKSKMTKATSKSKVEDVKQAPKPSQASNEAPKSS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SQSTEANSQQQVTASEEAAVEQAVVTENTPATS−−−−−−−−−−−−−−−−−−QAQQAYAVTETTYRPAQHQTSGQVLSNGNTAG−−−−−AIGSAAAAQMAAATGVPQSTWEHIIAR−−−−ESNGNPNVANASGASGLFQTM−−−−−−−−−PGW−−−−GSTATVQNQVNSAIKAYRAQGLSAWGY
fig|1154893.3.peg.918   Streptococcus agalactiae GB00012         AITLVALFSCILAVTVI−−−−−−−−−−−−−−−−−FKSSQVTTESLSKADK−−VRVAKKSKMNKATSKSKVEGVKQAPKP−−−−−−−−−−S−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SQSTEANSQQQVTASEEAAVEQAVVTENTPATS−−−−−−−−−−−−−−−−−−QAQQAYAVTETTYRPAQHQPSGQVLSNGNTAG−−−−−AIGSAAAAQMAAATGVPQSTWEHIIAR−−−−ESNGNPNVANASGASGLFQTM−−−−−−−−−PGW−−−−GSTATVQDQVNSAIKAYRAQGLSAWGY
fig|1154811.3.peg.1116   Streptococcus agalactiae CCUG 37737         AITLVALFSCILAVMVI−−−−−−−−−−−−−−−−−FKSSQVTTESLSKADK−−VRVAKKSKMTKATSKSKVEDVKQAPKPSQASNEAPKSS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SQSTEANSQQQVTASEEAAVEQAVVTENTPATS−−−−−−−−−−−−−−−−−−QAQQAYAVTETTYRPAQHQTSGQVLSNGNTAG−−−−−AIGSAAAAQMAAATGVPQSTWEHIIAR−−−−ESNGNPNVANASGASGLFQTM−−−−−−−−−PGW−−−−GSTATVQDQVNSAIKAYRAQGLSAWGY
fig|1154911.3.peg.320   Streptococcus agalactiae GB00245         AITLVALFSCILAVMVI−−−−−−−−−−−−−−−−−FKSSQVTTESLSKADK−−VRVAKKSKMTKATSKSKVEDVKQAPKPSQASNEAPKSS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SQSTEANSQQQVTASEEAAVEQAVVTENTPATS−−−−−−−−−−−−−−−−−−QAQQAYAVTETTYRPAQHQTSGQVLSNGNTAG−−−−−AIGSAAAAQMAAATGVPQSTWEHIIAR−−−−ESNGNPNVANASGASGLFQTM−−−−−−−−−PGW−−−−GSTATVQDQVNSAIKAYRAQGLSAWGY
fig|1336.3.peg.1702   Streptococcus equi                        FA−−−−−−−−−−−−−−−−−FSSENVNTDSYAKASD−−TKVVKKHHKTKKSTVAKA−−−−−−−−−−−−−−ATKEQP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AEQAEPSSADAAPA−−−−−QESVASEVASPAVQ−−−−−−−−−−−−−−−−−−−−−EAAPQAQYAATPVAYSNGVILSNGNTAG−−−−−AIGSEAAAQMAAATGVPQATWEAIIAR−−−−ESNGNPNAANPSGASGLFQTM−−−−−−−−−PGW−−−−GSTATVQDQVNSALNAYRAQGLSAWGY
fig|40041.11.peg.2058   Streptococcus equi subsp. zooepidemicus                        FA−−−−−−−−−−−−−−−−−FSSENVNTDSYAKASD−−TKVVKKHHKTKKSTVAKA−−−−−−−−−−−−−−ATKEQP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AEQAEPSSADAAPA−−−−−QEPVASEV−−−AVQ−−−−−−−−−−−−−−−−−−−−−EAAPQAQYAATPVAYSNGVVLSNGNTAG−−−−−AIGSEAAAQMAAATGVPQATWEAIIAR−−−−ESNGNPNAANPSGASGLFQTM−−−−−−−−−PGW−−−−GSTATVQDQVNSALNAYRAQGLSAWGY
fig|552526.7.peg.1962   Streptococcus equi subsp. zooepidemicus MGCS10565                        FA−−−−−−−−−−−−−−−−−FSSENVNTDSYAKASD−−TKVVKKHHKAKKSTAAKA−−−−−−−−−−−−−−ATKEQP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AEQAEASSADVAPA−−−−−QESVASEVASPAVQ−−−−−−−−−−−−−−−−−−−−−EAAPQAQYAATPVAYSNGVVLSNGNTAG−−−−−AIGSEAAAQMAAATGVPQATWEAIIAR−−−−ESNGNPNAANPSGASGLFQTM−−−−−−−−−PGW−−−−GSTATVQDQVNSALNAYRAQGLSAWGY
fig|486410.3.peg.2135   Streptococcus dysgalactiae subsp. equisimilis GGS_124         SFGVIAVAIAMLAVIFA−−−−−−−−−−−−−−−−−FSSKNVDTDSYAKKSE−−PKVIKKVKKAKKT−−SQE−−−−−−−−−−−−−−AVKEEP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KKESAEATSEPAPA−−−−−AEQ−−AAPAAEATP−−−−−−−−−−−−−−−−−VVQQETTQVVQYTAAPVAYSSGGVVLSNGNTAG−−−−−VVGSQAAAQMAAATGVPQSTWEHIIAR−−−−ESNGNPSAANASGASGLFQTM−−−−−−−−−PGW−−−−GSTVTVQDQVNSALNAYRAQGLSAWGY
fig|1207470.4.peg.1902   Streptococcus pyogenes M1 476          FGLVALALTILAIIFA−−−−−−−−−−−−−−−−−FSSKNADTKSYAKKSE−−SKMVTIDKAPKN−−−NHA−−−−−−−−−−−−−−ITKEES−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KEKAKSIASEPIPT−−−−−VENSVAPTVTEEVP−−−−−−−−−−−−−−−−−VVQQEVTQTVQQVSSVAYNPNNVVLSNGNTAG−−−−−IVGSQAAAQMAAATGVPQSTWEHIIAR−−−−ESNGNPNAANASGASGLFQTM−−−−−−−−−PGW−−−−GSTATVEDQVNAALKAYSAQGLSAWGY
fig|487215.4.peg.1786   Streptococcus pyogenes Alab49          FGLVALALTILAIIFA−−−−−−−−−−−−−−−−−FSSKNADTKSYAKKSE−−SKMVTIDKAPKN−−−NHA−−−−−−−−−−−−−−ITKEES−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KEKVKSIASEPIPT−−−−−VENSVAPTVTEEAP−−−−−−−−−−−−−−−−−VVQQEVTQTVQQVSSVAYNPNNVVLSNGNTAG−−−−−IVGSQAAAQMAAATGVPQSTWEHIIAR−−−−ESNGNPNAANASGASGLFQTM−−−−−−−−−PGW−−−−GSTATVEDQVNAALKAYSAQGLSAWGY
fig|319701.3.peg.893   Streptococcus pyogenes MGAS6180          FGLVALALTILAIIFA−−−−−−−−−−−−−−−−−FSSKNADTKSYAKKSE−−SKMVTIDKAPKN−−−NHA−−−−−−−−−−−−−−ITKEES−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KDKSKSIASEPIPT−−−−−VENSVAPTVTEEAP−−−−−−−−−−−−−−−−−VVQQEVTQTVQQVSSVAYNPNNVVLSNGNTAG−−−−−IVGSQAAAQMAAATGVPQSTWEHIIAR−−−−ESNGNPNAANASGASGLFQTM−−−−−−−−−PGW−−−−GSTATVEDQVNAALKAYSAQGLSAWGY
fig|370552.3.peg.1962   Streptococcus pyogenes MGAS10270          FGLVALALTILAIIFA−−−−−−−−−−−−−−−−−FSSKNADTKSYAKKSE−−SKMVTIDKAPKN−−−NHA−−−−−−−−−−−−−−ITKEES−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KEKAKSIASEPIPT−−−−−VENSVAPTVTEEAP−−−−−−−−−−−−−−−−−VVQQEVTQTVQQVSSVAYNPNNVVLSNGNTAG−−−−−IVGSQAAAQMAAATGVPQSTWEHIIAR−−−−ESNGNPNAANASGASGLFQTM−−−−−−−−−PGW−−−−GSTATVEDQVNAALKAYSAQGLSAWGY
fig|370554.3.peg.1959   Streptococcus pyogenes MGAS10750          FGLVALALTILAIIFA−−−−−−−−−−−−−−−−−FSSKNDDTKSYAKKSE−−SKMVTIDKAPKN−−−NHA−−−−−−−−−−−−−−ITKEES−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KEKAKSIASEPIPT−−−−−VENSVAPTVTEEAP−−−−−−−−−−−−−−−−−VVQQEETQTVQQVSSVAYNPNNVVLSNGNTAG−−−−−IVGSQAAAQMAAATGVPQSTWEHIIAH−−−−ESNGNPNAANASGASGLFQTM−−−−−−−−−PGW−−−−GSTATVEDQVNAALKAYSAQGLSAWGY
fig|286636.3.peg.1934   Streptococcus pyogenes MGAS10394          FGLVALALTILAIIFA−−−−−−−−−−−−−−−−−FSSKNADTKSYAKKSE−−SKMVTIDKAPKN−−−NHA−−−−−−−−−−−−−−ITKEES−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KEKAKSIASEPIPT−−−−−VENSVAPTVTEEAP−−−−−−−−−−−−−−−−−VIQQEVTQTVQQVSSVAYNPNNVVLSNGNTAG−−−−−IVGSQAAAQMAAATGVPQSTWEHIIAR−−−−ESNGNPNAANASGASGLFQTM−−−−−−−−−PGW−−−−GSTATVEDQVNAALKAYSAQGLSAWGY