(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00004900

fig|1157354.3.peg.2187   Enterococcus faecalis B2207          GELAVIKLL−−−CAIYKKGYFILWDDLSQATLLKRLPGVSKEMLNQIVNRLVLWGFFDKELFDSV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KVLTSENIQATFFEATKR−−−−−RKTPK−−PTKYIVNVN−−−−−−−−−−SNSQSETVNADINTQSKVK−−−−ESK−−−−−VNKSKVNKKET−−ESCINPSSPETSVEKAFF−−−−−−−−−−−−−−−−−−−−−−−−−EEPLGEEKLTE−−L−−−−−IR−−YYSQ−−−−−−−−−−−−−−NVSPA−−−−−−−−−−−−−TPVNITDLQYDLA−−−−DFD−−−−−−−−GDLELLKEAVNICAR−−NNERR−−YS−−−Y−−−−−−−FAGILKNWRANG−−VKT−−−−−−−−−−−−−−−−−−−−−−−−YAD   
fig|1158625.3.peg.2074   Enterococcus faecalis RM4679          GELAVIKLL−−−CAIYKKGYFILWDDLSQATLLKRLPGVSKEMLNQIVNRLVLWGFFDKELFDSV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KVLTSENIQATFFEATKR−−−−−RKTPK−−PTKYIVNVN−−−−−−−−−−SNSQNETVNADINTQSKVK−−−−ESK−−−−−VNKSKVNKKET−−ESCINPLSPETSVEKAFF−−−−−−−−−−−−−−−−−−−−−−−−−EEPLGEEKLTE−−L−−−−−IR−−YYSQ−−−−−−−−−−−−−−NVSPA−−−−−−−−−−−−−TPVNITDLQYDLA−−−−DFD−−−−−−−−GDLELLKEAVNICAR−−NNERR−−YS−−−Y−−−−−−−FAGILKNWRANG−−VKT−−−−−−−−−−−−−−−−−−−−−−−−YAD   
fig|565644.5.peg.1578   Enterococcus faecalis CH188          GELAVIKLL−−−CAIYKKGYFILWDDLSQATLLKRLPGVSKEMLNQIVNRLVLWGFFDKELFDSV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KVLTSENIQATFFEATKR−−−−−RKTPK−−PTKYIVNVN−−−−−−−−−−SNSQNETVNADINTQSKVK−−−−ESK−−−−−VNKSKVNKKET−−ESCINPLSPETSVEKAFF−−−−−−−−−−−−−−−−−−−−−−−−−EEPLGEEKLTE−−L−−−−−IR−−YYSQ−−−−−−−−−−−−−−NVSPA−−−−−−−−−−−−−TPVNITDLQYDLA−−−−DFD−−−−−−−−GDLELLKEAVNICAR−−NNERR−−YS−−−Y−−−−−−−FAGILKNWRANG−−VKT−−−−−−−−−−−−−−−−−−−−−−−−YAD   
fig|1206105.3.peg.1694   Enterococcus faecalis D32          GELAVIKLL−−−CAIYKKGYFILWDDLSQATLLKRLPGVSKEMLNQIVNRLVLWGFFDKELFDSV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KVLTSENIQATFFEATKR−−−−−RKTPK−−PTKYIVNVN−−−−−−−−−−SNSQSETVNADINTQSKVK−−−−ESK−−−−−VNKSKVNKKET−−ESSINPSSPETSVEKAFF−−−−−−−−−−−−−−−−−−−−−−−−−EEPLGEEKLTE−−L−−−−−IR−−YYSQ−−−−−−−−−−−−−−NVSPA−−−−−−−−−−−−−TPVNITDLQYDLA−−−−DFD−−−−−−−−GDLELLKEAVNICAR−−NNERR−−YS−−−Y−−−−−−−FAGILKNWRANG−−VKT−−−−−−−−−−−−−−−−−−−−−−−−YAD   
fig|565642.4.peg.2453   Enterococcus faecalis ATCC 4200          GELAVIKLL−−−CAIYKKGYFILWDDLSQATLLKRLPGVSKEMLNQIVNRLVLWGFFDKELFDSV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KVLTSENIQATFFEATKR−−−−−RKTPK−−PTKYIVNVN−−−−−−−−−−SNSQSETVNADINTQSKVK−−−−ESK−−−−−VNKSKVNKKET−−ESSINPSSPETSVEKAFF−−−−−−−−−−−−−−−−−−−−−−−−−EEPLGEEKLTE−−L−−−−−IR−−YYSQ−−−−−−−−−−−−−−NVSPA−−−−−−−−−−−−−TPVNITDLQYDLA−−−−DFD−−−−−−−−GDLELLKEAVNICAR−−NNERR−−YS−−−Y−−−−−−−FAGILKNWRANG−−VKT−−−−−−−−−−−−−−−−−−−−−−−−YAD   
fig|565651.6.peg.2134   Enterococcus faecalis AR01/DG          GELAVIKLL−−−CAIYKKGYFILWDDLSQATLLKRLPGVSKEMLNQIVNRLVLWGFFDKELFDSV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KVLTSENIQATFFEATKR−−−−−RKTPK−−PTKYIVNVN−−−−−−−−−−NNSQSETVNADINAQSKVK−−−−ESK−−−−−VNKSKVNKKET−−ESSINSSSPETSVEKAFF−−−−−−−−−−−−−−−−−−−−−−−−−EEPLGEEKLTE−−L−−−−−IR−−YYSQ−−−−−−−−−−−−−−NVSPA−−−−−−−−−−−−−TPVNITDLQYDLS−−−−DFD−−−−−−−−GDLELLKEAVNICAR−−NNERR−−YS−−−Y−−−−−−−FAGILKNWRANG−−VKT−−−−−−−−−−−−−−−−−−−−−−−−YAD   
fig|565644.5.peg.1669   Enterococcus faecalis CH188          GELAVIKLL−−−CAIYKKGYFILWDELSQATLLKRLPGVSKEMLNQIVNRLVLWGFFDKELFDSV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KVLTSENIQATFFEATKR−−−−−RKTPK−−PTKYIVNVN−−−−−−−−−−NNSQSETVNADINTQSKVK−−−−ESK−−−−−VNKSKVNKKESTKENSVSPPSNESD−−−−FL−−−−−−−−−−−−−−−−−−−−−−−−−DNPLGSKKLEE−−L−−−−−SK−−YFSK−−−−−−−−−−−−−−NVIRV−−−−−−−−−−−−−TPVNLTDLEYDLK−−−−DFN−−−−−−−−GDLDLLKEAVNICAR−−KNRRS−−YN−−−Y−−−−−−−FAGILKIWRANG−−IKT                              
fig|537973.8.peg.927   Lactobacillus paracasei subsp. paracasei 8700:2        PKGVLIFIYLL−−−AAIYRKGYYLEWTGLAKNQLVNRVSGATGELVGLVVKRLIEYGTFNKDLFLSD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NVLTSQRIQETFTDATKR−−−−−RKSQK−−PTLYWINAD−−−−−−−−−−−SNSASDGVNDDINTQSKVK−−−−ESK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VNKNKTDSQAG−−−−−−−−VR−−VHEN−−−−−−−−ARLLWQNVWGF−−−−−−−−−−−PNAIATQDLEEWIG−−−−NFG−−−−−−−−−−DDLVCWVIKYAAR−−KDVKA−−KGADRY−−−−−−−LAKVFDGYTERK−−IKT−−−−−−−−−−−−−−−−−−−−−−−−VEQAEA
fig|220668.1.peg.542   Lactobacillus plantarum WCFS1        PKGVLFMIYLL−−−SAVYQNGYYLQWNKLKQMQLANRIEGVSPELANQIVNRLIAYGTFSEELFNSA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KVLTSQRIQETYEDATKR−−−−−RKSQK−−PTKYWINAD−−−−−−−−−−INKDTSVVNVDINTQSKVN−−−−KSK−−−−−SNK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SKVNNYDDDAG−−−−−−−−V−−−TREQ−−−−−−−−VINDWTNLWGF−−−−−−−−−−−PNGIARPEIDEWLE−−−−EFK−−−−−−−−−−PEVIAYAIWVAGE−−HQIGS−−NACLKY−−−−−−−VRAIVAGWKKRN−−ITT−−−−−−−−−−−−−−−−−−−−−−−−LEQAKK
fig|220668.9.peg.537   Lactobacillus plantarum WCFS1        PKGVLFMIYLL−−−SAVYQNGYYLQWNKLKQMQLANRIEGVSPELANQIVNRLIAYGTFSEELFNSA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KVLTSQRIQETYEDATKR−−−−−RKSQK−−PTKYWINAD−−−−−−−−−−INKDTSVVNVDINTQSKVN−−−−KSK−−−−−SNK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SKVNNYDDDAG−−−−−−−−V−−−TREQ−−−−−−−−VINDWTNLWGF−−−−−−−−−−−PNGIARPEIDEWLE−−−−EFK−−−−−−−−−−PEVIAYAIWVAGE−−HQIGS−−NACLKY−−−−−−−VRAIVAGWKKRN−−ITT−−−−−−−−−−−−−−−−−−−−−−−−LEQAKK
fig|565663.4.peg.267   Enterococcus faecium Com15          GELAVIKLL−−−CAVYKKGYFIVWNDLTKATLLKRLPGASKELLDQIVARLVAWGFFNEDLFNSA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KVLTSENIQARYFEATKR−−−−−RKSPK−−PTKYVINVN−−−−−−−−−−−NNSQPNRDNDNINPQSKVN−−−−ESK−−−−−VNKIDE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ENMGV−−−−−YE−−FIQV−−−−−−−−−−−−−−SWGKP−−−−−−−−−−−PTGLLQGALGPMIK−−−−KWG−−−−−−−−−−SDIILFAFRLAFE−−NSVEM−−PGLKKY−−−−−−−VEAILESWNKQN−−IKT−−−−−−−−−−−−−−−−−−−−−−−−LDDALK
fig|565666.3.peg.887   Enterococcus faecium TC 6      LGAGPQLLWYKLM−−−−AIANKSGWQSELSIAN−−TRLQAMTKTSEKTLINNRNQLIQNGLLQYKKRGR−−−−−−−−−−−−−−−−−−−−−−−−−−−TKAGVYILSDLTGKFTVKTTVDNTVENSATG−−−−−−−−−−NIPVDSKVNPK−−−−−−−−−−VNREVNPSVDSTVNPSAYIN−−−−NTK−−−−−QNKT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NKE−−−−−−DDIGV−−−−−YE−−FIQK−−−−−−−−−−−−−−NWGKS−−−−−−−−−−−PTGLLQGALGPMIK−−−−AWG−−−−−−−−−−ADMILFAFKLAFE−−NNVEM−−PGLKKY−−−−−−−VEAILNSWSNQG−−IKT−−−−−−−−−−−−−−−−−−−−−−−−MESAEK
fig|525279.3.peg.548   Enterococcus faecium TX1330      LGAGPQLLWYKLM−−−−AIANRSGWQSELSIAN−−TRLQAMTKTSEKTLINNRNQLIQNGLLQYKKRGR−−−−−−−−−−−−−−−−−−−−−−−−−−−TKAGVYILSDLTGNFTVKTTVDNTVENPTTG−−−−−−−−−−NIPVDSKVNPK−−−−−−−−−−VNREVNPSVDSTVNPSAYIN−−−−NTK−−−−−QNKT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NKED−−−−−DDIGV−−−−−YE−−FIQK−−−−−−−−−−−−−−NWGKS−−−−−−−−−−−PTGLLQGALGPMIK−−−−TWG−−−−−−−−−−ADMILFAFKLAFE−−NNVEM−−PGLKKY−−−−−−−VEAILNSWSNQG−−IKT−−−−−−−−−−−−−−−−−−−−−−−−MESVEK
fig|645663.4.peg.1519   Enterococcus faecium E1039      LGAGPQLLWYKLM−−−−AIANKSGWQSELSIAN−−TRLQAMTKTSEKTLINNRNQLIQNGLLQYKKRGR−−−−−−−−−−−−−−−−−−−−−−−−−−−TKAGVYILSDLTGNFTVKTTVDNTVENSATG−−−−−−−−−−NIPVDSKVNPK−−−−−−−−−−VNREVNPSVDSTVNPSAYIN−−−−NTK−−−−−QNKT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NKED−−−−−DDIGV−−−−−YE−−FIQK−−−−−−−−−−−−−−NWGKA−−−−−−−−−−−PTGLLQGALGPMIK−−−−TWG−−−−−−−−−−ADMILFAFKLAFE−−NNVEM−−PGLKKY−−−−−−−VEAILNSWSNQG−−IKT−−−−−−−−−−−−−−−−−−−−−−−−MESAEK
fig|565659.3.peg.518   Enterococcus faecium 1,141,733      LGAGPQLLWYKLM−−−−AIANKSGWQSELSIAN−−TRLQAMTKTSEKTLINNRNQLIQNGLLQYKKRGR−−−−−−−−−−−−−−−−−−−−−−−−−−−TKAGVYILSDLTGNFTVKTTVDNTVENSATG−−−−−−−−−−NIPVDSKVNPK−−−−−−−−−−VNREVNPSVDSTVNPSAYIN−−−−NTK−−−−−QNKT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NKE−−−−−−DDIGV−−−−−YE−−FIQK−−−−−−−−−−−−−−NWGKA−−−−−−−−−−−PTGLLQGALGPMIK−−−−TWG−−−−−−−−−−ADMILFAFKLAFE−−NNVEM−−PGLKKY−−−−−−−VEAILNSWSNQG−−IKT−−−−−−−−−−−−−−−−−−−−−−−−MESAEK
fig|535205.4.peg.1568   Enterococcus faecium E1071                                              MTKTSEKTLINNRNQLIQNGLLQYKKRGR−−−−−−−−−−−−−−−−−−−−−−−−−−−TKAGVYILSDLTGNFTVKTTVDNTVENSATG−−−−−−−−−−NIPVDSKVNPK−−−−−−−−−−VNREVNPSVDSTVIPSAYIN−−−−NTK−−−−−QNKT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NKE−−−−−−DDIGV−−−−−YE−−FIQK−−−−−−−−−−−−−−NWGKA−−−−−−−−−−−PTGLLQGALGPMIK−−−−TWG−−−−−−−−−−ADMILFAFKLAFE−−NNVEM−−PGLKKY−−−−−−−VEAILNSWSNQG−−IKT−−−−−−−−−−−−−−−−−−−−−−−−MESAEK
fig|565642.4.peg.1025   Enterococcus faecalis ATCC 4200     GLSSGQIALWRALM−−−−SINNKTRWSEWFTASN−−QTLETLAGLSRQGINKNRNVLKQLGLIDFQTNG−−−−−−−−−−−−−−−−−−−−−−−−−−−−RKATSYHICKLYTSDSVQGSLQEDVRKLSTS−−−−−NSLQESVQDSLQSSSETVAEKCTTQLRNSSTLYKHKQNININ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ENTNINNHEEDVGV−−−−−HE−−FIQS−−−−−−−−−−−−−−HWGQQ−−−−−−−−−−−PNNLLKGALGPWIR−−−−EWG−−−−−−−−−−PELVLYAVKQAYE−−YSVDM−−RWLKSY−−−−−−−VDKIFANWKDKS−−ITT−−−−−−−−−−−−−−−−−−−−−−−−LEEAME
fig|1158625.3.peg.1528   Enterococcus faecalis RM4679     KLSSGQIALWRALM−−−−SINNKAGWATWFTAAN−−ATLESLSGLSRSGINKNRNALKQLGLIDFKSNG−−−−−−−−−−−−−−−−−−−−−−−−−−−−RKATSYKVCVLYTLNSAQESTQQSNDKVTLK−−−−−−−−−−−−−−−−−−−−−−−−−−STTQSTNSGTLIKHKQNINTNNSFS−−−−PET−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNK−−−−−LN−−I−−−−−YA−−AVEQ−−−−−−−−−−−−−−NFGRP−−−−−−−−−−−LSPIEMEMIKQWQT−−−−EDG−−−−−−−−YPDDLIQLALKEAVL−−NQAFS−−LK−−−Y−−−−−−−MDRILLSWERKG−−IKT−−−−−−−−−−−−−−−−−−−−−−−−KNQAIK
fig|1157386.3.peg.1471   Enterococcus faecalis B2277     KLSSGQIALWRALM−−−−SINNKAGWATWFTAAN−−ATLESLSGLSRSGINKNRNALKQLGLIDFKSNG−−−−−−−−−−−−−−−−−−−−−−−−−−−−RKATSYKVCVLYTLNSAQESTQQSNDKVTLK−−−−−−−−−−−−−−−−−−−−−−−−−−STTQSTNSGTLIKHKQNINTNNSFS−−−−PET−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNK−−−−−LN−−I−−−−−YA−−AVEQ−−−−−−−−−−−−−−NFGRP−−−−−−−−−−−LSPIEMEMIKQWQT−−−−EDG−−−−−−−−YPDDLIQLALKEAVL−−NQAFS−−LK−−−Y−−−−−−−MDRILLSWERKG−−IKT−−−−−−−−−−−−−−−−−−−−−−−−KNQAIK
fig|525318.3.peg.1424   Lactobacillus buchneri ATCC 11577     KLSAGQIALWHALM−−−−SINNKAHWQKWFTAAN−−KTLESLTGLSRSGINSARNSLKQYGLINFETMGP−−−−−−−−−−−−−−−−−−−−−−−−−−−HKATKYFIKQLYTSDSVHSSEQSGVHSTDRT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EYIPETILRQNSGTLIK−−−−QNK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TETKLNSRQSHAGV−−−−−WE−−NWQQ−−−−−−−−−−−−−−−LWGF−−−−−−−−−−−PNAVAQQDLQEWAQ−−−−EFT−−−−−−−−−−PDLLNHVIEYAGR−−RNVQA−−RAADNY−−−−−−−IDRVLQSYRQHQPPITT−−−−−−−−−−−−−−−−−−−−−−−−VAQAKK
fig|525338.3.peg.1048   Lactobacillus plantarum subsp. plantarum ATCC 14917     SVSNGQNNLYRELL−−−DYANDEGKLDVQFRMKN−−SALLSLTGLSEPGLDKARNSLVQLGLIKYVRGKKN−−−−−−−−−−−−−−−−−−−−−−−−−−VKPPEYRIINLYSRSAGYPTSNPTTSHKSRP−−−−−−−−−−−−−−TGLDKVGQPVGQGGGQPVEHKELTSTDPDLTDTDSYD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DDAGV−−−−−−−−−TREQ−−−−−−−−VINDWTNLWGF−−−−−−−−−−−PNGIARPEIDEWLE−−−−EFK−−−−−−−−−−PEVIAYAIWVAGE−−HQIGS−−NACLKY−−−−−−−VRAIVAGWKKRN−−ITT−−−−−−−−−−−−−−−−−−−−−−−−LEQAKK
fig|220668.9.peg.2060   Lactobacillus plantarum WCFS1     SVSNGQNNLYRELL−−−DYANDEGKLDVQFRMKN−−SALLSLTGLSEPGLDKARNSLVQLGLIKYARGKKN−−−−−−−−−−−−−−−−−−−−−−−−−−VKPPEYRIINLYSRSAGYPTSNPTTSHKSRP−−−−−−−−−−−−−−TGLDEVGQLVGQGGGQPVEHKELTNTDPDLTDTDSYD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DDAGV−−−−−−−−−TREQ−−−−−−−−VINDWTNLWGF−−−−−−−−−−−PNGVARPEIDEWLA−−−−VLK−−−−−−−−−−PELVAYAIQIAGE−−HDVQS−−RGALKY−−−−−−−VRAIIAGWKKRN−−ITT−−−−−−−−−−−−−−−−−−−−−−−−LEQAKK
fig|220668.1.peg.2028   Lactobacillus plantarum WCFS1     SVSNGQNNLYRELL−−−DYANDEGKLDVQFRMKN−−SALLSLTGLSEPGLDKARNSLVQLGLIKYARGKKN−−−−−−−−−−−−−−−−−−−−−−−−−−VKPPEYRIINLYSRSAGYPTSNPTTSHKSRP−−−−−−−−−−−−−−TGLDEVGQLVGQGGGQPVEHKELTNTDPDLTDTDSYD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DDAGV−−−−−−−−−TREQ−−−−−−−−VINDWTNLWGF−−−−−−−−−−−PNGVARPEIDEWLA−−−−VLK−−−−−−−−−−PELVAYAIQIAGE−−HDVQS−−RGALKY−−−−−−−VRAIIAGWKKRN−−ITT−−−−−−−−−−−−−−−−−−−−−−−−LEQAKK
fig|525337.3.peg.2242   Lactobacillus paracasei subsp. paracasei ATCC 25302      LSTGQIALWHGLV−−−−YQCNQLGWPSEFNMPN−−RTLETLTGLSRQGIIKARNALKQSGLIDFQTNG−−−−−−−−−−−−−−−−−−−−−−−−−−−−VKATTYSVIDISRKLSTSDSRQPSSQADDSV−−−−−−−−−−−−−−−−−−−−SDSRQHSRQPSRQHSLQGSLQPSRQHSSTYTKQDETKLDKTKRQQTTAPVKAAERPTE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EPSSSSSSILD−−I−−−−−CN−−FWEG−−−−−−−−−−−−−−NGFGQ−−−−−−−−−−−LSPFTRESLVEWVD−−−−DMR−−−KAGSPEPEKLVLNALRTAVE−−SNVKN−−YK−−−Y−−−−−−−VNGILKNWESKR−−LLT−−−−−−−−−−−−−−−−−−−−−−−−VAAVEA
fig|1215914.3.peg.1324   Lactobacillus casei W56      LSTGQIALWHGLV−−−−YQCNQLGWPSEFNMPN−−RTLETLTGLSRQGIVKARNALKQSGLIDFQTNG−−−−−−−−−−−−−−−−−−−−−−−−−−−−VKATTYSVIDISRKLSTSDSRQPSSQADGSV−−−−−−−−−−−−−−−−−−−−SNSRQHSRQPSRQHSLQGSLQPSRQHSSTYTKQDETKLDKTKRQQTTAPVKAAERPAE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EPSSSSSSILD−−I−−−−−CN−−FWEG−−−−−−−−−−−−−−NGFGQ−−−−−−−−−−−LSPFTRESLVDWVD−−−−DMR−−−KAGSPEPEKLVLNALRTAVE−−SNVRN−−YK−−−Y−−−−−−−VNGILKNWESKR−−LLT−−−−−−−−−−−−−−−−−−−−−−−−VAAVDA
fig|568704.3.peg.773   Lactobacillus rhamnosus Lc 705      LSTGQIALWHGLV−−−−YQCNQLGWPSEFNMPN−−RTLETLTGLSRQGIVKSRNALKQSGLIDFQTNG−−−−−−−−−−−−−−−−−−−−−−−−−−−−VKATTYSVIDISRKLSTSDSRQPSGQDDDSV−−−−−−−−−−−−−−−−−−−−SNSRQHSRQPSRQHSLQGSLQPSRQHSSTYTKQDETKLDKTKRQQTTAPVKAAERPAE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EPSSSSSSILD−−I−−−−−CN−−FWEG−−−−−−−−−−−−−−NGFGQ−−−−−−−−−−−LSPFTRESLVDWVA−−−−DMR−−−KAGSPEPEKLVLNALRTAVE−−SNVRN−−YK−−−Y−−−−−−−VNGILKNWESKR−−LLT−−−−−−−−−−−−−−−−−−−−−−−−VAAVDA
fig|568703.9.peg.1034   Lactobacillus rhamnosus GG      LSTGQIALWHGLV−−−−YQCNQLGWPSEFNMPN−−RTLETLTGLSRQGIVKSRNALKQSGLIDFQTNG−−−−−−−−−−−−−−−−−−−−−−−−−−−−VKATTYSVIDISRKLSTSDSRQPSSQDDDSM−−−−−−−−−−−−−−−−−−−−SNSRQHGRQPSRQHSLQGSLQPSRQHSSTYTKQDETKLDKTKRQQTTAPVKAAERPAG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EPSSSSSSILD−−I−−−−−CN−−FWEG−−−−−−−−−−−−−−NGFGQ−−−−−−−−−−−LSPFTRESLVDWVA−−−−DMR−−−KAGSPEPEKLVLNALRTAVE−−SNVRN−−YK−−−Y−−−−−−−VNGILKNWESKR−−LLT−−−−−−−−−−−−−−−−−−−−−−−−VAAVDA
fig|398511.4.peg.3496   Bacillus pseudofirmus OF4      LTPSGIATWHALM−−−−QVWQKAGWPKSFTVAV−−SVIAVKSGMKVRHFYNIRKELEEKGYLTFTSRGS−−−−−−−−−−−−−−−−−−−−−−−−−−−GQAAQYAMTDLSTNLHHQPRALYAPDRTQAS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ASTASQPNAQPSSLLI−−−−KEN−−−−−NIKE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NNKD−−−−−IT−−P−−−−−FR−−FYEE−−−−−−−−−−−−−−NGFGR−−−−−−−−−−−LSPFISESINAWLD−−−−DPT−−−−−−FTEPSGVVIEAMKVSLL−−QNVRT−−WG−−−Y−−−−−−−VSKILQDWSGKG−−LQT−−−−−−−−−−−−−−−−−−−−−−−−VGEIRA
fig|536227.4.peg.334   Clostridium carboxidivorans P7      LSTSAIALWHTIM−−−−HINNKAGWVKTFTVAE−−SVLSIKTGLSGRSVRNARNELKQKGRIDFKSRTG−−−−−−−−−−−−−−−−−−−−−−−−−−−GKAPIYTIISFEVGISCLDKRAMEKTEEIDS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EEG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NSTEIDSVGVSID−−−−SAGDVSTDTSGDSSTLIDKDLDEHKD−−−−−−−−−−−−−−−−−−−−−−LDIIVNNDHKEK                                   
fig|293826.6.peg.2699   Alkaliphilus metalliredigens QYMF      LKAKEILLWHTLM−−−−HLACTARWVKWISTPI−−STLESKTGLKRDAIYAARDKLVKLGRIEVLPGKG−−−−−−−−−−−−−−−−−−−−−−−−−−−SKAAQYRIIPFVENYCSEEVEEQLDDPDINT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EDTDKQTPTPPNAKPQKEEL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PQMNIYRK−−−−−−−−−−−−MQTLIMM−−−−−−−−−−−PSPMDIENIKTYLN−−−−DGM−−−−−−−−−EDQLLMEAIDISERELQNKKPSDKWR−−−Y−−−−−−−AKGIMRNWFNDG−−IKT−−−−−−−−−−−−−−−−−−−−−−−−LTQYQE
fig|563191.3.peg.145   Acidaminococcus sp. D21      LSTSARILWFSLM−−−−HYCNSCGWKVDFAVPL−−SAIEADTGLKRDAIYAARNSLIQAGRIKVTQRKG−−−−−−−−−−−−−−−−−−−−−−−−−−−GKAAVYSLIFFTVEAGDENPVSGMASVKPTR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TPTRTPTPSPTRTPTSTPNIPRVEKT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RVDKGGGAARARSTRNPVNDLDFGE−−V−−−−−AQ−−AFSD−−−−−−−−−−−−−−NINP−−−−−−−−−−−ITPFQADDLHDLYE−−−−TYG−−−−−−−−−−KDRVIWAIREGAR−−NNARS−−IR−−−Y−−−−−−−VERVLEHWRR                                     
fig|568816.4.peg.1208   Acidaminococcus intestini RyC-MR95      LSTSARILWFSLM−−−−HYCNSCGWKVDFAVPL−−SAIEADTGLKRDAIYAARNSLIQAGRIKVTQRKG−−−−−−−−−−−−−−−−−−−−−−−−−−−GKAAVYSLIFFTVEAGDENPVSGMASVKPTR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TPTRTPTPSPTRTPTSTPNIPRVEKT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RVDKGGGAARARSTRNPVNDLDFGE−−V−−−−−AQ−−AFSD−−−−−−−−−−−−−−NINP−−−−−−−−−−−ITPFQADDLHDLYE−−−−TYG−−−−−−−−−−KDRVIWAIREGAR−−NNARS−−IR−−−Y−−−−−−−VERVLEHWRR                                     
fig|702443.3.peg.3592   Bacteroides ovatus SD CMC 3f       TATEQALFYELV−−−−AICNGEDWRDVFDCSN−−IELCFALNVNEKTLIKARESLINAGLIYYKSG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KNKRIISSYSFVKEFKTTVTTTVNFTANQTA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NQTANKGANQTAN−−−−DTGDKGVNDTGDSTDYNKLKQKPNINILSKVSHGDFD−−−F−−−−−−−ISNEF−−−−−−−−−LET−−−−−−−−−−−−−−−−−−−−−−−−FTLWLE
fig|556259.3.peg.361   Bacteroides sp. D2       TATEQALFYELV−−−−AICNGEDWRDVFDCSN−−IELCFALNVNEKTLIKARESLINAGLIYYKSG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KNKRIISSYSFVKEFKTTVTTTVNF−−−−TA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NQTANKGVNQTAN−−−−DTVDKGANDTGDSTDYNKLKQKPNRNILSKVSHGDFD−−−F−−−−−−−ISDEF−−−−−−−−−LEA−−−−−−−−−−−−−−−−−−−−−−−−FSLWLE
fig|272559.17.peg.2418   Bacteroides fragilis NCTC 9343     RLTATEQALFYELV−−−−AVCNSEGWEDVFSCSN−−IELCFSLNIDEKTLIRARLSLINAGLVYYKSG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KGKRSVGSYSFCRKFKDDPPKKDQTTGDIPV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPPAQKPVDAPAD−−−−QPGDVPVDAPADAPDYNKTKTKTKTDFPPSSAH−−EG−−−KISGIDLFLDKSLTECYQE−−−LRTNIPWMEQFCMNIRLDYPDFSPELFYEFLDR
fig|272559.3.peg.2294   Bacteroides fragilis ATCC 25285     RLTATEQALFYELV−−−−AVCNSEGWEDVFSCSN−−IELCFSLNIDEKTLIRARLSLINAGLVYYKSG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KGKRSVGSYSFCRKFKDDPPKKDQTTGDIPV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPPAQKPVDAPAD−−−−QPGDVPVDAPADAPDYNKTKTKTKTDFPPSSAH−−EG−−−KISGIDLFLDKSLTECYQE−−−LRTNIPWMEQFCMNIRLDYPDFSPELFYEFLDR
fig|580331.4.peg.1439   Thermoanaerobacter italicus Ab9                                               MGVSENTLKRARNELKQKNLIDFKPANKK−−−−−−−−−−−−−−−−−−−−−−−−−−GESTTYRIIDLTNKVSNIDTKPDTKIDTQVK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VSNIDTQIDTNADTKPD−−−−TKL−−−−−DTKPDTQTDAINKLKYKLKLKYKHNEVVDDVDVKKASCQTEKVSNIDTQIDTKMTNDTL−−−−−VK−−V−−−−−VN−−LFEQ−−−−−−−−−−−−−−SGMGT−−−−−−−−−−−INATIAESLEYISN−−−−NYP−−−−−−−−−−YELIEEAFRRARL−−NHATS−−IR−−−Y−−−−−−−VEKILLAWREKD−−IES−−−−−−−−−−−−−−−−−−−−−−−−LEQ   
fig|525257.3.peg.2359   Chryseobacterium gleum ATCC 35910     KISPTEIALYLYLL−−−−−−−KIGYEKDRYDFKISDVELARELGLTRVTIKASKDKLKNRGLIQFQTSN−−−−−−−−−−−−−−−−−−−−−−−−−−−−GLPCYYRLLLDYSFEIKPEKEGIKKDSDTEN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LQKRAILEIPQIID−−−−NLA−−−−−−−−−NESTIIPSWEEFISYAKTLQS−−−−−−−YDSPMDFSIEKKYKIWVDKGWKNA−−−−−−−−−−−−−−−−−−−−−−−−FNRPIS
fig|634956.3.peg.3153   Geobacillus thermoglucosidasius C56-YS93     FLTNDEVLILVTAH−−−−−−−−−−−−−−−QENYVTNTRLQSLTDKKSDEISKLLSGLVEKGYLEPNGQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GRGTKYTLTEMFHQKSIGNSRYNRISSGPSA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NNSGPNAANSGPN−−−−ENE−−−−−QTK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DHEKVLLDISE−−−−−−−−−−−−LARKKKRLNPSEMDEIILNLCAI−−−−−−−−−−−−−KPLTLKELSQLLN−−−−−−−−−−−−−−−−−−−RQMDPLRKK−−−−−−−−−−−−−−−−−Y−−−−−−−ISRLLREGK−−−−−LEL−−−−−−−−−−−−−−−−−−−−−−−−L     
fig|469616.3.peg.1883   Fusobacterium mortiferum ATCC 9817      LKGNELLVYAIIY−−−−−−−−GFSQTNGTYFSGSTQYLADWTNSTRQGIMKNLKSLIDKGLIEKVGE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NQQVNYYKALRPVNKVNQSTELTRKQSLQGA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KQSLQEEVTEFTGTCKQSLH−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SN−−−−−−−−−−−−IYNK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LDNNINNN−−−SSSVD−−−−−−−−−−−−−−−−−ESTQPQHLEEKAIEFRNDIIE−−−−−−−−−−−−−−−LKDII                                          
fig|535205.4.peg.2144   Enterococcus faecium E1071     GLQSEEFLFVLQLH−−−−−−−−−−MAQLEGDTFPDLQMIAMDMGIKQDQIFQILDRLVTNGFIKIETTI−−−−−−−−−−−−−−−−−−−−−−−−−−−−VNGKKADRYNLYPIYDLLGEYLKTQEKKYEE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KTQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EKEI−−−−−QS−−V−−−−−YQ−−LFEQ−−−−−−−−−−−−−−EFGRP−−−−−−−−−−−LSSIEFQRIGQWLE−−−−EDH−−−−−−−−YQPEILKLALREAVL−−NQAYS−−FN−−−Y−−−−−−−VDRILLSWERKN−−LRT−−−−−−−−−−−−−−−−−−−−−−−−KQQVEE
fig|565666.3.peg.1137   Enterococcus faecium TC 6     GLQSEEFLFVLQLH−−−−−−−−−−MAQLEGDTFPDLQMIAMDMGIKQDQIFQILDRLVTNGFIKIETTI−−−−−−−−−−−−−−−−−−−−−−−−−−−−VNGKKADRYNLYPIYDLLGEYLKTQEKKYEE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KTQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EKEI−−−−−QS−−V−−−−−YQ−−LFEQ−−−−−−−−−−−−−−EFGRP−−−−−−−−−−−LSSIEFQRIGQWLE−−−−EDH−−−−−−−−YQPEILKLALREAVL−−NQAYS−−FN−−−Y−−−−−−−VDRILLSWERKN−−LRT−−−−−−−−−−−−−−−−−−−−−−−−KQQVEE
fig|645663.4.peg.797   Enterococcus faecium E1039     GLQSEEFLFVLQLH−−−−−−−−−−MAQLEGDTFPDLQMIAMDMGIKQDQIFQILDRLVTNGFIKIETTI−−−−−−−−−−−−−−−−−−−−−−−−−−−−VNGKKADRYNLYPIYDLLGEYLKTQEKKYEE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KTQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EKEI−−−−−QS−−V−−−−−YQ−−LFEQ−−−−−−−−−−−−−−EFGRP−−−−−−−−−−−LSSIEFQRIGQWLE−−−−EDH−−−−−−−−YQPEILKLALREAVL−−NQAYS−−FN−−−Y−−−−−−−VDRILLSWERKN−−LRT−−−−−−−−−−−−−−−−−−−−−−−−KQQVEE
fig|565663.4.peg.516   Enterococcus faecium Com15     GLQSEEFLFVLQLH−−−−−−−−−−MAQLEGDTFPDLQMIAMDMGIKQDQIFQILDRLVTNGFIKIETTI−−−−−−−−−−−−−−−−−−−−−−−−−−−−VNGKKADRYNLYPIYDQLGEYLKTQEKKYEE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KTQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EKEI−−−−−QS−−V−−−−−YQ−−LFEQ−−−−−−−−−−−−−−EFGRP−−−−−−−−−−−LSSIEFQRIGQWLE−−−−EDH−−−−−−−−YQPEILKLALREAVL−−NQAYS−−FN−−−Y−−−−−−−VDRILLSWERKN−−LRT−−−−−−−−−−−−−−−−−−−−−−−−KQQVEE
fig|1138917.3.peg.634   Enterococcus faecium E2039     GLQSEEFLFVLQLH−−−−−−−−−−MAQLEGDTFPDLQMIAMDMGIKQDQIFQILDRLVTNGFIKIETTI−−−−−−−−−−−−−−−−−−−−−−−−−−−−VNGKKADRYNLYPIYNQLGEYLKTQEKKYEE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KTQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EKEI−−−−−QS−−V−−−−−YQ−−LFEQ−−−−−−−−−−−−−−EFGRP−−−−−−−−−−−LSSIEFQRIGQWLE−−−−EDH−−−−−−−−YQPEILKLALREAVL−−NQAYS−−FN−−−Y−−−−−−−VDRILLSWERKN−−LRT−−−−−−−−−−−−−−−−−−−−−−−−KQQVEE
fig|525279.3.peg.102   Enterococcus faecium TX1330     GLQSEEFLFVLQLH−−−−−−−−−−MAQLEGDTFPDLQMIAIDMGIKQDQIFQILDRLVTNGFIKIETTN−−−−−−−−−−−−−−−−−−−−−−−−−−−−VNGKKADRYNLYPIYDQLGEYLKTQEKKYEE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KIQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EKEI−−−−−QS−−V−−−−−YQ−−LFEQ−−−−−−−−−−−−−−EFGRP−−−−−−−−−−−LSSIEFQRIGQWLE−−−−EDH−−−−−−−−YQPEILKLALREAVL−−NQAYS−−FN−−−Y−−−−−−−IDRILLSWERKN−−LRT−−−−−−−−−−−−−−−−−−−−−−−−KQQVEE
fig|565659.3.peg.751   Enterococcus faecium 1,141,733     GLQSEEFLFVLQLH−−−−−−−−−−MAQLEGDTFPDLQMIAIDMGIKQDQIFQILDRLVTNGFIKIETTI−−−−−−−−−−−−−−−−−−−−−−−−−−−−VNGKKADRYNLYPIYDQLGEYLKTQEKKYEE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KIQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EKEI−−−−−QS−−V−−−−−YQ−−LFEQ−−−−−−−−−−−−−−EFGRP−−−−−−−−−−−LSSIEFQRIGQWLE−−−−EDH−−−−−−−−YQPEILKLALREAVL−−NQAYS−−FN−−−Y−−−−−−−IDRILLSWERKN−−LRT−−−−−−−−−−−−−−−−−−−−−−−−KQQVEE
fig|333990.5.peg.1645   Carnobacterium sp. AT7     GLTNEQLILILQLK−−−−−−−−−−SFIDAGNDFPDTEIISRRMQISSAEVFQMIHGLINKKLIAIETEKN−−−−−−−−−−−−−−−−−−−−−−−−−−−NDGKTRDSYRLDLLWDRLALVISQQENQQRV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EKQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−HLSE−−−−−QE−−L−−−−−FQ−−LFES−−−−−−−−−−−−−−EFGRP−−−−−−−−−−−LSPIEMQTIGMWLD−−−−DDH−−−−−−−−YAVELIELALREAVL−−SQVYN−−LK−−−Y−−−−−−−VDRILLNWERKN−−IRT−−−−−−−−−−−−−−−−−−−−−−−−KDQVDK
fig|525330.3.peg.929   Lactobacillus johnsonii ATCC 33200     KISETEAMLLLQLE−−−−−−−−−−SFKQEKKFFPSDNNLSERMNLSPIEISQLIQNLIDKDLIELGQKRD−−−−−−−−−−−−−−−−−−−−−−−−−−−REGRITNFYDLNHLYQKLDTLIDEREKSYQD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QATFKSSTSTQQSANPI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QE−−L−−−−−VR−−QFEI−−−−−−−−−−−−−−EFGRL−−−−−−−−−−−LSPIEKQEIAAWIN−−−−IDH−−−−−−−−YDPEIVKLALREAIL−−AQVYN−−FK−−−Y−−−−−−−VDRILLNWQRHG−−LTT−−−−−−−−−−−−−−−−−−−−−−−−LDQIKN
fig|1185421.3.peg.2144   Staphylococcus hominis subsp. hominis ZBW5     GLNEKDLVILIKLI−−−−−−−−−−YAAEVSNKQPSIEFLQKGSNMEPREITSIIQNLIQRDLLALHVSKD−−−−−−−−−−−−−−−−−−−−−−−−−−−EEGKFTEYMNLNRFYEKLSDILTQEKNETTH−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−HQT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QQNF−−−−−KE−−L−−−−−FQ−−YIEQ−−−−−−−−−−−−−−LFSRP−−−−−−−−−−−LSPYEIETLNQWID−−−−VDQ−−−−−−−−HDYTLIRAALDEAYS−−HDKLS−−FK−−−Y−−−−−−−VDRILLNWKKNN−−VTT−−−−−−−−−−−−−−−−−−−−−−−−LEESNK
fig|481743.5.peg.2276   Geobacillus sp. Y412MC10     GLSDREAMLVIHLI−−−−−−−−−GYQQVEFKTFPSLEELAEVTGSPAAFIAASLQRLMKVGLIGIDEYVDE−−−−−−−−−−−−−−−−−−−−−−−−−−GQGIHYERYNLNGLYEKLAACLAQEGRDKSP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EAAKFASPLLNARPASG−−−−KTA−−−−−ASE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KPAPEKEE−−−−−RN−−L−−−−−FT−−IFEK−−−−−−−−−−−−−−EFGRP−−−−−−−−−−−LSPMELETISGWVD−−−−ADR−−−−−−−−YPDELILLALKEAVF−−AGKLH−−FR−−−Y−−−−−−−IDRILLEWSRNR−−VRT−−−−−−−−−−−−−−−−−−−−−−−−AQDAKA
fig|246194.6.peg.1181   Carboxydothermus hydrogenoformans Z-2901      LTEKELVFLLQLM−−−−−−−−−−SFNNEGNLLPSAEFLAKSLGEDLGEIKKNYRELIKKGIISVSKKFDE−−−−−−−−−−−−−−−−−−−−−−−−−−KSGKYVETIDYTPLFEKLTDLWAAQKVLNEV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NNRPLEKGS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDSA−−−−−AR−−V−−−−−VE−−VFSR−−−−−−−−−−−−−−EFGRG−−−−−−−−−−−LSPIEIELIDNWLN−−−−QKK−−−−−−−−YSEELIYEALKRAVI−−LNKKS−−FR−−−Y−−−−−−−IDAILYRWESNN−−IKT−−−−−−−−−−−−−−−−−−−−−−−−IEEVNN
fig|635013.3.peg.1681   Thermincola sp. JR     GVTDSEMMLIIQLL−−−−−−−−−RLKSFDNKPFPSLDQLAECMTGDSFKLKSDLAGLIEKEIISVCYYYDE−−−−−−−−−−−−−−−−−−−−−−−−−−ETGDVMSTYSLEPLFEKISEFWACEKVKGLQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−QMKKALKEKELKETRSSTTIA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KTEY−−−−−AK−−V−−−−−CK−−TFEK−−−−−−−−−−−−−−EFGRP−−−−−−−−−−−MSPMELEQIGTWLE−−−−DFH−−−−−−−−GSSELILEALKRAVF−−MGKHN−−FK−−−Y−−−−−−−IDSILLEWQKNN−−LKT−−−−−−−−−−−−−−−−−−−−−−−−VRAVLE
fig|536233.3.peg.1351   Clostridium botulinum E1 str. 'BoNT E Beluga'      LSCGAKVLYAYIC−−−−−−−−−SFTGAGSNAFPSLELICNELGMSEKKIYKCRKELVDNNLIAIEKKRI−−−−−−−−−−−−−−−−−−−−−−−−−−−GSKYSNNIYTLITNPTQNEPSQNEHIQNEPV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QNDYVQES−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EETSHSLEPSQNGHVQ−−−−−−NEPCPKVGTISNRLINKKEKRKTE−−−−−−−−−−−−−−−−−−−−−−FDELIQEYTDN                                    
fig|160491.19.peg.517   Streptococcus pyogenes str. Manfredo     FDDDGKVYMYF−−−−−−−−−−−−−−−−−−−−−−−TNEQFMELLKCSNKTVVKAKKELHDLSLLRE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VRQGINKPNRLYINGS−−−−−−−−−−VESTLQDVYKLHTINTNIIN−−−−TNI−−−−−SNYY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DDKG−−−−−TS−−−−−−−−−−−−FLEE−−−−−−−−−−−−IENLWGRQ−−−−−−−−−−FNGYEVQQINRFLLEE−−HIS−−−−−−−−−−NDLLKKAIETSLA−−NGARN−−MN−−−Y−−−−−−−VSAVINNWIDSG−−ITT−−−−−−−−−−−−−−−−−−−−−−−−VEQVDA
fig|406560.4.peg.2360   Streptococcus pneumoniae SP14-BS69     SIEELQKDYFVQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LSKPTIIKRKKELVDFGLIELKKQFNK−−−−−−−−−−−−−−−−−−−−−−−−−−SDKIYVNRLSSYISKNSLPTEVKNFDHISKNSLPTEVKNFDHISKN−−−−−−−−−−−−−−−−−−−SLPTEVKNFDSNQSYIN−−−−QSY−−−−−INRITEPDGAGANNLYSIE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DAPE−−−−−NDLGI−−−−−VHDWIFSE−−−−−−−−−−−−−−−−FGRY−−−−−−−−−−PTPFEIEDLKYFLQ−−−−DHS−−−−−−−−−−KEVIKLAIKECVG−−NGKPY−−FK−−−Y−−−−−−−LESILRDWKQKG−−LVT−−−−−−−−−−−−−−−−−−−−−−−−AELVEN
fig|406560.4.peg.2446   Streptococcus pneumoniae SP14-BS69     SIEELQKDYFVQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LSKPTIIKRKKELVDFGLIELKKQFNK−−−−−−−−−−−−−−−−−−−−−−−−−−SDKIYVNRLSSYISKNSLPTEVKNFDHISKNSLPTEVKNFDHISKN−−−−−−−−−−−−−−−−−−−SLPTEVKNFDSNQSYIN−−−−QSY−−−−−INRITEPDGAGANNLYSIE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DAPE−−−−−NDLGI−−−−−VHDWIFSE−−−−−−−−−−−−−−−−FGRY−−−−−−−−−−PTPFEIEDLKYFLQ−−−−DHS−−−−−−−−−−KEVIKLAIKECVG−−NGKPY−−FK−−−Y−−−−−−−LESILRDWKQKG−−LVT−−−−−−−−−−−−−−−−−−−−−−−−AELVEN
fig|393133.3.peg.2074   Listeria monocytogenes 10403S                                           LSNRWNADRKQVRKFLELLKKNDMITITKSRQK−−−−−−−−−−−−−−−−−−−−−−−−−−GTTYEISNYNDFQGISEEIRTT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KGTTI−−−−DTTEDTTKE−−−−HQM−−−−−VQRKGHKQELKNLR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IKELKKDIN−−−−NNSD−−−−−LN−−F−−−−−KD−−FWEQ−−−−−−−−−−−−−−NGFGM−−−−−−−−−−−MLPVELEKLLAWVD−−−−DFA−−−−−−−−GNREIVMKALEVTSEQGANKRN−−YA−−−Y−−−−−−−VNKILKNWESRG−−FKT−−−−−−−−−−−−−−−−−−−−−−−−IADVDA
fig|272626.1.peg.2395   Listeria innocua Clip11262                                           LSNRWNADRKQVRKFLELLKKNDMITITKSRQK−−−−−−−−−−−−−−−−−−−−−−−−−−GTTYEISNYNDFQGISEEIRTT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KGTTI−−−−DTTEDTTKE−−−−HQM−−−−−VQRKGHKQELKNLR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IKELKKDIN−−−−NNSD−−−−−LN−−F−−−−−KD−−FWEQ−−−−−−−−−−−−−−NGFGM−−−−−−−−−−−MLPVELEKLLAWVD−−−−DFA−−−−−−−−GNREIVMKALEVTSEQGANKRN−−YA−−−Y−−−−−−−VNKILKNWESRG−−FKT−−−−−−−−−−−−−−−−−−−−−−−−IADVDA
fig|393121.3.peg.2583   Listeria monocytogenes FSL J2-071                                           LSNRWNADRKQVRKFLELLKKNDMITITKSRQK−−−−−−−−−−−−−−−−−−−−−−−−−−GTTYEISNYNDFQGISEEIRTT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KGTTI−−−−DTTEDTTKE−−−−HQM−−−−−VQRKGHKQELKNLR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IKELKKDIN−−−−NNSD−−−−−LN−−F−−−−−KD−−FWEQ−−−−−−−−−−−−−−NGFGM−−−−−−−−−−−MLPVELEKLLAWVD−−−−DFA−−−−−−−−GNREIVMNALEVTSEQGANKRN−−YA−−−Y−−−−−−−VNKILKNWESRG−−FKT−−−−−−−−−−−−−−−−−−−−−−−−IADVDA
fig|393121.7.peg.3149   Listeria monocytogenes FSL J2-071                                           LSNRWNADRKQVRKFLELLKKNDMITITKSRQK−−−−−−−−−−−−−−−−−−−−−−−−−−GTTYEISNYNDFQGISEEIRTT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KGTTI−−−−DTTEDTTKE−−−−HQM−−−−−VQRKGHKQELKNLR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IKELKKDIN−−−−NNSD−−−−−LN−−F−−−−−KD−−FWEQ−−−−−−−−−−−−−−NGFGM−−−−−−−−−−−MLPVELEKLLAWVD−−−−DFA−−−−−−−−GNREIVMNALEVTSEQGANKRN−−YA−−−Y−−−−−−−VNKILKNWESRG−−FKT−−−−−−−−−−−−−−−−−−−−−−−−IADVDA
fig|267409.5.peg.1352   Listeria monocytogenes str. 1/2a F6854                                           LSNRWNADRKQVRKFLELLKKNDMITITKSRQK−−−−−−−−−−−−−−−−−−−−−−−−−−GTTYEISNYNDFQGISEEIRTT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KGTTIDTTEDTTEDTTKE−−−−HQM−−−−−VQRKGHKQELKNLR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IKELKKDIN−−−−NNSD−−−−−LN−−F−−−−−KD−−FWEQ−−−−−−−−−−−−−−NGFGM−−−−−−−−−−−MLPVEMEKLLAWVD−−−−DFA−−−−−−−−GNREIVMKALEVTSEQGANKRN−−YA−−−Y−−−−−−−VNKILKNWESRG−−FKT−−−−−−−−−−−−−−−−−−−−−−−−IADVDA
fig|267409.5.peg.2770   Listeria monocytogenes str. 1/2a F6854                                                                  GFLTKKSTKV−−−−−−−−−−−−−−−−−−−−−−−−−−NTLINIVNWGVYQESEN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KPNTLANNQLTNDSQTAN−−−−KQL−−−−−TTN−−−−−−−KNVR−−−−−−−−−−−−−−−−−−−−TKECKN−−−−−−−−−−−−NN−−NNSD−−−−−LN−−F−−−−−KD−−FWEQ−−−−−−−−−−−−−−NGFGM−−−−−−−−−−−MLPVELEKLLAWVD−−−−DFA−−−−−−−−GNREIVMKALEVTSEQGANKRN−−YA−−−Y−−−−−−−VNKILKNWESRG−−FKT−−−−−−−−−−−−−−−−−−−−−−−−IVDVDA
fig|393131.7.peg.2765   Listeria monocytogenes J2818                                                                  GFLTKKSTKV−−−−−−−−−−−−−−−−−−−−−−−−−−NTLINIVNWGVYQESEN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KPNTLANNQLTNDSQTAN−−−−KQL−−−−−TTN−−−−−−−KNVR−−−−−−−−−−−−−−−−−−−−TKECKN−−−−−−−−−−−−NN−−NNSD−−−−−LN−−F−−−−−KD−−FWEQ−−−−−−−−−−−−−−NGFGM−−−−−−−−−−−MLPVELEKLLAWVD−−−−DFA−−−−−−−−GNREIVMKALEVTSEQGANKRN−−YA−−−Y−−−−−−−VNKILKNWESRG−−FKT−−−−−−−−−−−−−−−−−−−−−−−−IVDVDA
fig|393125.10.peg.2996   Listeria monocytogenes FSL R2-503                                                                  GFLTKKSTKV−−−−−−−−−−−−−−−−−−−−−−−−−−NTLINIVNWGVYQESEN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KPNTLANNQLTNDSQTAN−−−−KQL−−−−−TTN−−−−−−−KNVR−−−−−−−−−−−−−−−−−−−−TKECKN−−−−−−−−−−−−NN−−NNSD−−−−−LN−−F−−−−−KD−−FWEQ−−−−−−−−−−−−−−NGFGM−−−−−−−−−−−MLPVELEKLLAWVD−−−−DFA−−−−−−−−GNREIVMKALEVTSEQGANKRN−−YA−−−Y−−−−−−−VNKILRNWEERG−−FKT−−−−−−−−−−−−−−−−−−−−−−−−VADVNA
fig|401650.3.peg.2655   Listeria monocytogenes Aureli 1997        NQMLIVWIRLLALAGKTNDKGRIYLNENVPYTEDMLATLFNRDVGIIRVTLHTLQSFGMIQKTE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NGLIEIENWEKHQNVDGMERVREQTRKRVEK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−HRKAMQQNRIASGDSKGN−−−−KEC−−−−−NVT−−−−−−−SSVT−−−−−−−−−−−−−−−−−−−−VTQSNAIDIDKELDKDINNN−−NNSD−−−−−LN−−F−−−−−KD−−FWEQ−−−−−−−−−−−−−−NGFGM−−−−−−−−−−−MLPIELEKLLAWVD−−−−DFA−−−−−−−−GNREIVMKALEVTSEQGANKRN−−YA−−−Y−−−−−−−VNKILKNWESRG−−FKT−−−−−−−−−−−−−−−−−−−−−−−−IADVDA
fig|393126.4.peg.2739   Listeria monocytogenes FSL R2-561        NQMLIVWIRLLALAGKTNDKGRIYLNENVPYTEDMLATLFNRDVGIIRVTLHTLQGFGMIQKTE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NGLIEIENWEKHQNVDGMERVREQTRKRVEK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−HREAMRQNRIASGDSKGD−−−−KES−−−−−NVT−−−−−−−SSVT−−−−−−−−−−−−−−−−−−−−VTQSNAIDIDKELDKDINI−−NNSD−−−−−LN−−F−−−−−KD−−FWEQ−−−−−−−−−−−−−−NGFGM−−−−−−−−−−−MLPIEQEKLLAWVD−−−−DFS−−−−−−−−GNQEIVFKALEVTSEQGANKRN−−YA−−−Y−−−−−−−VNKILRNWEERG−−FKT−−−−−−−−−−−−−−−−−−−−−−−−VADVNA
fig|169963.1.peg.2308   Listeria monocytogenes EGD-e        NQMLIVWIRLLALAGKTNDKGRIYLNENVPYTEDMLATLFNRDVGIIRVTLHTLQSFGMIQKTE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NGLIEIENWEKHQNVDGMERVREQTRKRVEK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−HREAMRQNRIASGDSKGN−−−−KEC−−−−−NVT−−−−−−−SSVT−−−−−−−−−−−−−−−−−−−−VTQSNAIDIDKELDKDINN−−NNSD−−−−−LN−−F−−−−−KD−−FWEQ−−−−−−−−−−−−−−NGFGM−−−−−−−−−−−MLPVELEKLLAWVD−−−−DFA−−−−−−−−GNREIVMKALEVTSEQGANKRN−−YA−−−Y−−−−−−−VNKILKNWESRG−−FKT−−−−−−−−−−−−−−−−−−−−−−−−IADVDA
fig|637381.3.peg.2484   Listeria monocytogenes 08-5923        NQMLIVWIRLLALAGKTNDKGRIYLNENVPYTEDMLATLFNRDVGIIRVTLHTLQSFGMIQKTE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NGLIEIENWEKHQNVDGMERVREQTRKRVEK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−HREAMRQNRIASGDSKGN−−−−KEC−−−−−NVT−−−−−−−SSVT−−−−−−−−−−−−−−−−−−−−VTQSNAIDIDKELDKDINN−−NNSE−−−−−LN−−F−−−−−KD−−FWEQ−−−−−−−−−−−−−−NGFGM−−−−−−−−−−−MLPVELEKLLAWVD−−−−DFA−−−−−−−−GNREIVMKALEVTSEQGANKRN−−YA−−−Y−−−−−−−VNKILKNWESRG−−FKT−−−−−−−−−−−−−−−−−−−−−−−−IADVDA
fig|12360.1.peg.15   Staphylococcus aureus phage phi 11           ITIWVKLLTLSGKYNEQGYIMLSENLPYNEEMLANEFNRPINSIRLAIQTFETLGMIEKV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NGVIKVTNWEKHQSLDSKAKHKEKNKLRQQR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YREKQKKLLEAKRNVTVTLR−−−−NDT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EEEEEREEEKEEEYKNKEEEREAVFSS−−−−−−−SIKYIIANLDDK−−−−−−−−−−−LTPNQMEQLGFAID−−−−DIG−−−−−−−TNAFEVVKVGVEYTKS−−KSAHG−−−G−−−Y−−−−−−−LIKVLNNWAKEN−−VKT−−−−−−−−−−−−−−−−−−−−−−−−KEDAEN
fig|266117.6.peg.39   Rubrobacter xylanophilus DSM 9941     LYELLRVLPEVGLD−−−−−−−−−−−−−−−−−−EVEVQELAELLRSTPEGVREALKTLEENGFLVRREGWTEVAGPPPAPGRAPAAPERP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ARDIRVIRAADEGV−−−−−SADDYFRY−−−−−−−−−−−−−−−−MGS−−−−−−−−−−−LPSPHILEFLNGYCE−−−−RDG−−−−−−−−MSPDVVREALRIASE−−RDARR−−VG−−−Y−−−−−−−VRSILERWVERG−−VKT−−−−−−−−−−−−−−−−−−−−−−−−VEDVE 
fig|563194.3.peg.1895   Pediococcus acidilactici 7_4                                      PSENELCELYGTSRETVRKALAMLLELGYIQKIKGKG−−−−−−−−−−−−−−−−−−−−−−−−−−−SIVLDVSRFVFPVSGIKSFKELNQSQDMHSR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TKLITLEPRLVPNKTFN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LDNDDQLN−−−ATYIE−−−−RLRTVNDEPIIIDIDYILSAVVANIPE−−RAAKNSLYE−−−Y−−−−−−−FEDEL−−−−−−GLDIS                               
fig|684738.3.peg.1538   Lactococcus lactis subsp. lactis KF147               ILLKLYLRSLKYEGRLMFNERIPFNPQMLSTIVRHPVGVVKKALKAFVDLCLVEVMD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NGAIYMLDIQNFIGKTTTEADRIKAYRSKIN−−−−−−KEKGLVSNDTPKLVQ−−−−−−−−−−MYDKSTPELELEIERELKIE−−−−KEV−−−−−EAS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KATSTNSDF−−−−−QN−−L−−−−−IE−−LYQK−−−−−−−−−−−−−−NFGI−−−−−−−−−−−VKPILYDDLKADLE−−−−DYG−−−−−−−−−−LELIIEAVKRAVK−−−RQRE−−YG−−−Y−−−−−−−AQGILKSWNNKG−−IKT−−−−−−−−−−−−−−−−−−−−−−−−LDQAKA
fig|486410.3.peg.1639   Streptococcus dysgalactiae subsp. equisimilis GGS_124               ILLKLYLRSLKNDGLLMFNNLIPYNAQMLATITRHQVGTIEKAIQIFRDLQLIEILD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NGAIYMTNIQNFVGKSSSQADYMRNYREKKV−−−−−−−−−−−−−−−−−−−−−−−−GLTNVNQNSYICEPEIEIEIEKDKKID−−−−INI−−−−−DIKTEVEEEIKDSS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ATADEKSN−−−−−FN−−I−−−−−FE−−YYQS−−−−−−−−−−−−−−RIGV−−−−−−−−−−−LDGYQAEKLNAYIKID−−KLE−−−−−−−−−−SKLVKRAIDRAAD−−NSKRS−−FG−−−Y−−−−−−−VNSILKSWAQNG−−ITT−−−−−−−−−−−−−−−−−−−−−−−−ITQ   
fig|471876.6.peg.1553   Streptococcus pyogenes NZ131          SEMIVIYIRLMLEAIENDCIIDYEGTFDNYAEELALRLETSEEQINMALAYFVKCGVIQVDD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GGNTHYPQAKALLGQETNWNRYKKKQAELE−−−−−KFQLL−−−−−−−−−−−−−−−−−−−−−−−−−−SNQVPTEIEKDKKID−−−−INI−−−−−DIKSEVEEEIKDSS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SAANVNNF−−−−−KI−−I−−−−−SD−−YFQQ−−−−−−−−−−−−−−EIGI−−−−−−−−−−−LSQNQFEQLSDYITIT−−KME−−−−−−−−−−VDVVKEAITRAAD−−NSKR                                                               
fig|1154921.3.peg.31   Streptococcus agalactiae GB00561                       SLKNDGLLMFNNLIPYNAQMLATITRHQVGTVEKAIQIFRDLQLIEILD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NGAIYMTNIQNFVGKSSTEADRIRKLRA−−−−−−−−KN−−−−NSGV−−−−−Q−−−−−−−−−−MLYKCTPEIEIEKDKKI−−D−−−−INI−−−−−DKELELEQDKED−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−R−−F−−−−−VD−−VVEA−−−−−−−−−−−−−−NLGRG−−−−−−−−−−LVKFEFDMINDYLIGQ−−NVS−−−−−−−−−−KDLFLEAVKVAVA−−NNVRK−−FN−−−Y−−−−−−−IARILDNWINDG−−IKT−−−−−−−−−−−−−−−−−−−−−−−−PEQAYQ
fig|471872.6.peg.1271   Streptococcus infantarius subsp. infantarius ATCC BAA-102               ILLKLYLRSLKNDGLLMFNNLIPYNAQMLATITRHQVGTVEKAIQIFQQLKLIEILD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NGAIYMSNIQNFVGKSSSEGDRKRAKRA−−−−−−−−QNRAIRQTSG−−−−−Q−−−−−−−−−−MSDKRPPEIEIDTETEIKKD−−−−IEL−−−−−KKELELEPEKEE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−R−−F−−−−−VD−−IVEA−−−−−−−−−−−−−−NLGRG−−−−−−−−−−LVKFEYDTMNDYLINK−−HVS−−−−−−−−−−KELFLEAVKVAVA−−NNVRK−−FN−−−Y−−−−−−−ISRVLDNWIENG−−IQT−−−−−−−−−−−−−−−−−−−−−−−−VEQAYQ
fig|585150.3.peg.2605   Staphylococcus aureus subsp. aureus C160                                                   KESTVRDYIKLLENLGTIVVKSDNK−−−−−−−−−−−−−−−−−−−−−−−−−−−FSVITVVNWAIYQSMEEN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SDSKNDNKSTTNQQQIN−−−−TNK−−−−−NVK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NGDNVKNGENEKKK−−−−−VT−−A−−−−−FD−−FFQD−−−−−−−−−−−−−−NGFGF−−−−−−−−−−−ITPYNLDDLNYYLD−−−−SFE−−−−−−−NDSDEIVTASLKIAKD−−RNKVT−−WG−−−Y−−−−−−−AKSILNTWLNAN−−LKS−−−−−−−−−−−−−−−−−−−−−−−−IEQVRA
fig|565643.5.peg.1596   Enterococcus faecalis DS5                                                                       KSTTK−−−−−−−−−−−−−−−−−−−−−−−−−−−YSVISINNWDDYQASEHQVNNKRTTSEQQVH−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TYKNEKNDKNEKNIN−−−−N−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NNKG−−−−−SS−−I−−−−−RS−−IWEN−−−−−−−−−−−−−−NGFGP−−−−−−−−−−−MSSKTMTDFDYWIS−−−−DFEKIGASQKDAEQLIIKAIEIAID−−ANARN−−YN−−−Y−−−−−−−INAILIDWERRG−−FKS−−−−−−−−−−−−−−−−−−−−−−−−VEEREA
fig|565647.5.peg.2056   Enterococcus faecalis E1Sol                                                              FEKEGMLNIKSTTK−−−−−−−−−−−−−−−−−−−−−−−−−−−YSVISINNWDDYQASEHQVNIKRTTSEQQVH−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TNKNEKNDKNEKNVV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VVEEQ−−−−−QS−−V−−−−−FQ−−LYQS−−−−−−−−−−−−−−−IFGM−−−−−−−−−−−LNSVTTQNLEYWCN−−−−DLS−−−−−−−−−−TELVSEALKISAK−−SNARN−−FK−−−Y−−−−−−−TESILRNWEQEG−−VKT−−−−−−−−−−−−−−−−−−−−−−−−LDDVKA
fig|212717.1.peg.944   Clostridium tetani E88       QSRKILLGNELI−−−−−−−−−−−EIKRGSTHASELKLMDRWNWSKKKVRNFLQLLEKDNMIICEKSKK−−−−−−−−−−−−−−−−−−−−−−−−−−−GTTITIINYEVYQGSRN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−HRETIKEPQGNHKETIK−−−−ELLGDHKGYTNNNDNNYNNIN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NDNNSSGSTPN−−Y−−−−−IE−−FFNS−−−−−−−−−−−−−−NFHL−−−−−−−−−−−INSYEINILNSFVKD−−−GLS−−−−−−−−−−EEVILLALKKAVE−−NNVRT−−IK−−−Y−−−−−−−VKSILQNWLENN−−IKT−−−−−−−−−−−−−−−−−−−−−−−−VEGVKA
fig|212717.1.peg.1923   Clostridium tetani E88                                   SFITSQKKLMERWGWGSEKTRTFLKLLDSDGMIKFQPDKK−−−−−−−−−−−−−−−−−−−−−−−−−−−KTTIIILNYDRYQKQNGFNADIPTDSENMQN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DNRTQTECNQNDSRTSA−−−−E−−−−−−−−TNNNDNNYNNIN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NDNNSSGSTPN−−Y−−−−−IE−−FFNS−−−−−−−−−−−−−−NFHM−−−−−−−−−−−ISSYELEVLRSYEKD−−−GLS−−−−−−−−−−EEVILLALKKAVE−−NNVRT−−IK−−−Y−−−−−−−VKSILQNWLENN−−IKT−−−−−−−−−−−−−−−−−−−−−−−−VEGVKA
fig|1245029.3.peg.5003   Bacillus anthracis str. Carbosap                                       SYQQFADSFGFTKRQVKDACDYLKDRRLVHIEFRTIFVNGTRCNNVMFIEP−−−IPEEIQKISILYWENGTPP−−−−−−−−−−−TLERKRV−−−−−LQQNEPPS−−−−−−−−−−−−−−−−−YDKKEEPPTFKRKTNTENTTK−−−−NTT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ENVSS−−−−−SS−−I−−−−−FS−−FYEN−−−−−−−−−−−−−−NFGI−−−−−−−−−−−LNSFIAENISQWVN−−−−DTS−−−−−−−−−−EELVQAAMERALK−−QQKK−−WN−−−Y−−−−−−−AEGILKQWVNNN−−VKT−−−−−−−−−−−−−−−−−−−−−−−−LKDVDA
fig|191218.6.peg.5779   Bacillus anthracis str. A2012                                       SYQQFADSFGFTKRQVKDACDYLKDRRLVHIEFRTIFVNGTRCNNVMFIEP−−−IPEEIQKISILYWENGTPP−−−−−−−−−−−TLERKRV−−−−−LQQNEPPS−−−−−−−−−−−−−−−−−YDKKEEPPTFKRKTNTENTTK−−−−NTT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ENVSS−−−−−SS−−I−−−−−FS−−FYEN−−−−−−−−−−−−−−NFGI−−−−−−−−−−−LNSFIAENISQWVN−−−−DTS−−−−−−−−−−EELVQAAMERALK−−QQKK−−WN−−−Y−−−−−−−AEGILKQWVNNN−−VKT−−−−−−−−−−−−−−−−−−−−−−−−LKDVDA
fig|280477.3.peg.5105   Bacillus anthracis str. Australia 94                                       SYQQFADSFGFTKRQVKDACDYLKDRRLVHIEFRTIFVNGTRCNNVMFIEP−−−IPEEIQKISILYWENGTPP−−−−−−−−−−−TLERKRV−−−−−LQQNEPPS−−−−−−−−−−−−−−−−−YDKKEEPPTFKRKTNTENTTK−−−−NTT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ENVSS−−−−−SS−−I−−−−−FS−−FYEN−−−−−−−−−−−−−−NFGI−−−−−−−−−−−LNSFIAENISQWVN−−−−DTS−−−−−−−−−−EELVQAAMERALK−−QQKK−−WN−−−Y−−−−−−−AEGILKQWVNNN−−VKT−−−−−−−−−−−−−−−−−−−−−−−−LKDVDA
fig|280355.3.peg.4061   Bacillus anthracis str. A1055                                       SYQQFADSFGFTKRQVKDACDYLKDRRLVHIEFRTIFVNGTRCNNVMFIEP−−−IPEEIQKISILYWENGTPP−−−−−−−−−−−TLERKRV−−−−−LQQNELPS−−−−−−−−−−−−−−−−−YDKKEEPPTFKRKTNTENTTK−−−−NTT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ENVSS−−−−−SS−−I−−−−−FS−−FYEN−−−−−−−−−−−−−−NFGI−−−−−−−−−−−LNSFIAENISQWVN−−−−DTS−−−−−−−−−−EELVQAAMERALK−−QQKK−−WN−−−Y−−−−−−−AEGILKQWVNNN−−VKT−−−−−−−−−−−−−−−−−−−−−−−−LKDVDA
fig|280355.4.peg.4176   Bacillus anthracis str. A1055                                       SYQQFADSFGFTKRQVKDACDYLKDRRLVHIEFRTIFVNGTRCNNVMFIEP−−−IPEEIQKISILYWENGTPP−−−−−−−−−−−TLERKRV−−−−−LQQNELPS−−−−−−−−−−−−−−−−−YDKKEEPPTFKRKTNTENTTK−−−−NTT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ENVSS−−−−−SS−−I−−−−−FS−−FYEN−−−−−−−−−−−−−−NFGI−−−−−−−−−−−LNSFIAENISQWVN−−−−DTS−−−−−−−−−−EELVQAAMERALK−−QQKK−−WN−−−Y−−−−−−−AEGILKQWVNNN−−VKT−−−−−−−−−−−−−−−−−−−−−−−−LKDVDA
fig|261591.3.peg.5302   Bacillus anthracis str. Vollum                                       SYQQFADSFGFTKRQVKGACDYLKDRRLVHIEFRTIFVNGTRCNNVMFIEP−−−IPEEIQKISILYWENGTPP−−−−−−−−−−−TLERKRV−−−−−LQQNEPPS−−−−−−−−−−−−−−−−−YDKKEEPPTFKRKTNTENTTK−−−−NTT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ENVSS−−−−−SS−−I−−−−−FS−−FYEN−−−−−−−−−−−−−−NFGI−−−−−−−−−−−LNSFIAENISQWVN−−−−DTS−−−−−−−−−−EELVQAAMERALK−−QQKK−−WN−−−Y−−−−−−−AEGILKQWVNNN−−VKT−−−−−−−−−−−−−−−−−−−−−−−−LKDVDA
fig|486624.3.peg.2716   Bacillus anthracis str. A0488                                       SYQQFADSFGFTKRQVKGACDYLKDRRLVHIEFRTIFVNGTRCNNVMFIEP−−−IPEEIQKISILYWENGTPP−−−−−−−−−−−TLERKRV−−−−−LQQNEPPS−−−−−−−−−−−−−−−−−YDKKEEPPTFKRKTNTENTTK−−−−NTT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ENVSS−−−−−SS−−I−−−−−FS−−FYEN−−−−−−−−−−−−−−NFGI−−−−−−−−−−−LNSFIAENISQWVN−−−−DTS−−−−−−−−−−EELVQAAMERALK−−QQKK−−WN−−−Y−−−−−−−AEGILKQWVNNN−−VKT−−−−−−−−−−−−−−−−−−−−−−−−LKDVDA
fig|1053214.3.peg.2462   Bacillus cereus IS845/00                                       SYQQFADSFGFTKRQVKDACDYLKDRRLVRIEFRTVFVNGTRCNNVMFIEP−−−IPEEIQKISILYWENGTPP−−−−−−−−−−−TLERKRV−−−−−LQPNVPPS−−−−−−−−−−−−−−−−−YDKTEEPPTFKRKTNTKITTK−−−−NTT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ENVSS−−−−−SS−−I−−−−−FS−−FYEN−−−−−−−−−−−−−−NFGI−−−−−−−−−−−LNSFVAENISQWIN−−−−DTN−−−−−−−−−−EELVQAAMERALK−−QQKK−−WN−−−Y−−−−−−−AEGILKQWVNNN−−VKT−−−−−−−−−−−−−−−−−−−−−−−−LKDVDA
fig|526975.3.peg.4898   Bacillus cereus BDRD-ST26                                       SYQQFADSFGFTKRQVKDACDYLKDRRLVRIEFRTVFVNGTRCNNVMFIEP−−−IPEEIQKISILYWENGTPP−−−−−−−−−−−TLERKRV−−−−−LQPNVPPS−−−−−−−−−−−−−−−−−YDKTEEPPTFKRKTNTKITTK−−−−NTT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ENVSS−−−−−SS−−I−−−−−FS−−FYEN−−−−−−−−−−−−−−NFGI−−−−−−−−−−−LNSFVAENISQWIN−−−−DTN−−−−−−−−−−EELVQAAMERALK−−QQKK−−WN−−−Y−−−−−−−AEGILKQWVNNN−−VKT−−−−−−−−−−−−−−−−−−−−−−−−LKDVDA
fig|527028.3.peg.3775   Bacillus thuringiensis serovar pulsiensis BGSC 4CC1                                         QQLADTFGFTKLQVKRACDLLTDMLLIKIEFRTINADGKILNNVMFVEP−−−VPTEIKKISSMYQQIEEDPG−−−−−−−−−−−YLEVNRV−−−−−VTSKSRPS−−−−−−−−−−−−−−−−−SLTSKESPNFKVKTNTEITTK−−−−ITT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ENVS−−−−−SS−−I−−−−−FS−−FYEN−−−−−−−−−−−−−−NFGI−−−−−−−−−−−LNSFIAENISQWVN−−−−DTS−−−−−−−−−−EELVQAAMERALK−−QQKK−−WN−−−Y−−−−−−−AEGILKQWVNNN−−VKT−−−−−−−−−−−−−−−−−−−−−−−−LKDVDA
fig|315749.8.peg.2761   Bacillus cytotoxicus NVH 391-98                                         QQLADTFGFSKLQVKRACDLLTDMLLIKIEFRTINVDGKVLNNVMFVEP−−−VASEIKKISSMYQQIEIDPP−−−−−−−−−−−YFEVKRD−−−−−PTSKLPPS−−−−−−−−−−−−−−−−−LLESKDPPYFEVRTNTENTTE−−−−ITTNIDDD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DN−−P−−−−−HP−−LIDL−−−−−−−−−−−−−−QFKNSLEHLMKNSIPLSVIAEQELGEFCD−−−−LFG−−−−−−−−−−SELVNAAVDKALD−−ENAPR−−WT−−−Y−−−−−−−IRTILSNWQKNN−−VKT−−−−−−−−−−−−−−−−−−−−−−−−LADVIK
fig|315749.4.peg.2676   Bacillus cereus subsp. cytotoxis NVH 391-98                                         QQLADTFGFSKLQVKRACDLLTDMLLIKIEFRTINVDGKVLNNVMFVEP−−−VASEIKKISSMYQQIEIDPP−−−−−−−−−−−YFEVKRD−−−−−PTSKLPPS−−−−−−−−−−−−−−−−−LLESKDPPYFEVRTNTENTTE−−−−ITTNIDDD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DN−−P−−−−−HP−−LIDL−−−−−−−−−−−−−−QFKNSLEHLMKNSIPLSVIAEQELGEFCD−−−−LFG−−−−−−−−−−SELVNAAVDKALD−−ENAPR−−WT−−−Y−−−−−−−IRTILSNWQKNN−−VKT−−−−−−−−−−−−−−−−−−−−−−−−LADVIK
fig|526983.3.peg.1425   Bacillus cereus Rock3-28                                       SYQQLADSFGFTKRQVKEACDFLKERGLIKIEFRTIVVNGTRCNNVMYVEP−−−IPEIIQKISVMYWGNDTPPTLKRDSPI−−−−TSESKRV−−−−−LHFKGTPS−−−−−−−−−−−−−−−−−YDETEEALTLERKTNTEITTNITTEITTNIN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DDNA−−−−−TS−−S−−−−−QK−−LIDQ−−−−−−−−−−−−−−EFKISYNFLLKQGIPLSEIAIQELGEFCD−−−−RFG−−−−−−−−−−NELITHAVNKAID−−ENVPK−−WR−−−Y−−−−−−−IRSILSSWEKEK−−VKT−−−−−−−−−−−−−−−−−−−−−−−−LNDVAA
fig|526984.3.peg.2764   Bacillus cereus Rock3-29                                       SYQQLADSFGFTKRQVKEACDFLKERGLIKIEFRTIVVNGTRCNNVMYVEP−−−IPEIIQKISVMYWGNDTPPTLKRNSPI−−−−TSESKRV−−−−−LHSKGTPS−−−−−−−−−−−−−−−−−YDETEEALTLERKTNTEITTNITTEITTNIND−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DDNT−−−−−TS−−S−−−−−QK−−LIDQ−−−−−−−−−−−−−−EFKISYNFLLKQGIPLSEIAIQELGEFCD−−−−RFG−−−−−−−−−−NELITHAVNKAID−−ENVPK−−WR−−−Y−−−−−−−IRSILSSWEKAK−−VKT−−−−−−−−−−−−−−−−−−−−−−−−LNDVAA
fig|527019.3.peg.334   Bacillus thuringiensis IBL 200                                       SYQQLADSFGFTKRQVKEACDFLKERGLIKIEFRTILVNGTRCNNVMYVEP−−−VPEMIQKISIMYWGNGNPPTLKSNSPV−−−−TLESKRV−−−−−LHSKAIPF−−−−−−−−−−−−−−−−−YDKTEESLTLERKTNTEITTNITTGITTNVN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DDDA−−−−−−−−−S−−−−−QK−−LIDQ−−−−−−−−−−−−−−EFKISYNFLLKKGIPLSEIAIQELGEFCD−−−−RFG−−−−−−−−−−NELVIHAVNKAID−−ENVPK−−WR−−−Y−−−−−−−IRSILSSWEKEK−−VKT−−−−−−−−−−−−−−−−−−−−−−−−LNDVAA
fig|405531.7.peg.2455   Bacillus cereus G9842                                       SYQQLADSFGFTKRQVKEACDFLKERELIKIEFRTILVNGTRCNNVMYVEP−−−VPEMIQKISIMYWGNGNPPTLKSNSPV−−−−TLESKRV−−−−−LHSKVIPS−−−−−−−−−−−−−−−−−YDKTEESLTLERKTNTEITTNITTEITTNIN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DDA−−−−−TS−−S−−−−−QK−−LIDQ−−−−−−−−−−−−−−EFKISYNFLLEKGIPLSEIAIQELGEFCD−−−−RFG−−−−−−−−−−NELVIHAVNKAID−−ENVPK−−WR−−−Y−−−−−−−IRSILSSWEKEK−−VKT−−−−−−−−−−−−−−−−−−−−−−−−LNDVAA
fig|714359.3.peg.2486   Bacillus thuringiensis BMB171                                       SYQQLADSFGFTKRQVKEACDFLKERGLIKIEFRTILVNGTRCNNVMYVEP−−−VPEMIQKISIMYWGNANPPTLKSNSPI−−−−TLESKSV−−−−−LHSKAIPS−−−−−−−−−−−−−−−−−