(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00006217

fig|1137131.3.peg.1523   Staphylococcus aureus subsp. aureus 122051                    MVLSVFIIGC−−−−DKSSDTSEK−−−−PKEDSK−−−−−−−−−−−−−−−−−−−−−−EAQIKKSFEKTLDMYPIKNLEDLYDKEGSRDGEFKKGDKGIWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVNE
fig|585160.3.peg.1953   Staphylococcus aureus subsp. aureus WBG10049                    MVLSVFIIGC−−−−DKSSDTSEK−−−−PKEDSK−−−−−−−−−−−−−−−−−−−−−−EAQIKKSFEKTLDMYPIKNLEDLYDKEGSRDGEFKKGDKGIWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVNE
fig|548473.3.peg.39   Staphylococcus aureus subsp. aureus TCH60       MRYLNRVVLYIIVMVLSVFIIGC−−−−DKSSDTSEK−−−−PKEDSK−−−−−−−−−−−−−−−−−−−−−−EAQIKKSFEKTLDMYPIKNLEDLYDKEGSRDGEFKKGDKGIWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVNE
fig|548473.6.peg.76   Staphylococcus aureus subsp. aureus TCH60       MRYLNRVVLYIIVMVLSVFIIGC−−−−DKSSDTSEK−−−−PKEDSK−−−−−−−−−−−−−−−−−−−−−−EAQIKKSFEKTLDMYPIKNLEDLYDKEGSRDGEFKKGDKGIWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVNE
fig|1163749.3.peg.2475   Staphylococcus aureus subsp. aureus LCT-SA112       MRYLNRVVLYIIVMVLSVFIIGC−−−−DKSSDTSEK−−−−PKEDSK−−−−−−−−−−−−−−−−−−−−−−EAQIKKSFEKTLDMYPIKNLEDLYDKEGSRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVNE
fig|1169255.3.peg.78   Staphylococcus aureus M0946       MRYLNRVVLYIIVMVLSVFIIGC−−−−DKSSDTSEK−−−−PKEDSK−−−−−−−−−−−−−−−−−−−−−−EAQIKKSFEKTLDMYPIKNLEDLYDKEGSRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVNE
fig|282458.1.peg.415   Staphylococcus aureus subsp. aureus MRSA252       MRYLNRVVLYIIVMVLSVFIIGC−−−−DKSSDTSEK−−−−PKEDSK−−−−−−−−−−−−−−−−−−−−−−EAQIKKSFEKTLDMYPIKNLEDLYDKEGSRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVNE
fig|548470.3.peg.2108   Staphylococcus aureus subsp. aureus MN8       MRYLNRVVLYIIVMVLSVFIIGC−−−−DKSSDTSEK−−−−PKEDSK−−−−−−−−−−−−−−−−−−−−−−EAQIKKSFEKTLDMYPIKNLEDLYDKEGSRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVNE
fig|585150.3.peg.531   Staphylococcus aureus subsp. aureus C160       MRYLNRVVLYIIVMVLSVFIIGC−−−−DKSSDTSEK−−−−PKEDSK−−−−−−−−−−−−−−−−−−−−−−EAQIKKSFEKTLDMYPIKNLEDLYDKEGSRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVNE
fig|585151.3.peg.56   Staphylococcus aureus subsp. aureus C427       MRYLNRVVLYIIVMVLSVFIIGC−−−−DKSSDTSEK−−−−PKEDSK−−−−−−−−−−−−−−−−−−−−−−EAQIKKSFEKTLDMYPIKNLEDLYDKEGSRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVNE
fig|904728.3.peg.574   Staphylococcus aureus subsp. aureus 21195       MRYLNRVVLYIIVMVLSVFIIGC−−−−DKSSDTSEK−−−−PKEDSK−−−−−−−−−−−−−−−−−−−−−−EAQIKKSFEKTLDMYPIKNLEDLYDKEGSRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVNE
fig|585147.3.peg.1940   Staphylococcus aureus subsp. aureus A017934/97                    MVLSVFIIGC−−−−DKSSDTSEK−−−−PKEDSK−−−−−−−−−−−−−−−−−−−−−−EAQIKKSFEKTLDMYPIKNLEDLYDKEGSRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVNE
fig|931453.3.peg.2534   Staphylococcus aureus subsp. aureus CIG149                    MVLSVFIIGC−−−−DKSSDTSEK−−−−PKEDSK−−−−−−−−−−−−−−−−−−−−−−EAQIKKSFEKTLDMYPIKNLEDLYDKEGSRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVNE
fig|1158485.3.peg.82   Staphylococcus aureus M1311                           MGC−−−−DRSSDTTEN−−−−QREDSK−−−−−−−−−−−−−−−−−−−−−−EEQIKKSFEKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKNKFPDRKNYNVEMKNNKIILLDKVEDTNLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSELSVVDSLNFQPAKVDE
fig|1213730.3.peg.75   Staphylococcus aureus M0877                           MGC−−−−DRSSDTTEN−−−−QREDSK−−−−−−−−−−−−−−−−−−−−−−EEQIKKSFEKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKNKFPDRKNYNVEMKNNKIILLDKVEDTNLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSELSVVDSLNFQPAKVDE
fig|553583.3.peg.2049   Staphylococcus aureus A9635                           MGC−−−−DRSSDTTEN−−−−QREDSK−−−−−−−−−−−−−−−−−−−−−−EEQIKKSFEKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKNKFPDRKNYNVEMKNNKIILLDKVEDTNLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSELSVVDSLNFQPAKVDE
fig|904730.3.peg.988   Staphylococcus aureus subsp. aureus 21200                           MGC−−−−DRSSDTTEN−−−−QREDSK−−−−−−−−−−−−−−−−−−−−−−EEQIKKSFEKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKNKFPDRKNYNVEMKNNKIILLDKVEDTNLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSELSVVDSLNFQPAKVDE
fig|931454.3.peg.938   Staphylococcus aureus subsp. aureus CIG1524                           MGC−−−−DRSSDTTEN−−−−QREDSK−−−−−−−−−−−−−−−−−−−−−−EEQIKKSFEKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKNKFPDRKNYNVEMKNNKIILLDKVEDTNLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSELSVVDSLNFQPAKVDE
fig|1158687.3.peg.363   Staphylococcus aureus M0565                    MVVSVFIIGC−−−−NKSSDTSEK−−−−PKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVDE
fig|553588.3.peg.1737   Staphylococcus aureus A9719                    MVVSVFIIGC−−−−NKSSDTSEK−−−−PKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVDE
fig|681288.4.peg.395   Staphylococcus aureus subsp. aureus ED98                    MVVSVFIIGC−−−−NKSSDTSEK−−−−PKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVDE
fig|703339.3.peg.425   Staphylococcus aureus 04-02981                    MVVSVFIIGC−−−−NKSSDTSEK−−−−PKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVDE
fig|904750.3.peg.1068   Staphylococcus aureus subsp. aureus 21272                    MVVSVFIIGC−−−−NKSSDTSEK−−−−PKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVDE
fig|1116224.3.peg.426   Staphylococcus aureus subsp. aureus VRS11a       MGYFKRVVLYIIVMVVSVFIIGC−−−−NKSSDTSEK−−−−PKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVDE
fig|1157030.3.peg.354   Staphylococcus aureus M0450       MGYFKRVVLYIIVMVVSVFIIGC−−−−NKSSDTSEK−−−−PKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVDE
fig|1158480.3.peg.1242   Staphylococcus aureus M1253       MGYFKRVVLYIIVMVVSVFIIGC−−−−NKSSDTSEK−−−−PKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVDE
fig|1158486.3.peg.2629   Staphylococcus aureus M1320       MGYFKRVVLYIIVMVVSVFIIGC−−−−NKSSDTSEK−−−−PKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVDE
fig|1158685.3.peg.1197   Staphylococcus aureus M0539       MGYFKRVVLYIIVMVVSVFIIGC−−−−NKSSDTSEK−−−−PKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVDE
fig|1169274.3.peg.366   Staphylococcus aureus M1309       MGYFKRVVLYIIVMVVSVFIIGC−−−−NKSSDTSEK−−−−PKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVDE
fig|1224926.3.peg.2616   Staphylococcus aureus M0279       MGYFKRVVLYIIVMVVSVFIIGC−−−−NKSSDTSEK−−−−PKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVDE
fig|158878.1.peg.443   Staphylococcus aureus subsp. aureus Mu50       MGYFKRVVLYIIVMVVSVFIIGC−−−−NKSSDTSEK−−−−PKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVDE
fig|158878.14.peg.448   Staphylococcus aureus subsp. aureus Mu50       MGYFKRVVLYIIVMVVSVFIIGC−−−−NKSSDTSEK−−−−PKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVDE
fig|359786.3.peg.861   Staphylococcus aureus subsp. aureus JH9       MGYFKRVVLYIIVMVVSVFIIGC−−−−NKSSDTSEK−−−−PKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVDE
fig|450394.6.peg.2223   Staphylococcus aureus subsp. aureus USA300_TCH959       MGYFKRVVLYIIVMVVSVFIIGC−−−−NKSSDTSEK−−−−PKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVDE
fig|505321.3.peg.511   Staphylococcus aureus subsp. aureus str. CF-Marseille       MGYFKRVVLYIIVMVVSVFIIGC−−−−NKSSDTSEK−−−−PKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVDE
fig|548474.3.peg.1829   Staphylococcus aureus subsp. aureus TCH130       MGYFKRVVLYIIVMVVSVFIIGC−−−−NKSSDTSEK−−−−PKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVDE
fig|553565.3.peg.2743   Staphylococcus aureus A5937       MGYFKRVVLYIIVMVVSVFIIGC−−−−NKSSDTSEK−−−−PKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVDE
fig|553571.3.peg.641   Staphylococcus aureus A6300       MGYFKRVVLYIIVMVVSVFIIGC−−−−NKSSDTSEK−−−−PKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVDE
fig|553577.3.peg.1668   Staphylococcus aureus A8796       MGYFKRVVLYIIVMVVSVFIIGC−−−−NKSSDTSEK−−−−PKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVDE
fig|553581.3.peg.1270   Staphylococcus aureus A9299       MGYFKRVVLYIIVMVVSVFIIGC−−−−NKSSDTSEK−−−−PKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVDE
fig|553592.3.peg.1775   Staphylococcus aureus A9763       MGYFKRVVLYIIVMVVSVFIIGC−−−−NKSSDTSEK−−−−PKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVDE
fig|553596.3.peg.2360   Staphylococcus aureus A9781       MGYFKRVVLYIIVMVVSVFIIGC−−−−NKSSDTSEK−−−−PKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVDE
fig|889933.4.peg.376   Staphylococcus aureus subsp. aureus ECT-R 2       MGYFKRVVLYIIVMVVSVFIIGC−−−−NKSSDTSEK−−−−PKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVDE
fig|904731.3.peg.1569   Staphylococcus aureus subsp. aureus 21201       MGYFKRVVLYIIVMVVSVFIIGC−−−−NKSSDTSEK−−−−PKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVDE
fig|585152.3.peg.353   Staphylococcus aureus subsp. aureus D139       MRNLKRDVLYISIMALSIFIIGC−−−−DKSSVTAEK−−−−AKEDSK−−−−−−−−−−−−−−−−−−−−−−EEQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFEKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDTNLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGGKSDLSVIDSLNFQPAKVDE
fig|282459.1.peg.396   Staphylococcus aureus subsp. aureus MSSA476      MMEYIKKIALYMSVLLLIIFIGGC−−−−GNMKDEQKKEEQTNKTDSK−−−−−−−−−−−−−−−−−−−−−−EEQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKADELSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVDE
fig|1231383.3.peg.2011   Staphylococcus aureus KT/314250                                               NKTDSK−−−−−−−−−−−−−−−−−−−−−−EEQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKADELSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVDE
fig|196620.1.peg.401   Staphylococcus aureus subsp. aureus MW2                                               NKTDSK−−−−−−−−−−−−−−−−−−−−−−EEQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKADELSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVDE
fig|282459.5.peg.423   Staphylococcus aureus subsp. aureus MSSA476                                               NKTDSK−−−−−−−−−−−−−−−−−−−−−−EEQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKADELSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVDE
fig|762962.3.peg.1386   Staphylococcus aureus subsp. aureus ATCC 51811                                               NKTDSK−−−−−−−−−−−−−−−−−−−−−−EEQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKADELSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVDE
fig|931441.3.peg.639   Staphylococcus aureus subsp. aureus CIG1835                                               NKTDSK−−−−−−−−−−−−−−−−−−−−−−EEQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKADELSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVDE
fig|931459.3.peg.925   Staphylococcus aureus subsp. aureus CIGC128                                               NKTDSK−−−−−−−−−−−−−−−−−−−−−−EEQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKADELSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVDE
fig|546343.3.peg.965   Staphylococcus aureus subsp. aureus str. JKD6009                                                                                         MYPIKNLEELYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDTNLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGGKSDLSVIDSLNFQPAKVDE
fig|1112349.3.peg.268   Staphylococcus aureus subsp. aureus NN50                                               NKTDSK−−−−−−−−−−−−−−−−−−−−−−EEQIKKSFEKTLDMYPIKNLEELYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDTNLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGGKSDLSVIDSLNFQPAKVDE
fig|553567.3.peg.1958   Staphylococcus aureus A5948                                               NKTDSK−−−−−−−−−−−−−−−−−−−−−−EEQIKKSFEKTLDMYPIKNLEELYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDTNLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGGKSDLSVIDSLNFQPAKVDE
fig|553590.4.peg.2513   Staphylococcus aureus A9754                                               NKTDSK−−−−−−−−−−−−−−−−−−−−−−EEQIKKSFEKTLDMYPIKNLEELYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDTNLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGGKSDLSVIDSLNFQPAKVDE
fig|904778.3.peg.1011   Staphylococcus aureus subsp. aureus IS-88                                               NKTDSK−−−−−−−−−−−−−−−−−−−−−−EEQIKKSFEKTLDMYPIKNLEELYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDTNLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGGKSDLSVIDSLNFQPAKVDE
fig|931433.3.peg.1024   Staphylococcus aureus subsp. aureus CIG1114                                               NKTDSK−−−−−−−−−−−−−−−−−−−−−−EEQIKKSFEKTLDMYPIKNLEELYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDTNLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGGKSDLSVIDSLNFQPAKVDE
fig|931442.3.peg.1107   Staphylococcus aureus subsp. aureus CIG547                                               NKTDSK−−−−−−−−−−−−−−−−−−−−−−EEQIKKSFEKTLDMYPIKNLEELYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDTNLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGGKSDLSVIDSLNFQPAKVDE
fig|1158539.3.peg.379   Staphylococcus aureus M0633      MMGYIKRMALYMSVFLLIIFIVGC−−−−RNMKDEQKKEEQTNKTDSK−−−−−−−−−−−−−−−−−−−−−−EEQIKKSFEKTLDMYPIKNLEELYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDTNLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGGKSDLSVIDSLNFQPAKVDE
fig|367830.3.peg.2455   Staphylococcus aureus subsp. aureus USA300      MMGYIKRMALYMSVFLLIIFIVGC−−−−RNMKDEQKKEEQTNKTDSK−−−−−−−−−−−−−−−−−−−−−−EEQIKKSFEKTLDMYPIKNLEELYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDTNLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGGKSDLSVIDSLNFQPAKVDE
fig|426430.6.peg.409   Staphylococcus aureus subsp. aureus str. Newman      MMGYIKRMALYMSVFLLIIFIVGC−−−−RNMKDEQKKEEQTNKTDSK−−−−−−−−−−−−−−−−−−−−−−EEQIKKSFEKTLDMYPIKNLEELYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDTNLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGGKSDLSVIDSLNFQPAKVDE
fig|452948.4.peg.1088   Staphylococcus aureus 930918-3      MMGYIKRMALYMSVFLLIIFIVGC−−−−RNMKDEQKKEEQTNKTDSK−−−−−−−−−−−−−−−−−−−−−−EEQIKKSFEKTLDMYPIKNLEELYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDTNLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGGKSDLSVIDSLNFQPAKVDE
fig|455227.3.peg.1756   Staphylococcus aureus D30      MMGYIKRMALYMSVFLLIIFIVGC−−−−RNMKDEQKKEEQTNKTDSK−−−−−−−−−−−−−−−−−−−−−−EEQIKKSFEKTLDMYPIKNLEELYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDTNLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGGKSDLSVIDSLNFQPAKVDE
fig|93062.19.peg.473   Staphylococcus aureus subsp. aureus COL      MMGYIKRMALYMSVFLLIIFIVGC−−−−RNMKDEQKKEEQTNKTDSK−−−−−−−−−−−−−−−−−−−−−−EEQIKKSFEKTLDMYPIKNLEELYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDTNLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGGKSDLSVIDSLNFQPAKVDE
fig|93062.4.peg.941   Staphylococcus aureus subsp. aureus COL      MMGYIKRMALYMSVFLLIIFIVGC−−−−RNMKDEQKKEEQTNKTDSK−−−−−−−−−−−−−−−−−−−−−−EEQIKKSFEKTLDMYPIKNLEELYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDTNLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGGKSDLSVIDSLNFQPAKVDE
fig|1028799.3.peg.359   Staphylococcus aureus subsp. aureus VC40     EAMGYLKRFALYISVMILIFAIAGC−−−−GKGNE−−−−−−−−TKEDSK−−−−−−−−−−−−−−−−−−−−−−EEQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDTNLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGGKSDLSVIDSLNFQPAKVDE
fig|93061.3.peg.401   Staphylococcus aureus subsp. aureus NCTC 8325     EAMGYLKRFALYISVMILIFAIAGC−−−−GKGNE−−−−−−−−TKEDSK−−−−−−−−−−−−−−−−−−−−−−EEQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDTNLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGGKSDLSVIDSLNFQPAKVDE
fig|1112349.3.peg.272   Staphylococcus aureus subsp. aureus NN50      MMGYLKRLVLYIVIMVMSVFIIGC−−−−DKSSDTAEK−−−−SKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYSIKNLEELYDKEGYRDGEFEKGDKGMWTIYTDFAKSNKPGELSNEGMVLYLDRNTRTAKGYYFVRTFY−−−−−−−−−−−−RKDKLPDRKNYKVEMKNNKIILLDKVEDKKLKQKIENFKFFSQYANLKELKNYSNGDVSINENVPSYDVKYKMSNKDENVKQLRSRYNIPTDKSPVLKMHIDGNLKGSSVGDRKLEIDFSKRENSHLSVIDSLDYQPAKTN 
fig|1156998.3.peg.2475   Staphylococcus aureus HIF003_B2N-C      MMGYLKRLVLYIVIMVMSVFIIGC−−−−DKSSDTAEK−−−−SKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYSIKNLEELYDKEGYRDGEFEKGDKGMWTIYTDFAKSNKPGELSNEGMVLYLDRNTRTAKGYYFVRTFY−−−−−−−−−−−−RKDKLPDRKNYKVEMKNNKIILLDKVEDKKLKQKIENFKFFSQYANLKELKNYSNGDVSINENVPSYDVKYKMSNKDENVKQLRSRYNIPTDKSPVLKMHIDGNLKGSSVGDRKLEIDFSKRENSHLSVIDSLDYQPAKTN 
fig|1305598.3.peg.422   Staphylococcus aureus M1      MMGYLKRLVLYIVIMVMSVFIIGC−−−−DKSSDTAEK−−−−SKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYSIKNLEELYDKEGYRDGEFEKGDKGMWTIYTDFAKSNKPGELSNEGMVLYLDRNTRTAKGYYFVRTFY−−−−−−−−−−−−RKDKLPDRKNYKVEMKNNKIILLDKVEDKKLKQKIENFKFFSQYANLKELKNYSNGDVSINENVPSYDVKYKMSNKDENVKQLRSRYNIPTDKSPVLKMHIDGNLKGSSVGDRKLEIDFSKRENSHLSVIDSLDYQPAKTN 
fig|367830.3.peg.2451   Staphylococcus aureus subsp. aureus USA300      MMGYLKRLVLYIVIMVMSVFIIGC−−−−DKSSDTAEK−−−−SKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYSIKNLEELYDKEGYRDGEFEKGDKGMWTIYTDFAKSNKPGELSNEGMVLYLDRNTRTAKGYYFVRTFY−−−−−−−−−−−−RKDKLPDRKNYKVEMKNNKIILLDKVEDKKLKQKIENFKFFSQYANLKELKNYSNGDVSINENVPSYDVKYKMSNKDENVKQLRSRYNIPTDKSPVLKMHIDGNLKGSSVGDRKLEIDFSKRENSHLSVIDSLDYQPAKTN 
fig|452948.4.peg.1092   Staphylococcus aureus 930918-3      MMGYLKRLVLYIVIMVMSVFIIGC−−−−DKSSDTAEK−−−−SKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYSIKNLEELYDKEGYRDGEFEKGDKGMWTIYTDFAKSNKPGELSNEGMVLYLDRNTRTAKGYYFVRTFY−−−−−−−−−−−−RKDKLPDRKNYKVEMKNNKIILLDKVEDKKLKQKIENFKFFSQYANLKELKNYSNGDVSINENVPSYDVKYKMSNKDENVKQLRSRYNIPTDKSPVLKMHIDGNLKGSSVGDRKLEIDFSKRENSHLSVIDSLDYQPAKTN 
fig|455227.3.peg.1752   Staphylococcus aureus D30      MMGYLKRLVLYIVIMVMSVFIIGC−−−−DKSSDTAEK−−−−SKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYSIKNLEELYDKEGYRDGEFEKGDKGMWTIYTDFAKSNKPGELSNEGMVLYLDRNTRTAKGYYFVRTFY−−−−−−−−−−−−RKDKLPDRKNYKVEMKNNKIILLDKVEDKKLKQKIENFKFFSQYANLKELKNYSNGDVSINENVPSYDVKYKMSNKDENVKQLRSRYNIPTDKSPVLKMHIDGNLKGSSVGDRKLEIDFSKRENSHLSVIDSLDYQPAKTN 
fig|553567.3.peg.1954   Staphylococcus aureus A5948      MMGYLKRLVLYIVIMVMSVFIIGC−−−−DKSSDTAEK−−−−SKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYSIKNLEELYDKEGYRDGEFEKGDKGMWTIYTDFAKSNKPGELSNEGMVLYLDRNTRTAKGYYFVRTFY−−−−−−−−−−−−RKDKLPDRKNYKVEMKNNKIILLDKVEDKKLKQKIENFKFFSQYANLKELKNYSNGDVSINENVPSYDVKYKMSNKDENVKQLRSRYNIPTDKSPVLKMHIDGNLKGSSVGDRKLEIDFSKRENSHLSVIDSLDYQPAKTN 
fig|553590.4.peg.2509   Staphylococcus aureus A9754      MMGYLKRLVLYIVIMVMSVFIIGC−−−−DKSSDTAEK−−−−SKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYSIKNLEELYDKEGYRDGEFEKGDKGMWTIYTDFAKSNKPGELSNEGMVLYLDRNTRTAKGYYFVRTFY−−−−−−−−−−−−RKDKLPDRKNYKVEMKNNKIILLDKVEDKKLKQKIENFKFFSQYANLKELKNYSNGDVSINENVPSYDVKYKMSNKDENVKQLRSRYNIPTDKSPVLKMHIDGNLKGSSVGDRKLEIDFSKRENSHLSVIDSLDYQPAKTN 
fig|904778.3.peg.1017   Staphylococcus aureus subsp. aureus IS-88      MMGYLKRLVLYIVIMVMSVFIIGC−−−−DKSSDTAEK−−−−SKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYSIKNLEELYDKEGYRDGEFEKGDKGMWTIYTDFAKSNKPGELSNEGMVLYLDRNTRTAKGYYFVRTFY−−−−−−−−−−−−RKDKLPDRKNYKVEMKNNKIILLDKVEDKKLKQKIENFKFFSQYANLKELKNYSNGDVSINENVPSYDVKYKMSNKDENVKQLRSRYNIPTDKSPVLKMHIDGNLKGSSVGDRKLEIDFSKRENSHLSVIDSLDYQPAKTN 
fig|931433.3.peg.1020   Staphylococcus aureus subsp. aureus CIG1114      MMGYLKRLVLYIVIMVMSVFIIGC−−−−DKSSDTAEK−−−−SKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYSIKNLEELYDKEGYRDGEFEKGDKGMWTIYTDFAKSNKPGELSNEGMVLYLDRNTRTAKGYYFVRTFY−−−−−−−−−−−−RKDKLPDRKNYKVEMKNNKIILLDKVEDKKLKQKIENFKFFSQYANLKELKNYSNGDVSINENVPSYDVKYKMSNKDENVKQLRSRYNIPTDKSPVLKMHIDGNLKGSSVGDRKLEIDFSKRENSHLSVIDSLDYQPAKTN 
fig|931442.3.peg.1103   Staphylococcus aureus subsp. aureus CIG547      MMGYLKRLVLYIVIMVMSVFIIGC−−−−DKSSDTAEK−−−−SKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYSIKNLEELYDKEGYRDGEFEKGDKGMWTIYTDFAKSNKPGELSNEGMVLYLDRNTRTAKGYYFVRTFY−−−−−−−−−−−−RKDKLPDRKNYKVEMKNNKIILLDKVEDKKLKQKIENFKFFSQYANLKELKNYSNGDVSINENVPSYDVKYKMSNKDENVKQLRSRYNIPTDKSPVLKMHIDGNLKGSSVGDRKLEIDFSKRENSHLSVIDSLDYQPAKTN 
fig|426430.6.peg.405   Staphylococcus aureus subsp. aureus str. Newman      MMGYLKRLVLYIVIMVMSVFIIGC−−−−DKSSDTAEK−−−−SKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYSIKNLEELYDKEGYRDGEFEKGDKGMWTIYTDFAKSNKQGELSNEGMVLYLDRNTRTAKGYYFVRTFY−−−−−−−−−−−−RKDKLPDRKNYKVEMKNNKIILLDKVEDKKLKQKIENFKFFSQYANLKELKNYSNGDVSINENVPSYDVKYKMSNKDENVKQLRSRYNIPTDKSPVLKMHIDGNLKGSSVGDRKLEIDFSKRENSHLSVIDSLDYQPAKTN 
fig|904753.3.peg.921   Staphylococcus aureus subsp. aureus 21282      MMGYLKRLVLYIVIMVMSVFIIGC−−−−DKSSDTAEK−−−−SKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYSIKNLEELYDKEGYRDGEFEKGDKGMWTIYTDFAKSNKQGELSNEGMVLYLDRNTRTAKGYYFVRTFY−−−−−−−−−−−−RKDKLPDRKNYKVEMKNNKIILLDKVEDKKLKQKIENFKFFSQYANLKELKNYSNGDVSINENVPSYDVKYKMSNKDENVKQLRSRYNIPTDKSPVLKMHIDGNLKGSSVGDRKLEIDFSKRENSHLSVIDSLDYQPAKTN 
fig|904754.3.peg.292   Staphylococcus aureus subsp. aureus 21283      MMGYLKRLVLYIVIMVMSVFIIGC−−−−DKSSDTAEK−−−−SKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYSIKNLEELYDKEGYRDGEFEKGDKGMWTIYTDFAKSNKQGELSNEGMVLYLDRNTRTAKGYYFVRTFY−−−−−−−−−−−−RKDKLPDRKNYKVEMKNNKIILLDKVEDKKLKQKIENFKFFSQYANLKELKNYSNGDVSINENVPSYDVKYKMSNKDENVKQLRSRYNIPTDKSPVLKMHIDGNLKGSSVGDRKLEIDFSKRENSHLSVIDSLDYQPAKTN 
fig|553594.3.peg.1889   Staphylococcus aureus A9765      MMGYLKRLVLYIVIMVMSVFIIGC−−−−DKSSDTAEK−−−−SKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYSIKNLEELYDKEGYRDGEFEKGDKGMWTIYTDFAKSNKPGELSNEGMVLYLDRNTRTAKGYYFVRTFY−−−−−−−−−−−−RKDKLPDRKNYKVEMKNNKIILLDKVEDKKLKQKIENFKFFSQYANLKELKNYSNGDVSINENVPSYDVKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGGKSDLSVIDSLNFQPAKVDE
fig|548474.3.peg.1827   Staphylococcus aureus subsp. aureus TCH130       MRNLKRDVLYISIMALSIFIIGC−−−−DKSSVTAEK−−−−AKEDSK−−−−−−−−−−−−−−−−−−−−−−EDQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFEKGDKGTWTMYTDFAKSNKPGELSNEGMFLSLDRNTRTAKGYYFVRTFY−−−−−−−−−−−−RKYKLPYRKNYKVKMKNNKIILLDKVEDKKLKQKIENFKFFGQYANLKELKNYSNGDVSINENVPSYDVKYKMNNKDENVKQLRSRYNIPTDKSPVLKMHIDGNLKGSSVGDRKLEIDFSKRENSHLSVIDSLDYQPAKTN 
fig|1116224.3.peg.429   Staphylococcus aureus subsp. aureus VRS11a                                       EANT−−−−NKTDSK−−−−−−−−−−−−−−−−−−−−−−EEKIKKSFAKTLDMYPIKNLEELYDKEGYRDGEFEKGDKGMWTIYTDFAKSNKPGELSNEGMVLYLDRNTRTAKGYYFVRTFY−−−−−−−−−−−−RKDKLPDRKNYKVEMKNNKIILLDKVEDPNLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDVKYKMSNKDENVKQLRSRYNIPTDKSPVLKMHIDGNLKGSSVGDRKLEIDFSKRENSHLSVIDSLDYQPAKVDE
fig|1157030.3.peg.356   Staphylococcus aureus M0450                                       EANT−−−−NKTDSK−−−−−−−−−−−−−−−−−−−−−−EEKIKKSFAKTLDMYPIKNLEELYDKEGYRDGEFEKGDKGMWTIYTDFAKSNKPGELSNEGMVLYLDRNTRTAKGYYFVRTFY−−−−−−−−−−−−RKDKLPDRKNYKVEMKNNKIILLDKVEDPNLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDVKYKMSNKDENVKQLRSRYNIPTDKSPVLKMHIDGNLKGSSVGDRKLEIDFSKRENSHLSVIDSLDYQPAKVDE
fig|1158480.3.peg.1244   Staphylococcus aureus M1253                                       EANT−−−−NKTDSK−−−−−−−−−−−−−−−−−−−−−−EEKIKKSFAKTLDMYPIKNLEELYDKEGYRDGEFEKGDKGMWTIYTDFAKSNKPGELSNEGMVLYLDRNTRTAKGYYFVRTFY−−−−−−−−−−−−RKDKLPDRKNYKVEMKNNKIILLDKVEDPNLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDVKYKMSNKDENVKQLRSRYNIPTDKSPVLKMHIDGNLKGSSVGDRKLEIDFSKRENSHLSVIDSLDYQPAKVDE
fig|1158486.3.peg.2631   Staphylococcus aureus M1320                                       EANT−−−−NKTDSK−−−−−−−−−−−−−−−−−−−−−−EEKIKKSFAKTLDMYPIKNLEELYDKEGYRDGEFEKGDKGMWTIYTDFAKSNKPGELSNEGMVLYLDRNTRTAKGYYFVRTFY−−−−−−−−−−−−RKDKLPDRKNYKVEMKNNKIILLDKVEDPNLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDVKYKMSNKDENVKQLRSRYNIPTDKSPVLKMHIDGNLKGSSVGDRKLEIDFSKRENSHLSVIDSLDYQPAKVDE
fig|1158685.3.peg.1199   Staphylococcus aureus M0539                                       EANT−−−−NKTDSK−−−−−−−−−−−−−−−−−−−−−−EEKIKKSFAKTLDMYPIKNLEELYDKEGYRDGEFEKGDKGMWTIYTDFAKSNKPGELSNEGMVLYLDRNTRTAKGYYFVRTFY−−−−−−−−−−−−RKDKLPDRKNYKVEMKNNKIILLDKVEDPNLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDVKYKMSNKDENVKQLRSRYNIPTDKSPVLKMHIDGNLKGSSVGDRKLEIDFSKRENSHLSVIDSLDYQPAKVDE
fig|1158687.3.peg.365   Staphylococcus aureus M0565                                       EANT−−−−NKTDSK−−−−−−−−−−−−−−−−−−−−−−EEKIKKSFAKTLDMYPIKNLEELYDKEGYRDGEFEKGDKGMWTIYTDFAKSNKPGELSNEGMVLYLDRNTRTAKGYYFVRTFY−−−−−−−−−−−−RKDKLPDRKNYKVEMKNNKIILLDKVEDPNLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDVKYKMSNKDENVKQLRSRYNIPTDKSPVLKMHIDGNLKGSSVGDRKLEIDFSKRENSHLSVIDSLDYQPAKVDE
fig|1169274.3.peg.368   Staphylococcus aureus M1309                                       EANT−−−−NKTDSK−−−−−−−−−−−−−−−−−−−−−−EEKIKKSFAKTLDMYPIKNLEELYDKEGYRDGEFEKGDKGMWTIYTDFAKSNKPGELSNEGMVLYLDRNTRTAKGYYFVRTFY−−−−−−−−−−−−RKDKLPDRKNYKVEMKNNKIILLDKVEDPNLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDVKYKMSNKDENVKQLRSRYNIPTDKSPVLKMHIDGNLKGSSVGDRKLEIDFSKRENSHLSVIDSLDYQPAKVDE
fig|1224926.3.peg.2618   Staphylococcus aureus M0279                                       EANT−−−−NKTDSK−−−−−−−−−−−−−−−−−−−−−−EEKIKKSFAKTLDMYPIKNLEELYDKEGYRDGEFEKGDKGMWTIYTDFAKSNKPGELSNEGMVLYLDRNTRTAKGYYFVRT