(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00006221

fig|221109.1.peg.1333   Oceanobacillus iheyensis HTE831     MKCEVQLLYKNLRYRILEINGEEYVLDFGNSIWKIIFPFLHWVLPNPVYKID−−NHEIIEKLEV−−PQENHPKK−−ISTGTGALGGLVGGVFLANLLRPLANVFNIPSTSLVNLIITIIVLIIALSVFVYVNRRHEKNLTAIVDYTHYPRKKIWIKPPTLKFFFNICFAY−−−−−−LFFMALTVVPL−−MGFIE−−−−−−TGDMFIFVPGVVFLFVSFMITYMTIPPGNTTVRFKD 
fig|221109.4.peg.1350   Oceanobacillus iheyensis HTE831     LKCEVQLLYKNLRYRILEINGEEYVLDFGNSIWKIIFPFLHWVLPNPVYKID−−NHEIIEKLEV−−PQENHPKK−−ISTGTGALGGLVGGVFLANLLRPLANVFNIPSTSLVNLIITIIVLIIALSVFVYVNRRHEKNLTAIVDYTHYPRKKIWIKPPTLKFFFNICFAY−−−−−−LFFMALTVVPL−−MGFIE−−−−−−TGDMFIFVPGVVFLFVSFMITYMTIPPGNTTVRFKD 
fig|221109.1.peg.1340   Oceanobacillus iheyensis HTE831     MKCNVQGVFKNLRYRIVEIDEEKYILDMGNSIWKIIFPFLHWVLPKPVYKID−−NQVIVEKLKV−−PDGSQPKT−−ISTGTGALGGLIGVVLASLIRPLANMFHIPSTPLINFIITIVVVIIALSVFVYINTRSKRKLTAIVDYNHYPRKKLWIRLPSLKFFFNISFSY−−−−−−LFFMAFTVVPF−−MGFIE−−−−−−TGNIIVFIGSI                          
fig|221109.4.peg.1358   Oceanobacillus iheyensis HTE831     MKCNVQGVFKNLRYRIVEIDEEKYILDMGNSIWKIIFPFLHWVLPKPVYKID−−NQVIVEKLKV−−PDGSQPKT−−ISTGTGALGGLIGVVLASLIRPLANMFHIPSTPLINFIITIVVVIIALSVFVYINTRSKRKLTAIVDYNHYPRKKLWIRLPSLKFFFNISFSY−−−−−−LFFMAFTVVPF−−MGFIE−−−−−−TGNIIVFIGSI                          
fig|221109.1.peg.1324   Oceanobacillus iheyensis HTE831     MNCNVQFVFKNLRYRILEIDEEEYILDMGNSVWKIIFPFLHWVLPNPVYKLD−−NHEIVKRLKV−−PEREQPKT−−ISAGTGALGGLIGVFLASLIRPLANMFHIPSTSLINFIITILVVIIALSVFIYINTRSKNNLTAIVDYKHYPRKKLWIRPPSLKFFSSLCFFY−−−−−−LFFMALTVVPL−−MGFIE−−−−−−TGNIIIFFGSIFFLFVTFMINYFTILVGNTTVRFRD 
fig|221109.4.peg.1340   Oceanobacillus iheyensis HTE831     MNCNVQFVFKNLRYRILEIDEEEYILDMGNSVWKIIFPFLHWVLPNPVYKLD−−NHEIVKRLKV−−PEREQPKT−−ISAGTGALGGLIGVFLASLIRPLANMFHIPSTSLINFIITILVVIIALSVFIYINTRSKNNLTAIVDYKHYPRKKLWIRPPSLKFFSSLCFFY−−−−−−LFFMALTVVPL−−MGFIE−−−−−−TGNIIIFFGSIFFLFVTFMINYFTILVGNTTVRFRD 
fig|221109.1.peg.1338   Oceanobacillus iheyensis HTE831     MYCKAQAVYKNPRYKILVINEQRYILDMGGKSFWKILFPFMYWIFPNNTYKVN−−NLEIIEKIKT−−PDIDQKD−−VGGGMSILGGVVAILLANLLRPLANVFNIPSTPIVNAIIVLMVLLLVLILVFNISKRCKKRINHELDIEQYEEEQVWIRPNSIKQLLFILFAY−−−−−−LFFLGFTTLAL−−SGFIY−−−−−−SGDVMTLVMGTPILLVLLAISIITINGDTIVRFKGK
fig|221109.4.peg.1356   Oceanobacillus iheyensis HTE831     MYCKAQAVYKNPRYKILVINEQRYILDMGGKSFWKILFPFMYWIFPNNTYKVN−−NLEIIEKIKT−−PDIDQKD−−VGGGMSILGGVVAILLANLLRPLANVFNIPSTPIVNAIIVLMVLLLVLILVFNISKRCKKRINHELDIEQYEEEQVWIRPNSIKQLLFILFAY−−−−−−LFFLGFTTLAL−−SGFIY−−−−−−SGDVMTLVMGTPILLVLLAISIITINGDTIVRFKGK
fig|221109.1.peg.1342   Oceanobacillus iheyensis HTE831     MDCKVNGVYKNLRYRILVINSHTYILDLGKSFWKIIFPFLIWILPNPLYKIE−−NKEIVEKLKT−−PEVH−−QT−−NTGGQGLIGGGIAVLIANLLRPLTDYFNIQSSTMVNSVIVIVAILLLLSLRLYINHLNKKNLYRVIEAEKLTPDKVLISPKPIKHFFLILGMY−−−−−−LFFLAFTILLF−−IAFIQ−−−−−−IPNILILLITMSLWFLVLFTNSITIAVGNTRVKFISK
fig|221109.4.peg.1362   Oceanobacillus iheyensis HTE831     MDCKVNGVYKNLRYRILVINSHTYILDLGKSFWKIIFPFLIWILPNPLYKIE−−NKEIVEKLKT−−PEVH−−QT−−NTGGQGLIGGGIAVLIANLLRPLTDYFNIQSSTMVNSVIVIVAILLLLSLRLYINHLNKKNLYRVIEAEKLTPDKVLISPKPIKHFFLILGMY−−−−−−LFFLAFTILLF−−IAFIQ−−−−−−IPNILILLITMSLWFLVLFTNSITIAVGNTRVKFISK
fig|221109.1.peg.1335   Oceanobacillus iheyensis HTE831     MNCKVNHLDKNMRYRILIINSEQYILDMERSFWKIIFPFLFWLTPSPVFKVE−−DQDIVEELKM−−VKKE−−KL−−ESSWILS−−LGGFGYAIGILLAPLMDYFNIPSSPLINNILLIIAIALTAFLYFGISYRRQKKLQNIVELKELPRSKLWIRPSSTNLVFKFLTAY−−−−−−ICLLGFVSFLF−−LGFID−−−−−−TRNIMILIIASGFFFLLLLANRPTVDEGNTTVKFKDY
fig|221109.4.peg.1352   Oceanobacillus iheyensis HTE831     MNCKVNHLDKNMRYRILIINSEQYILDMERSFWKIIFPFLFWLTPSPVFKVE−−DQDIVEELKM−−VKKE−−KL−−ESSWILS−−LGGFGYAIGILLAPLMDYFNIPSSPLINNILLIIAIALTAFLYFGISYRRQKKLQNIVELKELPRSKLWIRPSSTNLVFKFLTAY−−−−−−ICLLGFVSFLF−−LGFID−−−−−−TRNIMILIIASGFFFLLLLANRPTVDEGNTTVKFKDY
fig|272558.1.peg.979   Bacillus halodurans C-125     MKCEVQKAMNVRFRILKIEGDTYILDMSQSIWKIVFPFLTWIIPLTIYKVD−−GEEINKKLQF−−STKDQ−−−−−KKNNISILLTAGIGIALGNLLTALTDYFYIQSTVLVNSIIAGIVMGIIIVVRFVLSNRNKNNFYQRVAPNVLSKERIWIRPKSFKHFIQALFGY−−−−−−IFFLVFFIAAI−−VLFIT−−−−−−GGNVIAIVSATIFALALSVIDVLYVVEGPTTVKFKKK
fig|221109.1.peg.3293   Oceanobacillus iheyensis HTE831     MSSEVNIIKKNLRYNLIKADNEYYIIDKDQPFLTNFLLPFLYWIFPKKVTKIS−−GDTAEQIQT−−VSNK−−EA−−TTSKVSYIGIGFSVILANLIGPLLDYLDVDITPFIAYSILFLITLLLVLFRVIVSNKFKHSLFQQLHLSPNQADETLWVTPRRVKNIASLLFLT−−−−−−IFIWAFVVGGL−−VSFFL−−−−−−YGNLFMLFVFTLAFFILLFLNILCVTPGKDTMKIR  
fig|221109.4.peg.3343   Oceanobacillus iheyensis HTE831     MSSEVNIIKKNLRYNLIKADNEYYIIDKDQPFLTNFLLPFLYWIFPKKVTKIS−−GDTAEQIQT−−VSNK−−EA−−TTSKVSYIGIGFSVILANLIGPLLDYLDVDITPFIAYSILFLITLLLVLFRVIVSNKFKHSLFQQLHLSPNQADETLWVTPRRVKNIASLLFLT−−−−−−IFIWAFVVGGL−−VSFFL−−−−−−YGNLFMLFVFTLAFFILLFLNILCVTPGKDTMKIR  
fig|221109.1.peg.3292   Oceanobacillus iheyensis HTE831     MKANVQFVYKKARYNLITMNGENYILDKDSPKWIIWLPFLFWFISHRAYKVD−−SEVTVNKL−−−−VRHSEKT−−SGSTINILAIGISLILANLIRPIMDSFNIDMSTFLATLIVLVVTVLMFLLRIYIGRNNQQKLYAQVSSELRNVKELHIKVKSMGYFLIYTGCY−−−−−−LFILAFLIACA−−MMYII−−−−−−YGNTIILVVYTMLAFIFFMGNLFTVTPGQMEVRVKD 
fig|221109.4.peg.3342   Oceanobacillus iheyensis HTE831     MKANVQFVYKKARYNLITMNGENYILDKDSPKWIIWLPFLFWFISHRAYKVD−−SEVTVNKL−−−−VRHSEKT−−SGSTINILAIGISLILANLIRPIMDSFNIDMSTFLATLIVLVVTVLMFLLRIYIGRNNQQKLYAQVSSELRNVKELHIKVKSMGYFLIYTGCY−−−−−−LFILAFLIACA−−MMYII−−−−−−YGNTIILVVYTMLAFIFFMGNLFTVTPGQMEVRVKD 
fig|467705.8.peg.1435   Streptococcus gordonii str. Challis substr. CH1             KRNLRYRILKTEDEYYLLDVERPFLIVYFLPLLIYFVPHRCYEMS−−KDEYEQLSQSMEKNTRLKEAFEKHGLGYSLGAGIGAMLLSRVFDINQFLKFDSSRISNFLAILIVLLVFGLRLWITASHEVLSGLK−−−−−NRGYHKIYVYPRFVKELFFNIFAY−−−−−−IISVLLTIVLI−−SAFFTNQ−−−−VDNYIVHIGLLIFLSFWLFI                 
fig|1138889.3.peg.1031   Enterococcus faecium E1050                LRYVILESKSGYYLIDTDHYTFWGGYLFPIFNWIIPHKVMKINLPAEEINRLIL−−NKDLQRKREKEHSNVAWIGPAFAVVTSSIVGPMLESIYSDFSIGIRYLFVTLSIAVLLCIKGYVSKKNKDILTLIGVN−−NLSSTKIILFPESIKEGSRLLIIF−−−−−−IMLILFSVLFG−−VMFI−−D−−−−TNNWFILAGVMLFSSFYLFSN                
fig|565665.3.peg.1555   Enterococcus faecium D344SRF                LRYVILESKSGYYLIDTDHYTFWGGYLFPIFNWIIPHKVMKINLPAEEINRLIL−−NKDLQRKREKEHSNVAWIGPAFAVVTSSIVGPMLESIYSDFSIGIRYLFVTLSIAVLLCIKGYVSKKNKDILTLIGVN−−NLSSTKIILFPESIKEGSRLLIIF−−−−−−IMLILFSVLFG−−VMFI−−D−−−−TNNWFILAGVMLFSSFYLFSN                
fig|525378.3.peg.1856   Staphylococcus epidermidis M23864:W1         IQSIGESNRYKLIIYSGSFYILDIEKNIFTYFFPFINYLFPRYLREID−−QTTAERLMT−−KQKS−−EV−−KKSNYVFPICLSIIISTLLRTVVHQFDISVNSIFLLFSVITSISSVLLLRLWLSYFNNKHIEIKY−−−−SNHKIKALLIPPRKYIFKSIGIF−−−−−−CYFSILYCLGM−−YAFIVSN−−−−KFNLLILIAGMILLFIITLTNYFLYP           
fig|1034809.4.peg.631   Staphylococcus lugdunensis N920143         IDSIKNNSKYKIIHDGEKHYVIDLNRNKLTYIFPLLNYLLPHRLMEIS−−DDAYFSLTT−−VQQSVES−−KVKNMMITLIGIVILFIYYRANVVDNFFLKH−−−YPPLIIIALMVLIFIIKWLIDKRKRKRLNIEQ−−−−IETEKRAYIFPEIFTMVISIILY−−−−−−VIAVVSFVFLSF−−KIFGSMGEPHLNSNVLIIMLAIILSFDQLLYSNSETSGKMSHIKVK  
fig|698737.3.peg.632   Staphylococcus lugdunensis HKU09-01         IDSIKNNSKYKIIHDGEKHYVIDLNRNKLTYIFPLLNYLLPHRLMEIS−−DDAYFSLTT−−VQQSVES−−KVKNMMITLIGIVILFIYYRANVVDNFFLKH−−−YPPLIIIALMVLIFIIKWLIDKRKRKRLNIEQ−−−−IETEKRAYIFPEIFTMVISIILY−−−−−−VIAVVSFVFLSF−−KIFGSMGEPHLNSNVLIIMLAIILSFDQLLYSNSETSGKMSHIKVK  
fig|525378.3.peg.586   Staphylococcus epidermidis M23864:W1        EIISIKGNSKYKLIKYEGKNYVIDLNSNKLSYIFPLLNYFAPHKLIEVS−−LNDINNEKS−−ITKNEDK−−LNDALLSLSVGITVILGVLLRPLFDYGNFPSSRIFNLLIILLTNFALILTKFIFDKRKRDVLALRN−−−−GTNVKLAYILPNFKIVIKNTVLY−−−−−−LILSFLYLMSL−−IAFYSME−−−−NSNIFFILTMIIFLLLILFQNIRLYGKIKIYGKISE 
fig|525376.3.peg.328   Staphylococcus epidermidis W23144                                              MNYLTKQVLIEID−−KDQLGNIRKNHINEN−−−−−−KNNALGSIGTGIGVLFGILSKPILDYMNFTTNLLLNIILVLIAIIPLITLKEIINRKKKKKLKIRM−−−−TKNKMSAFVLPNFKELFKNTIIN−−−−−−IILSFIIIALV−−FGFIIRN−−−−QSNYIYILGIMLVLSFILFQNVLLYAQTEI       
fig|979211.3.peg.1739   Staphylococcus epidermidis NIHLM023                                              MNYLTKQVLIEID−−KDQLGNIRKNHINEN−−−−−−KNNALGSIGTGIGVLFGILSKPILDYMNFTTNLLLNIILVLIAIIPLITLKEIINRKKKKKLKIRM−−−−TKNKMSAFVLPNFKELFKNTIIN−−−−−−IILSFIIIALV−−FGFIIRN−−−−QSNYIYILGIMLVLSFILFQNVLLYAQTEI       
fig|525378.3.peg.1808   Staphylococcus epidermidis M23864:W1         IETIKKNSKYKLIHYRDSHYIIDLNQNKLTYIFPLLNYVTRKSLVEVK−−EKDLNDITTIFTSKEEKE−−KRDSLTILASGISGFIAITTKSITDYLEFTTNMYINVFILLLTILPTLAFKNIFDNKKKKIMIRS−−−−TEVQAYAFVLPSKKYIFQNIFLY−−−−−−TFFIYMFIVSV−−AGVLTLK−−−−HTNIFFVVGIIITFMAILFQNLVLYAQTTIH      
fig|525378.3.peg.588   Staphylococcus epidermidis M23864:W1                                             MLNYITRQPLIEVN−−KNELKDIRTAFISKNEKN−−KRDSLNILGAGVAVLIATLTRSLIDYLNFSTNILINIMFVLIAIIPIVLIKSIVDRKKKTKLGIEL−−−−SYAESKAFILPNSKVLFQNIIYN−−−−−−LPITFIFIATT−−YGFLWLK−−−−QTNIIFVLGIMIFLTFILFQNVILYAQTTI       
fig|386043.6.peg.1884   Listeria welshimeri serovar 6b str. SLCC5334        KIRPIFKNTRYKILEYDSKFYLIDMDRGFYGFILFALSWLIPKKAILIP−−QMDADDLII−−KKA−−−YK−−SSHSIRVILLMCVIIISNLVLPSFLMKFFEGGLILS−−LCILSIFGVLIRIIYSKRNKIKCKNRE−−−−GNQEVLIKLRPQKWPYYFKSVCVY−−−−−−VLFLAVLVIGA−−YLFIIVK−−−−−GYWILSFCYTIVIFIFLLTNYLAY            
fig|386043.6.peg.2009   Listeria welshimeri serovar 6b str. SLCC5334        KIRPIFKNTRYKILEYDSKFYLIDMDRGFYGFILFALSWLIPKKAILIP−−QMDADDLII−−KKA−−−YK−−SSHSIRVILLMCVIIISNLVLPSFLMKFFEGGLILS−−LCILSIFGVLIRIIYSKRNKIKCKNRE−−−−GNQEVLIKLRPQKWPYYFKSVCVY−−−−−−VLFLAVLVIGA−−YLFIIVK−−−−−GYWILSFCYTIVIFIFLLTNYLAY            
fig|386043.9.peg.1948   Listeria welshimeri serovar 6b str. SLCC5334        KIRPIFKNTRYKILEYDSKFYLIDMDRGFYGFILFALSWLIPKKAILIP−−QMDADDLII−−KKA−−−YK−−SSHSIRVILLMCVIIISNLVLPSFLMKFFEGGLILS−−LCILSIFGVLIRIIYSKRNKIKCKNRE−−−−GNQEVLIKLRPQKWPYYFKSVCVY−−−−−−VLFLAVLVIGA−−YLFIIVK−−−−−GYWILSFCYTIVIFIFLLTNYLAY            
fig|386043.9.peg.2076   Listeria welshimeri serovar 6b str. SLCC5334        KIRPIFKNTRYKILEYDSKFYLIDMDRGFYGFILFALSWLIPKKAILIP−−QMDADDLII−−KKA−−−YK−−SSHSIRVILLMCVIIISNLVLPSFLMKFFEGGLILS−−LCILSIFGVLIRIIYSKRNKIKCKNRE−−−−GNQEVLIKLRPQKWPYYFKSVCVY−−−−−−VLFLAVLVIGA−−YLFIIVK−−−−−GYWILSFCYTIVIFIFLLTNYLAY            
fig|525376.3.peg.327   Staphylococcus epidermidis W23144            IHKNPRYKLIELDQKKYLIDLESNCFTYLFPPLNWILKKELIEIS−−NDKLNEIEY−−DDNNNKE−−QAKNIGCVSGGGGVLIATLMRPFMDLMDVPSNQSINSLIVILTVLVIIFIRGSLRKRWDLKLNSS−−−−−KTHIIKCIVRFKLKHMFFVIGAY−−−−−−LMFLLFSLLMI−−GLIFGVE−−−−−NNLMIYIGSPLIFFMFSLTNLITYDNEEIIISKLSQ
fig|979211.3.peg.1740   Staphylococcus epidermidis NIHLM023            IHKNPRYKLIELDQKKYLIDLESNCFTYLFPPLNWILKKELIEIS−−NDKLNEIEY−−DDNNNKE−−QAKNIGCVSGGGGVLIATLMRPFMDLMDVPSNQSINSLIVILTVLVIIFIRGSLRKRWDLKLNSS−−−−−KTHIIKCIVRFKLKHMFFVIGAY−−−−−−LMFLLFSLLMI−−GLIFGVE−−−−−NNLMIYIGSPLIFFMFSLTNLITYDNEEIIISKLSQ
fig|525376.3.peg.345   Staphylococcus epidermidis W23144            IHKNPRYKVIELNKTKYLIDLESNYVTYLLPMLNWILDKELIEVS−−RETLEKIEY−−DNNTNKE−−QTKGLGWLAGGGGVLFATLMRPFMDLMNIPSNLFINLLIVILSIIIVVFIRAYLRKKWDLKLKQ−−−−−−KNHVIKCKVRSNAKHMFTAIALY−−−−−−FMFLLQSIFMI−−SLIFGVK−−−−−NNLIIYIGLPIIIFVFSLTNLITYDNNEVIVTKSRQ
fig|979211.3.peg.318   Staphylococcus epidermidis NIHLM023            IHKNPRYKVIELNKTKYLIDLESNYVTYLLPMLNWILDKELIEVS−−RETLEKIEY−−DNNTNKE−−QTKGLGWLAGGGGVLFATLMRPFMDLMNIPSNLFINLLIVILSIIIVVFIRAYLRKKWDLKLKQ−−−−−−KNHVIKCKVRSNAKHMFTAIALY−−−−−−FMFLLQSIFMI−−SLIFGVK−−−−−NNLIIYIGLPIIIFVFSLTNLITYDNNEVIVTKSRQ
fig|525376.3.peg.326   Staphylococcus epidermidis W23144            IHKNPRYKLIELNQKKYLIDLEANYFFYLFPMLNWILKKELIEIT−−NDKLNEIEY−−DNKTNKE−−RSQNIRWISGGAGVLMALLMRPFMDLLDVPSNIYINIIIFIILVFSVISIRIYLRKKWDLKLKE−−−−−−NNPRMNCKMRPTFKYMIVATGAY−−−−−−LLFLALSIFMF−−PLIFLEK−−−−−LNILMCLCSLTFFFFFSIMNIIAFDNEKVIISKLSQ
fig|979211.3.peg.1741   Staphylococcus epidermidis NIHLM023            IHKNPRYKLIELNQKKYLIDLEANYFFYLFPMLNWILKKELIEIT−−NDKLNEIEY−−DNKTNKE−−RSQNIRWISGGAGVLMALLMRPFMDLLDVPSNIYINIIIFIILVFSVISIRIYLRKKWDLKLKE−−−−−−NNPRMNCKMRPTFKYMIVATGAY−−−−−−LLFLALSIFMF−−PLIFLEK−−−−−LNILMCLCSLTFFFFFSIMNIIAFDNEKVIISKLSQ
fig|979221.3.peg.1756   Staphylococcus epidermidis NIH05001         VYTIYKNPRYNIIQKDNRYLMVDLEQNWYSYLCPMLNWFIPIKFTELT−−YQEFNNINI−−FHNG−−−−−−GQKSHGMMAAGVGVTISVLLRSLVGYIDINISRIWIVFMFLIGFVAVITLRLSIRKKLNHPAFN−−−−−−KKSKQKVILIPSFKNMILVVFCY−−−−−−FMMLFFSIAPF−−QMIFEE−−−−KKNILGYILWVGVLFIFTTLNMASISDRKVHAKIKN 
fig|525374.3.peg.927   Staphylococcus epidermidis BCM-HMP0060         VYTIYKNPRYNIIQKDNRYLMVDLEQNWYSYLCPMLNWFIPIKFTELT−−YQEFNNINI−−FHNG−−−−−−GQKSQGMLAGGIGVTISVLLRSLVGYIDINISRIWIVFMFLIGFVAVITLRLSIRKKLNHPAFN−−−−−−KKSKQKVILIPSFKNMILVVFCY−−−−−−FMMLFFSIAPF−−QMIFEE−−−−KKNILGYILWVGVLFIFTTLNMASITDRKVHAKIKN 
fig|525376.3.peg.318   Staphylococcus epidermidis W23144         VYTIYKNPRYKIIQKDNRYLMVDLEQNWYSYLCPMLNWFIPIKCTELT−−YQEFNNLNI−−FNNG−−−−−−GQNSHGMMAAGIGVTISVLLRSIVGFMDINISRIWIAIMFLIGFIAVIALRLSIRKKLNHPAFN−−−−−−KKSKQKVMLIPSFKNMILVVFCY−−−−−−LMSIYLITGLF−−HMMVIEN−−−−IQNIWIYICWLGIFFAFTFMNIAAILDRKVHAKLK  
fig|979211.3.peg.1749   Staphylococcus epidermidis NIHLM023         VYTIYKNPRYKIIQKDNRYLMVDLEQNWYSYLCPMLNWFIPIKCTELT−−YQEFNNLNI−−FNNG−−−−−−GQNSHGMMAAGIGVTISVLLRSIVGFMDINISRIWIAIMFLIGFIAVIALRLSIRKKLNHPAFN−−−−−−KKSKQKVMLIPSFKNMILVVFCY−−−−−−LMSIYLITGLF−−HMMVIEN−−−−IQNIWIYICWLGIFFAFTFMNIAAILDRKVHAKLK  
fig|1034809.4.peg.637   Staphylococcus lugdunensis N920143        NVYTIYKNPRYKIIQKDNRYLMIDLEQNWYSYLCPMLNWFIPIKYTELS−−YKEFNNLNI−−FNNQ−−−−−−NQSNQGLIAAGIGVTISVLLRSFIGLMNINISQIWMFVLFLIGFVGVIALRLSIRKKLNHPAFN−−−−−−KNSTQKVMLIPSFKNMVLVVFCY−−−−−−LISIYLIVGLF−−YMMVIEN−−−−IQNIWIYICWLGIFFVFSFMNMASISDRKVHAKIKN 
fig|698737.3.peg.638   Staphylococcus lugdunensis HKU09-01        NVYTIYKNPRYKIIQKDNRYLMIDLEQNWYSYLCPMLNWFIPIKYTELS−−YKEFNNLNI−−FNNQ−−−−−−NQSNQGLIAAGIGVTISVLLRSFIGLMNINISQIWMFVLFLIGFVGVIALRLSIRKKLNHPAFN−−−−−−KNSTQKVMLIPSFKNMVLVVFCY−−−−−−LISIYLIVGLF−−YMMVIEN−−−−IQNIWIYICWLGIFFVFSFMNMASISDRKVHAKIKN 
fig|525378.3.peg.1857   Staphylococcus epidermidis M23864:W1         VYTIYKNPRYKIIQKDNQYLMVDLEQNWCSYLFPMLNWFIPIKYTKLT−−YQEFNNLDI−−FSNG−−−−−−SGASQGMITGGIGVIISVLLRSIVGLMDINVSRIWTLIMFLIGFVAVVGLRLALRKKLKHQSFN−−−−−−KNSKQKVRLIPSFKNFALMVFCY−−−−−−VIAIYLVVGLF−−YIMVINN−−−−VQNIMIYICWLGIFLAFLFMNIASISDRKVHAKIMN 
fig|450394.6.peg.1156   Staphylococcus aureus subsp. aureus USA300_TCH959     MLCESRIIDKNAKYRIIKYNDEYFMIDLSSNCISYLLPMINWFIPKKGVKLS−−VKEVEKLDT−−IKPQ−−−−−−KNSALNWYIGFSVLLTVIFRKYISLLDLQIERYINISISLLIILFIILFRLYINKKLTIKNFHQN−−−−−−EYRTLMLIPTWKSFIFTSFAF−−−−−−VFIGLISIFTI−−IVTFYYE−−−−NQNIIVFLTEVAMILIFSFLNVLSISDSKVHVIIKEN
fig|698737.3.peg.542   Staphylococcus lugdunensis HKU09-01     MLCESKIINMNPKYRIIKYNDDYLMVDTISHWITFLFPMINWFVPKRYAKLS−−EEEYNNLDI−−VKPV−−−−−−KNSGASIGVGIIIILNVLFRKYIDVFNVQVQESVAILSCVIGFLGIFIFFLYINKKVTLDIYKRN−−−−−KTKSKIILIPTLKNFGFTLFSY−−−−−−LLFGGISWVTM−−EMLTIDH−−−−LYNIFMFIVWIGIIAAFFFVNMFAIIDKKVHIILKNK
fig|1034809.4.peg.546   Staphylococcus lugdunensis N920143     MLCESKIIRMNPKYRIIKYNNDYFMVDTICHWITFLFPMINWFVSKRYAKLS−−EEEYNNLDI−−VKPV−−−−−−KNSGASIGAGLAILISALLRNYVNIFNIQIQESVAVLSCVIGFLGVFIFFLHINKKVTLDIYKRN−−−−−KTHSKTILIPTLKSIGFTLTSY−−−−−−VLCGGCALIIM−−EMLTIDH−−−−LYNVFIFILWVIWIAFFFFINMFAIMDKKVHVILKNK
fig|698737.3.peg.543   Staphylococcus lugdunensis HKU09-01     MLCESKIIRMNPKYRIIKYNNDYFMVDTICHWITFLFPMINWFVSKRYAKLS−−EEEYNNLDI−−VKPV−−−−−−KNSGASIGAGLAILISALLRNYVNIFNIQIQESVAVLSCVIGFLGVFIFFLHINKKVTLDIYKRN−−−−−KTHSKTILIPTLKSIGFTLTSY−−−−−−VLCGGCALIIM−−EMLTIDH−−−−LYNVFIFILWVIWIAFFFFINMFAIMDKKVHVILKNK
fig|698737.3.peg.545   Staphylococcus lugdunensis HKU09-01      LCESKIINKNPKYRIIKYKDDYLMVDIVSHWFTFLFPMINWFIPKRYAKLS−−EEEYNNLNI−−VKPV−−−−−−KNSGASIGVGLAILISVLLRKYVFIFDVQVQQSIAVISCIIGFLCVFIFFLYINKKVTLDIYKIN−−−−−KTHSKIILIPTLKNIGFTLFSY−−−−−−IFLGGFVWMIL−−YGLTVEN−−−−LYNIFIFIIWIGSIALFFFFNMFAIMDKKVHIILKNK
fig|585152.3.peg.520   Staphylococcus aureus subsp. aureus D139     MLCESWNINKNPRYKIIKYKNEFLMIDVTSSWIFFFIPMLNWGVPKKFAKIS−−QSKFEELNT−−FTPK−−−−−−NSRSAGWIAGGGSVLLAVLTRKYIQLLNIQVNQIAVNILCCLVLLGVFLSALYINSKSKLNVYDRN−−−−−NCDEKIILIPTFKNLCLMLLSY−−−−−−ILFGGLSILAF−−YMFITEG−−−−IQNIILFITWIMLVIMFLLSNVALVVNKKVNVIKR  
fig|585155.3.peg.1148   Staphylococcus aureus subsp. aureus H19     MLCESWNINKNPRYKIIKYKNEFLMIDVTSSWIFFFIPMLNWGVPKKFAKIS−−QSKFEELNT−−FTPK−−−−−−NSRSAGWIAGGGSVLLAVLTRKYIQLLNIQVNQIAVNILCCLVLLGVFLSALYINSKSKLNVYDRN−−−−−NCDEKIILIPTLKFMLNAPFVY−−−−−−SF                                                            
fig|450394.6.peg.1161   Staphylococcus aureus subsp. aureus USA300_TCH959     MLCESWNINKNPRYKIIKYKNEFLMVDVTSSWIFFFIPMLNWGVPKKFAKIS−−QSEFEELNT−−FTPK−−−−−−NSSSAGWIAGGGSVLLAVLTRKYIQLLNIQVNQIAVNILCCLVLLGVFLSALYINSKSKLNVYNRN−−−−−NCDEKIILIPTFKNLCLMLLSY−−−−−−IIFGGLSILAF−−YMFITEG−−−−IQNIILFITWIMLVIMFLLSNVALVVNKKVYVIKR  
fig|1213730.3.peg.2536   Staphylococcus aureus M0877     LICESKNINKNPRYKIIKYKNEFLMVDVTSSWIFFFIPMLNWGVPKKYAKIS−−QSEFEELNT−−FTPK−−−−−−NSSSAGWIAGGGSVLLAVLTRKYIQLLNIQVNQIAVNILCCLVLLGVFLSALYINSKSKLNVYDRN−−−−−NCDEKIILIPTFKNLYLMLLSY−−−−−−IIFGGLSILAF−−YMFITEG−−−−IQNIILFITWIMLVIMFLLSNVALVVNKKVYVIKR  
fig|1157010.3.peg.506   Staphylococcus aureus M0102     MLCESKVINKNPKYRIIKYESEYLMIDLASNWIVFFFPFINWLIPKTYVKIT−−KNDYEKLNI−−VKPV−−−−−−KNKSIGWTIFAGIVLLGGTVRRNTYLFDFQLEKLIVWSSCFIGFLGVIFFYCYLNKKLTLNVYKEN−−−−KNNELKLRLLPSFKNMCFTIFYY−−−−−−LFTGFMSYGAF−−YLLVFEN−−−−VQNLILYISWLFMTMLFMLMNMHSIIDKKVHIFLKSN
fig|548474.3.peg.1629   Staphylococcus aureus subsp. aureus TCH130     MLCESKVINKNPKYRIIKYESEYLMIDLASNWIVFFFPFINWLIPKTYVKIT−−KNDYEKLNI−−VKPV−−−−−−KNKSIGWTIFAGIVLLGGTVRRNTYLFDFQLEKLIVWSSCFIGFLGVIFFYCYLNKKLTLNVYKEN−−−−KNNELKLRLLPSFKNMCFTIFYY−−−−−−LFTGFMSYGAF−−YLLVFEN−−−−VQNLILYISWLFMTMLFMLMNMHSIIDKKVHIFLKSN
fig|553565.3.peg.1858   Staphylococcus aureus A5937     MLCESKVINKNPKYRIIKYESEYLMIDLASNWIVFFFPFINWLIPKTYVKIT−−KNDYEKLNI−−VKPV−−−−−−KNKSIGWTIFAGIVLLGGTVRRNTYLFDFQLEKLIVWSSCFIGFLGVIFFYCYLNKKLTLNVYKEN−−−−KNNELKLRLLPSFKNMCFTIFYY−−−−−−LFTGFMSYGAF−−YLLVFEN−−−−VQNLILYISWLFMTMLFMLMNMHSIIDKKVHIFLKSN
fig|505321.3.peg.2149   Staphylococcus aureus subsp. aureus str. CF-Marseille     MLCESKVINKNPKYRIIKYESEYLMIDLASNWIVFFFPFINWLIPKTYVKIT−−KNDYEKLNI−−VKPV−−−−−−KNKSIGWTIFAGIVLLGGTVRRNTYLFDFQLEKLIVWSSCFIGFLGVIFFYCYLNKKLTLNVYKEN−−−−KNNELKLRLLPSFKICVSQFFITSLLVSCLMGHFTCWCL−−KM                                              
fig|1158529.3.peg.746   Staphylococcus aureus M0396     LLCESKVINKNPKYRIIKYDSEYLMIDLASNWIVFFFPFINWLIPKTYVKIT−−KNDYEKLNI−−VKPV−−−−−−KNKSIGWTIFAGIVLLGGTVRRNTYLFDFQLEELIVWSSCFIGFLEIIFFYCYLNKKLTLNIYNES−−−−KNNELKLRLLPSFKNICFTIFYY−−−−−−LFTGFMSYGAF−−YLLVFEN−−−−VQNLILYVSWLFMTMLFMFMNMHSIIDKKVHIFLKSN
fig|196620.1.peg.557   Staphylococcus aureus subsp. aureus MW2     LLCESKVINKNPKYRIIKYDSEYLMIDLASNWIVFFFPFINWLIPKTYVKIT−−KNDYEKLNI−−VKPV−−−−−−KNKSIGWTIFAGIVLLGGTVRRNTYLFDFQLEELIVWSSCFIGFLEIIFFYCYLNKKLTLNIYNES−−−−KNNELKLRLLPSFKNICFTIFYY−−−−−−LFTGFMSYGAF−−YLLVFEN−−−−VQNLILYVSWLFMTMLFMFMNMHSIIDKKVHIFLKSN
fig|426430.6.peg.561   Staphylococcus aureus subsp. aureus str. Newman     LLCESKVINKNPKYRIIKYDSEYLMIDLASNWIVFFFPFINWLIPKTYVKIT−−KNDYEKLNI−−VKPV−−−−−−KNKSIGWTIFAGIVLLGGTVRRNTYLFDFQLEELIVWSSCFIGFLEIIFFYCYLNKKLTLNIYNES−−−−KNNELKLRLLPSFKNICFTIFYY−−−−−−LFTGFMSYGAF−−YLLVFEN−−−−VQNLILYVSWLFMTMLFMFMNMHSIIDKKVHIFLKSN
fig|93061.3.peg.573   Staphylococcus aureus subsp. aureus NCTC 8325     LLCESKVINKNPKYRIIKYDSEYLMIDLASNWIVFFFPFINWLIPKTYVKIT−−KNDYEKLNI−−VKPV−−−−−−KNKSIGWTIFAGIVLLGGTVRRNTYLFDFQLEELIVWSSCFIGFLEIIFFYCYLNKKLTLNIYNES−−−−KNNELKLRLLPSFKNICFTIFYY−−−−−−LFTGFMSYGAF−−YLLVFEN−−−−VQNLILYVSWLFMTMLFMFMNMHSIIDKKVHIFLKSN
fig|93062.4.peg.142   Staphylococcus aureus subsp. aureus COL     LLCESKVINKNPKYRIIKYDSEYLMIDLASNWIVFFFPFINWLIPKTYVKIT−−KNDYEKLNI−−VKPV−−−−−−KNKSIGWTIFAGIVLLGGTVRRNTYLFDFQLEELIVWSSCFIGFLEIIFFYCYLNKKLTLNIYNES−−−−KNNELKLRLLPSFKNICFTIFYY−−−−−−LFTGFMSYGAF−−YLLVFEN−−−−VQNLILYVSWLFMTMLFMFMNMHSIIDKKVHIFLKSN
fig|282459.5.peg.586   Staphylococcus aureus subsp. aureus MSSA476     MLCESKVINKNPKYRIIKYDSEYLMIDLASNWIVFFFPFINWLIPKTYVKIT−−KNDYEKLNI−−VKPV−−−−−−KNKSIGWTIFAGIVLLGGTVRRNTYLFDFQLEELIVWSSCFIGFLEIIFFYCYLNKKLTLNIYNES−−−−KNNELKLRLLPSFKNICFTIFYY−−−−−−LFTGFMSYGAF−−YLLVFEN−−−−VQNLILYVSWLFMTMLFMFMNMHSIIDKKVHIFLKSN
fig|451515.3.peg.653   Staphylococcus aureus subsp. aureus USA300_FPR3757     MLCESKVINKNPKYRIIKYDSEYLMIDLASNWIVFFFPFINWLIPKTYVKIT−−KNDYEKLNI−−VKPV−−−−−−KNKSIGWTIFAGIVLLGGTVRRNTYLFDFQLEELIVWSSCFIGFLEIIFFYCYLNKKLTLNIYNES−−−−KNNELKLRLLPSFKNICFTIFYY−−−−−−LFTGFMSYGAF−−YLLVFEN−−−−VQNLILYVSWLFMTMLFMFMNMHSIIDKKVHIFLKSN
fig|546342.3.peg.2263   Staphylococcus aureus subsp. aureus str. JKD6008     MLCESKVINKNPKYRIIKYDSEYLMIDLASNWIVFFFPFINWLIPKTYVKIT−−KNDYEKLNI−−VKPV−−−−−−KNKSIGWTIFAGIVLLGGTVRRNTYLFDFQLEELIVWSSCFIGFLEIIFFYCYLNKKLTLNIYNES−−−−KNNELKLRLLPSFKNICFTIFYY−−−−−−LFTGFMSYGAF−−YLLVFEN−−−−VQNLILYVSWLFMTMLFMFMNMHSIIDKKVHIFLKSN
fig|553567.3.peg.436   Staphylococcus aureus A5948     MLCESKVINKNPKYRIIKYDSEYLMIDLASNWIVFFFPFINWLIPKTYVKIT−−KNDYEKLNI−−VKPV−−−−−−KNKSIGWTIFAGIVLLGGTVRRNTYLFDFQLEELIVWSSCFIGFLEIIFFYCYLNKKLTLNIYNES−−−−KNNELKLRLLPSFKNICFTIFYY−−−−−−LFTGFMSYGAF−−YLLVFEN−−−−VQNLILYVSWLFMTMLFMFMNMHSIIDKKVHIFLKSN
fig|904785.3.peg.2230   Staphylococcus aureus subsp. aureus IS-157     MLCESKVINKNPKYRIIKYDSEYLMIDLASNWIVFFFPFINWLIPKTYVKIT−−KNDYEKLNI−−VKPV−−−−−−KNKSIGWTIFAGIVLLGGTVRRNTYLFDFQLEELIVWSSCFIGFLEIIFFYCYLNKKLTLNIYNES−−−−KNNELKLRLLPSFKNICFTIFYY−−−−−−LFTGFMSYGAF−−YLLVFEN−−−−VQNLILYVSWLFMTMLFMFMNMHSIIDKKVHIFLKSN
fig|585152.3.peg.524   Staphylococcus aureus subsp. aureus D139                                         ILFPFINWFIPKTYVKIT−−KNDYEKLNI−−VKPV−−−−−−KNKSIGWTIFAGIVLLGGTVRRNTYLFDFQLEELIVWSSCFIGFLGIIFFYCHLNKKLTLNIYNES−−−−KNNELKLRLLPSFKNICFTIFYY−−−−−−LFTGFMSYGAF−−YLLVFEN−−−−VQNLILYISWIFMTMLFMFMNMHSIIDKKVHIFLKSN
fig|585155.3.peg.1151   Staphylococcus aureus subsp. aureus H19     MLCETEIINKNPKYRVIKYDDEYLMIDVISTWLVYFFPFINWFIPKTYVKIT−−KNDYEKLNI−−VKPV−−−−−−KNKSIGWTIFAGIVLLGGTVRRNTYLFDFQLEELIVWSSCFIGFLGIIFFYCHLNKKLTLNIYNES−−−−KNNELKLRLLPSFKNICFTIFYY−−−−−−LFTGFMSYGAF−−YLLVFEN−−−−VQNLILYISWIFMTMLFMFMNMHSIIDKKVHIFLKSN
fig|273036.3.peg.583   Staphylococcus aureus RF122                                          LFPMINWLIPKKYVKIS−−EKDFETLNI−−VKPT−−−−−−KINTFWPVAGSTVLFGVMLRRYSHLFIVKYEYSIVILICCIIILGIFLFFLYLNQKLKLQIYNEN−−−−KNKSNKIIIFPTLKSLCLSIVLY−−−−−−IYLGGGSLFTI−−YMLLTIE−−−−VQNIILFITLFVIFLFFLFLNMCSLYDNKVHVLFKSN
fig|273036.6.peg.596   Staphylococcus aureus RF122                                          LFPMINWLIPKKYVKIS−−EKDFETLNI−−VKPT−−−−−−KINTFWPVAGSTVLFGVMLRRYSHLFIVKYEYSIVILICCIIILGIFLFFLYLNQKLKLQIYNEN−−−−KNKSNKIIIFPTLKSLCLSIVLY−−−−−−IYLGGGSLFTI−−YMLLTIE−−−−VQNIILFITLFVIFLFFLFLNMCSLYDNKVHVLFKSN
fig|585152.3.peg.528   Staphylococcus aureus subsp. aureus D139     LLCETENINKNPKYRIIKYKDEYLMIDLVSTWLALFFPMINWLIPKKYVKIS−−EKDFETLNI−−VKPS−−−−−−KVNSFWPVAGSTVLFGVMLRRYSHLFIVKYEYSIVILICCIIILGIFLFFLYLNQKLKLQIYNEN−−−−KNKSNKIIIFPTLKSLCLSIVLY−−−−−−IYLGGGSLFTI−−YMLLTIE−−−−VQNIILFITLFVIFLFFLFLNMCSLYDNKVHVLFKSN
fig|585155.3.peg.1155   Staphylococcus aureus subsp. aureus H19     LLCETENINKNPKYRIIKYKDEYLMIDLVSTWLALFFPMINWLIPKKYVKIS−−EKDFETLNI−−VKPS−−−−−−KVNSFWPVAGSTVLFGVMLRRYSHLFIVKYEYSIVILICCIIILGIFLFFLYLNQKLKLQIYNEN−−−−KNKSNKIIIFPTLKSLCLSIVLY−−−−−−IYLGGGSLFTI−−YMLLTIE−−−−VQNIILFITLFVIFLFFLFLNMCSLYDNKVHVLFKSN
fig|196620.1.peg.2674   Staphylococcus aureus subsp. aureus MW2     LLCETENINKNPKYRIIKYKDEYLMIDLVSTWLALFFPMINWLIPKKYVKIS−−EKDFETLNI−−VKTA−−−−−−KINSFWPVAGSTVLFGVMLRRYSHLFIVKYEYSIVILICCIIILGIFLFFLYLNQKLKLQIYNEN−−−−KNKSNKIIIFPTLKSLCLSIVLY−−−−−−IYLGGGSFFTI−−YMLLTIE−−−−VQNIILFITLFVIFLFFLFLNMCSLYDNKVHVLFKSN
fig|93062.4.peg.145   Staphylococcus aureus subsp. aureus COL     LLCETENINKNPKYRIIKYKDEYLMIDLVSTWLALFFPMINWLIPKKYVKIS−−EKDFETLNI−−VKTA−−−−−−KINSFWPVAGSTVLFGVMLRRYSHLFIVKYEYSIVILICCIIILGIFLFFLYLNQKLKLQIYNEN−−−−KNKSNKIIIFPTLKSLCLSIVLY−−−−−−IYLGGGSFFTI−−YMLLTIE−−−−VQNIILFITLFVIFLFFLFLNMCSLYDNKVHVLFKSN
fig|93061.3.peg.577   Staphylococcus aureus subsp. aureus NCTC 8325                             MIDLVSTWLALFFPMINWLIPKKYVKIS−−EKDFETLNI−−VKTA−−−−−−KINSFWPVAGSTVLFGVMLRRYSHLFIVKYEYSIVILICCIIILGIFLFFLYLNQKLKLQIYNEN−−−−KNKSNKIIIFPTLKSLCLSIVLY−−−−−−IYLGGGSFFTI−−YMLLTIE−−−−VQNIILFITLFVIFLFFLFLNMCSLYDNKVHVLFKSN
fig|546342.3.peg.524   Staphylococcus aureus subsp. aureus str. JKD6008     MLCETENINKNPKYRIIKYKDEYLMIDLVSTWLALFFPMINWLIPKKYVKIS−−EKDFETLNI−−VKTA−−−−−−KINSFWPVAGSTVLFGVMLRRYSHLFIVKYEYSIVILICCIIILGIFLFFLYLNQKLKLQIYNEN−−−−KNKSNKIIIFPTLKSLCLSIVLY−−−−−−IYLGGGSFFTI−−YMLLTIE−−−−VQNIILFITLFVIFLFFLFLNMCSLYDNKVHVLFK  
fig|282459.5.peg.589   Staphylococcus aureus subsp. aureus MSSA476     MLCETENINKNPKYRIIKYKDEYLMIDLVSTWLALFFPMINWLIPKKYVKIS−−EKDFETLNI−−VKTA−−−−−−KINSFWPVAGSTVLFGVMLRRYSHLFIVKYEYSIVILICCIIILGIFLFFLYLNQKLKLQIYNEN−−−−KNKSNKIIIFPTLKSLCLSIVLY−−−−−−IYLGGGSFFTI−−YMLLTIE−−−−VQNIILFITLFVIFLFFLFLNMCSLYDNKVHVLFKSN
fig|451515.3.peg.657   Staphylococcus aureus subsp. aureus USA300_FPR3757     MLCETENINKNPKYRIIKYKDEYLMIDLVSTWLALFFPMINWLIPKKYVKIS−−EKDFETLNI−−VKTA−−−−−−KINSFWPVAGSTVLFGVMLRRYSHLFIVKYEYSIVILICCIIILGIFLFFLYLNQKLKLQIYNEN−−−−KNKSNKIIIFPTLKSLCLSIVLY−−−−−−IYLGGGSFFTI−−YMLLTIE−−−−VQNIILFITLFVIFLFFLFLNMCSLYDNKVHVLFKSN
fig|553567.3.peg.432   Staphylococcus aureus A5948     MLCETENINKNPKYRIIKYKDEYLMIDLVSTWLALFFPMINWLIPKKYVKIS−−EKDFETLNI−−VKTA−−−−−−KINSFWPVAGSTVLFGVMLRRYSHLFIVKYEYSIVILICCIIILGIFLFFLYLNQKLKLQIYNEN−−−−KNKSNKIIIFPTLKSLCLSIVLY−−−−−−IYLGGGSFFTI−−YMLLTIE−−−−VQNIILFITLFVIFLFFLFLNMCSLYDNKVHVLFKSN
fig|585152.3.peg.522   Staphylococcus aureus subsp. aureus D139     LLCEVRVVNKNPRYRIIKYKNDYLMVDLVSTWLVLFFPFINWLIPKRYVQIS−−REEFDNLNI−−VKPV−−−−−−KNKALWPVIGSILLFGTMFRDKIYIPDSHLEKNCVIVICSVLLLNILVFYIYLNQKVKLSIYNN−−−−RSSNGKIMIFPSFKNLCFVLFSY−−−−−−FFCGGLSIMFL−−DVLISLS−−−−IQNIIVFIAWVIMTMLFFFLNMSSIIDKKIHVIY   
fig|585155.3.peg.1150   Staphylococcus aureus subsp. aureus H19     LLCEVRVVNKNPRYRIIKYKNDYLMVDLVSTWLVLFFPFINWLIPKRYVQIS−−REEFDNLNI−−VKPV−−−−−−KNKALWPVIGSILLFGTMFRDKIYIPDSHLEKNCVIVICSVLLLNILVFYIYLNQKVKLSIYNN−−−−RSSNGKIMIFPSFKNLCFVLFSY−−−−−−FFCGGLSIMFL−−DVLISLS−−−−IQNIIVFIAWVIMTMLFFFLNMSSIIDKKIHVIY   
fig|426430.6.peg.557   Staphylococcus aureus subsp. aureus str. Newman     LLCEVRVVNKNPRYRIIKYKNDYLMIDLVSTWLVLFFPFINWLIPKKYVQIS−−REDFDNLNI−−VKPV−−−−−−KNKALWPAIGSILLFGTMFRDKIYIPDSHLEKNCVIIICSVLLLSILVFYIYLNQKVKLSIYND−−−−RSSNGKIMIFPSFKNLCFVLFSY−−−−−−FFCGGLSIMFL−−DVLISLS−−−−IQNIIVFIAWVIMTMLFFFINMSSIIDKKIHVIY   
fig|451515.3.peg.648   Staphylococcus aureus subsp. aureus USA300_FPR3757     LLCEVRVVNKNPRYRIIKYKNDYLMIDLVSTWLVLFFPFINWLIPKKYVQIS−−REDFDNLNI−−VKPV−−−−−−KNKALWPAIGSILLFGTMFRDKIYIPDSHLEKNCVIIICSVLLLSILVFYIYLNQKVKLSIYND−−−−RSSNGKIMIFPSFKNLCFVLFSY−−−−−−FFCGGLSIMFL−−DVLISLS−−−−IQNIIVFIAWVIMTMLFFFINMSSIIDKKIHVIY   
fig|452948.4.peg.977   Staphylococcus aureus 930918-3     LLCEVRVVNKNPRYRIIKYKNDYLMIDLVSTWLVLFFPFINWLIPKKYVQIS−−REDFDNLNI−−VKPV−−−−−−KNKALWPAIGSILLFGTMFRDKIYIPDSHLEKNCVIIICSVLLLSILVFYIYLNQKVKLSIYND−−−−RSSNGKIMIFPSFKNLCFVLFSY−−−−−−FFCGGLSIMFL−−DVLISLS−−−−IQNIIVFIAWVIMTMLFFFINMSSIIDKKIHVIY   
fig|546342.3.peg.2258   Staphylococcus aureus subsp. aureus str. JKD6008     LLCEVRVVNKNPRYRIIKYKNDYLMIDLVSTWLVLFFPFINWLIPKKYVQIS−−REDFDNLNI−−VKPV−−−−−−KNKALWPAIGSILLFGTMFRDKIYIPDSHLEKNCVIIICSVLLLSILVFYIYLNQKVKLSIYND−−−−RSSNGKIMIFPSFKNLCFVLFSY−−−−−−FFCGGLSIMFL−−DVLISLS−−−−IQNIIVFIAWVIMTMLFFFINMSSIIDKKIHVIY   
fig|553567.3.peg.441   Staphylococcus aureus A5948     LLCEVRVVNKNPRYRIIKYKNDYLMIDLVSTWLVLFFPFINWLIPKKYVQIS−−REDFDNLNI−−VKPV−−−−−−KNKALWPAIGSILLFGTMFRDKIYIPDSHLEKNCVIIICSVLLLSILVFYIYLNQKVKLSIYND−−−−RSSNGKIMIFPSFKNLCFVLFSY−−−−−−FFCGGLSIMFL−−DVLISLS−−−−IQNIIVFIAWVIMTMLFFFINMSSIIDKKIHVIY   
fig|904785.3.peg.1441   Staphylococcus aureus subsp. aureus IS-157     LLCEVRVVNKNPRYRIIKYKNDYLMIDLVSTWLVLFFPFINWLIPKKYVQIS−−REDFDNLNI−−VKPV−−−−−−KNKALWPAIGSILLFGTMFRDKIYIPDSHLEKNCVIIICSVLLLSILVFYIYLNQKVKLSIYND−−−−RSSNGKIMIFPSFKNLCFVLFSY−−−−−−FFCGGLSIMFL−−DVLISLS−−−−IQNIIVFIAWVIMTMLFFFINMSSIIDKKIHVIY   
fig|93061.3.peg.568   Staphylococcus aureus subsp. aureus NCTC 8325     LLCEVRVVNKNPRYRIIKYKNDYLMIDLVSTWLVLFFPFINWLIPKKYVQIS−−REDFDNLNI−−VKPV−−−−−−KNKALWPAIGSILLFGTMFRDKIYIPDSHLEKNCVIIICSVLLLSILVFYIYLNQKVKLSIYND−−−−RSSNGKIMIFPSFKNLCFVLFSY−−−−−−FFCGGLSIMFL−−DVLISLS−−−−IQNIIVFIAWVIMTMLFFFINMSSIIDKKIHVIY   
fig|93062.4.peg.138   Staphylococcus aureus subsp. aureus COL     LLCEVRVVNKNPRYRIIKYKNDYLMIDLVSTWLVLFFPFINWLIPKKYVQIS−−REDFDNLNI−−VKPV−−−−−−KNKALWPAIGSILLFGTMFRDKIYIPDSHLEKNCVIIICSVLLLSILVFYIYLNQKVKLSIYND−−−−RSSNGKIMIFPSFKNLCFVLFSY−−−−−−FFCGGLSIMFL−−DVLISLS−−−−IQNIIVFIAWVIMTMLFFFINMSSIIDKKIHVIY   
fig|196620.1.peg.553   Staphylococcus aureus subsp. aureus MW2     MLYESNIINKNPRYRIIKYKNDYLMIDLVSTWLVLFFPFINWLIPKKYVQIS−−REEFDNLNI−−VKPV−−−−−−KNKALWPVIGSILLFGTMFRDKIYIPDSHLEKNCVIIICSVLLLSILVFYIYLNQKVKLSIYNN−−−−RSSNGKIMIFPSFKNLCFVLFSY−−−−−−FFCGGLSIMFL−−DVLISLS−−−−IQNIIVFIAWVIMTMLFFFINMSSIIDKKIHVIY   
fig|282459.5.peg.580   Staphylococcus aureus subsp. aureus MSSA476     MLYESNIINKNPRYRIIKYKNDYLMIDLVSTWLVLFFPFINWLIPKKYVQIS−−REEFDNLNI−−VKPV−−−−−−KNKALWPVIGSILLFGTMFRDKIYIPDSHLEKNCVIIICSVLLLSILVFYIYLNQKVKLSIYNN−−−−RSSNGKIMIFPSFKNLCFVLFSY−−−−−−FFCGGLSIMFL−−DVLISLS−−−−IQNIIVFIAWVIMTMLFFFINMSSIIDKKIHVIY   
fig|450394.6.peg.1155   Staphylococcus aureus subsp. aureus USA300_TCH959     MLYESNIINKNPRYRIIKYKNDYLMIDLVSTWLVLFFPFINWLIPKKYVQIS−−REDFDNLNI−−VKPV−−−−−−KNKALWPAIGSILLFGTMFRDKIYIPDSHLEKNCVIIICSVLLLSILVFYIYLNQKVKLSIYNN−−−−RSSNGKIMIFPSFKNLCFVLFSY−−−−−−FFCGGLSIMFL−−DVLISLS−−−−IQNIIVFIAWVIMTMLFFFINMSSIIDKKIHVIY   
fig|426430.6.peg.556   Staphylococcus aureus subsp. aureus str. Newman     MLFNIKVINKNPRYKVVQYNDEYLLIDLVSTWLVYFFPFINWFIPKRYAKLS−−EKELENLNV−−DKQN−−−−−−KNNIFWPVTGSSFLFVVILRKYVHTFEVQLDNKILISLCFIGFIGIAAFYIYLNKKLKLKIYDDN−−−−LDNENRVILVPTFKDGSFIVFTY−−−−−−LLLGGCSILFL−−IWLMTIK−−−−PQNLLVFIMWIIITIFFFLISMGSISNKKVYAKLKKQ
fig|451515.3.peg.647   Staphylococcus aureus subsp. aureus USA300_FPR3757     MLFNIKVINKNPRYKVVQYNDEYLLIDLVSTWLVYFFPFINWFIPKRYAKLS−−EKELENLNV−−DKQN−−−−−−KNNIFWPVTGSSFLFVVILRKYVHTFEVQLDNKILISLCFIGFIGIAAFYIYLNKKLKLKIYDDN−−−−LDNENRVILVPTFKDGSFIVFTY−−−−−−LLLGGCSILFL−−IWLMTIK−−−−PQNLLVFIMWIIITIFFFLISMGSISNKKVYAKLKKQ
fig|452948.4.peg.978   Staphylococcus aureus 930918-3     MLFNIKVINKNPRYKVVQYNDEYLLIDLVSTWLVYFFPFINWFIPKRYAKLS−−EKELENLNV−−DKQN−−−−−−KNNIFWPVTGSSFLFVVILRKYVHTFEVQLDNKILISLCFIGFIGIAAFYIYLNKKLKLKIYDDN−−−−LDNENRVILVPTFKDGSFIVFTY−−−−−−LLLGGCSILFL−−IWLMTIK−−−−PQNLLVFIMWIIITIFFFLISMGSISNKKVYAKLKKQ
fig|546342.3.peg.2257   Staphylococcus aureus subsp. aureus str. JKD6008     MLFNIKVINKNPRYKVVQYNDEYLLIDLVSTWLVYFFPFINWFIPKRYAKLS−−EKELENLNV−−DKQN−−−−−−KNNIFWPVTGSSFLFVVILRKYVHTFEVQLDNKILISLCFIGFIGIAAFYIYLNKKLKLKIYDDN−−−−LDNENRVILVPTFKDGSFIVFTY−−−−−−LLLGGCSILFL−−IWLMTIK−−−−PQNLLVFIMWIIITIFFFLISMGSISNKKVYAKLKKQ
fig|553567.3.peg.442   Staphylococcus aureus A5948     MLFNIKVINKNPRYKVVQYNDEYLLIDLVSTWLVYFFPFINWFIPKRYAKLS−−EKELENLNV−−DKQN−−−−−−KNNIFWPVTGSSFLFVVILRKYVHTFEVQLDNKILISLCFIGFIGIAAFYIYLNKKLKLKIYDDN−−−−LDNENRVILVPTFKDGSFIVFTY−−−−−−LLLGGCSILFL−−IWLMTIK−−−−PQNLLVFIMWIIITIFFFLISMGSISNKKVYAKLKKQ
fig|904785.3.peg.1442   Staphylococcus aureus subsp. aureus IS-157     MLFNIKVINKNPRYKVVQYNDEYLLIDLVSTWLVYFFPFINWFIPKRYAKLS−−EKELENLNV−−DKQN−−−−−−KNNIFWPVTGSSFLFVVILRKYVHTFEVQLDNKILISLCFIGFIGIAAFYIYLNKKLKLKIYDDN−−−−LDNENRVILVPTFKDGSFIVFTY−−−−−−LLLGGCSILFL−−IWLMTIK−−−−PQNLLVFIMWIIITIFFFLISMGSISNKKVYAKLKKQ
fig|93062.4.peg.137   Staphylococcus aureus subsp. aureus COL     MLFNIKVINKNPRYKVVQYNDEYLLIDLVSTWLVYFFPFINWFIPKRYAKLS−−EKELENLNV−−DKQN−−−−−−KNNIFWPVTGSSFLFVVILRKYVHTFEVQLDNKILISLCFIGFIGIAAFYIYLNKKLKLKIYDDN−−−−LDNENRVILVPTFKDGSFIVFTY−−−−−−LLLGGCSILFL−−IWLMTIK−−−−PQNLLVFIMWIIITIFFFLISMGSISNKKVYAKLKKQ
fig|93061.3.peg.567   Staphylococcus aureus subsp. aureus NCTC 8325                             LIDLVSTWLVYFFPFINWFIPKRYAKLS−−EKELENLNV−−DKQN−−−−−−KNNIFWPVTGSSFLFVVILRKYVHTFEVQLDNKILISLCFIGFIGIAAFYIYLNKKLKLKIYDDN−−−−LDNENRVILVPTFKDGSFIVFTY−−−−−−LLLGGCSILFL−−IWLMTIK−−−−PQNLLVFIMWIIITIFFFLISMGSISNKKVYAKLKKQ
fig|450394.6.peg.1154   Staphylococcus aureus subsp. aureus USA300_TCH959     MLFNVKVINKNPRYKVVQYNDEYLLIDLVSTWLVYFFPFINWFIPKRYAKLS−−EKELENLNV−−DKQN−−−−−−KNNIFWPVTGNSFLFVVILRKYVHTFEVQLDNKILISLCFIGFIGIAAFYIYLNKKLKLKIYDDN−−−−LDNENKVILVPTFKDGSFIVFTY−−−−−−LLLGGCSILFL−−IWLMTIK−−−−PQNLLVFIMWIIITIFFFLISMGSISNKKVYAKLKKQ
fig|196620.1.peg.552   Staphylococcus aureus subsp. aureus MW2     MLFNVKVINKNPRYKVVQYNDEYLLIDLVSTWLVYFFPFINWFIPKRYAKLS−−EKELENLNV−−DKQN−−−−−−KNNIFWPVTGSSFLFVVILRKYVHTFEVQLDNKILISLCFIGFIGIAAFYIYLNKKLKLKIYDDN−−−−LDNENKVILVPTFKDGSFIVFTY−−−−−−LLLGGCSILFL−−IWLMTIK−−−−PQNLLVFIMWIIITIFFFLISMGSISNKKVYAKLKKQ
fig|282459.5.peg.579   Staphylococcus aureus subsp. aureus MSSA476     MLFNVKVINKNPRYKVVQYNDEYLLIDLVSTWLVYFFPFINWFIPKRYAKLS−−EKELENLNV−−DKQN−−−−−−KNNIFWPVTGSSFLFVVILRKYVHTFEVQLDNKILISLCFIGFIGIAAFYIYLNKKLKLKIYDDN−−−−LDNENKVILVPTFKDGSFIVFTY−−−−−−LLLGGCSILFL−−IWLMTIK−−−−PQNLLVFIMWIIITIFFFLISMGSISNKKVYAKLKKQ
fig|585152.3.peg.521   Staphylococcus aureus subsp. aureus D139     MLCDIRVINKNPRYKVVQYNGEYLLIDLVSTWLVYFFPFINWFIPKRYAKLS−−EKELENLNV−−DKQN−−−−−−KNNIFWPVTGSSFLFVVIIRKYVHTFEVQLDNKILIVLCFIGFIGIAAFYIYLNKKLKLKIYDDN−−−−LDNENKIILMPTFKDGSFIVFTY−−−−−−LLLGGCSILFL−−IWLMTIK−−−−PQNILVFIMWIIITIFFFLISMGSISNKKVYAKLKKQ
fig|585155.3.peg.1149   Staphylococcus aureus subsp. aureus H19     MLCDIRVINKNPRYKVVQYNGEYLLIDLVSTWLVYFFPFINWFIPKRYAKLS−−EKELENLNV−−DKQN−−−−−−KNNIFWPVTGSSFLFVVIIRKYVHTFEVQLDNKILIVLCFIGFIGIAAFYIYLNKKLKLKIYDDN−−−−LDNENKIILMPTFKDGSFIVFTY−−−−−−LLLGGCSILFL−−IWLMTIK−−−−PQNILVFIMWIIITIFFFLISMGSISNKKVYAKLKKQ
fig|196620.1.peg.559   Staphylococcus aureus subsp. aureus MW2     LLCDVRVIYKNPKYKVIQHNGEYLLVDLVSTWFVYFFPFINWFIPKKYAIIS−−EEEFENLNV−−VKPN−−−−−−KNNVFWSVIGSSVLFGVTLRKYIHVFDVQLDKLVVMILCALALICVIVFYFNLNRKLKLKVFDTN−−−−IEKNKRVILIPTFKLGCFLVFGY−−−−−−IFAGSFSIFSL−−IALMTIE−−−−PQNIIIFIYWIMMTMLFFLLNMTSIGNEKVRVIMKNN
fig|282459.5.peg.588   Staphylococcus aureus subsp. aureus MSSA476     LLCDVRVIYKNPKYKVIQHNGEYLLVDLVSTWFVYFFPFINWFIPKKYAIIS−−EEEFENLNV−−VKPN−−−−−−KNNVFWSVIGSSVLFGVTLRKYIHVFDVQLDKLVVMILCALALICVIVFYFNLNRKLKLKVFDTN−−−−IEKNKRVILIPTFKLGCFLVFGY−−−−−−IFAGSFSIFSL−−IALMTIE−−−−PQNIIIFIYWIMMTMLFFLLNMTSIGNEKVRVIMKNN
fig|426430.6.peg.563   Staphylococcus aureus subsp. aureus str. Newman     LLCDVRVIYKNPKYKVIQHNGEYLLVDLVSTWFVYFFPFINWFIPKKYAIIS−−EEEFENLNV−−VKPN−−−−−−KNNVFWSVIGSSVLFGVTLRKYIHVFDVQLDKLVVMILCALALICVIVFYFNLNRKLKLKVFDTN−−−−IEKNKRVILIPTFKLGCFLVFGY−−−−−−IFAGSFSIFSL−−IALMTIE−−−−PQNIIIFIYWIMMTMLFFLLNMTSIGNEKVRVIMKNN
fig|451515.3.peg.656   Staphylococcus aureus subsp. aureus USA300_FPR3757     LLCDVRVIYKNPKYKVIQHNGEYLLVDLVSTWFVYFFPFINWFIPKKYAIIS−−EEEFENLNV−−VKPN−−−−−−KNNVFWSVIGSSVLFGVTLRKYIHVFDVQLDKLVVMILCALALICVIVFYFNLNRKLKLKVFDTN−−−−IEKNKRVILIPTFKLGCFLVFGY−−−−−−IFAGSFSIFSL−−IALMTIE−−−−PQNIIIFIYWIMMTMLFFLLNMTSIGNEKVRVIMKNN
fig|452948.4.peg.967   Staphylococcus aureus 930918-3     LLCDVRVIYKNPKYKVIQHNGEYLLVDLVSTWFVYFFPFINWFIPKKYAIIS−−EEEFENLNV−−VKPN−−−−−−KNNVFWSVIGSSVLFGVTLRKYIHVFDVQLDKLVVMILCALALICVIVFYFNLNRKLKLKVFDTN−−−−IEKNKRVILIPTFKLGCFLVFGY−−−−−−IFAGSFSIFSL−−IALMTIE−−−−PQNIIIFIYWIMMTMLFFLLNMTSIGNEKVRVIMKNN
fig|546342.3.peg.525   Staphylococcus aureus subsp. aureus str. JKD6008     LLCDVRVIYKNPKYKVIQHNGEYLLVDLVSTWFVYFFPFINWFIPKKYAIIS−−EEEFENLNV−−VKPN−−−−−−KNNVFWSVIGSSVLFGVTLRKYIHVFDVQLDKLVVMILCALALICVIVFYFNLNRKLKLKVFDTN−−−−IEKNKRVILIPTFKLGCFLVFGY−−−−−−IFAGSFSIFSL−−IALMTIE−−−−PQNIIIFIYWIMMTMLFFLLNMTSIGNEKVRVIMKNN
fig|553567.3.peg.433   Staphylococcus aureus A5948     LLCDVRVIYKNPKYKVIQHNGEYLLVDLVSTWFVYFFPFINWFIPKKYAIIS−−EEEFENLNV−−VKPN−−−−−−KNNVFWSVIGSSVLFGVTLRKYIHVFDVQLDKLVVMILCALALICVIVFYFNLNRKLKLKVFDTN−−−−IEKNKRVILIPTFKLGCFLVFGY−−−−−−IFAGSFSIFSL−−IALMTIE−−−−PQNIIIFIYWIMMTMLFFLLNMTSIGNEKVRVIMKNN
fig|904785.3.peg.2233   Staphylococcus aureus subsp. aureus IS-157     LLCDVRVIYKNPKYKVIQHNGEYLLVDLVSTWFVYFFPFINWFIPKKYAIIS−−EEEFENLNV−−VKPN−−−−−−KNNVFWSVIGSSVLFGVTLRKYIHVFDVQLDKLVVMILCALALICVIVFYFNLNRKLKLKVFDTN−−−−IEKNKRVILIPTFKLGCFLVFGY−−−−−−IFAGSFSIFSL−−IALMTIE−−−−PQNIIIFIYWIMMTMLFFLLNMTSIGNEKVRVIMKNN
fig|93061.3.peg.576   Staphylococcus aureus subsp. aureus NCTC 8325     LLCDVRVIYKNPKYKVIQHNGEYLLVDLVSTWFVYFFPFINWFIPKKYAIIS−−EEEFENLNV−−VKPN−−−−−−KNNVFWSVIGSSVLFGVTLRKYIHVFDVQLDKLVVMILCALALICVIVFYFNLNRKLKLKVFDTN−−−−IEKNKRVILIPTFKLGCFLVFGY−−−−−−IFAGSFSIFSL−−IALMTIE−−−−PQNIIIFIYWIMMTMLFFLLNMTSIGNEKVRVIMKNN
fig|93062.4.peg.144   Staphylococcus aureus subsp. aureus COL     LLCDVRVIYKNPKYKVIQHNGEYLLVDLVSTWFVYFFPFINWFIPKKYAIIS−−EEEFENLNV−−VKPN−−−−−−KNNVFWSVIGSSVLFGVTLRKYIHVFDVQLDKLVVMILCALALICVIVFYFNLNRKLKLKVFDTN−−−−IEKNKRVILIPTFKLGCFLVFGY−−−−−−IFAGSFSIFSL−−IALMTIE−−−−PQNIIIFIYWIMMTMLFFLLNMTSIGNEKVRVIMKNN
fig|273036.3.peg.582   Staphylococcus aureus RF122     LLCDVRVIYKNPKYKVIQHNGEYLLVDLVSIWLVYFLPCINWFIPKKYAIIS−−EEEFENLNV−