(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00004829

fig|391295.7.peg.1107   Streptococcus suis 05ZYH33       KRARLIYNPTSGQE−−−I−−MKKNVAEVLEIL−−−−−−EGYGYETSAFQTT−−−A−−EKDSAK−−−−−−NEATR−−−−−AALA−−−−−−−−−G−−−−−−F−−−−−−DLIIAAGGDGTINEVVNGI−−AP−−LE−−−KR−−−−−−−−PQ−−−MAIIPTGTTND−−−−YAR−−−A−−LK−−VP−−−R−−−GNPVEAAKVIGK−−−−−−−−Q−−−QT−−−−−ILMDI−−−−−−−−−GLAKNQKNG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FH−−−−−−−−−−−−−−−−−−−−−QEH−−−YFINIAAAG−−TLTELTY−−−S−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPSQLKT−−−−−MF−−GYLAYVV−−−K−−−−−−−−−−−GAEL−−−−−−−−−−−−LPQV−−−−−−−−QFTPVRVEH−−−−−−−−−−DEG−−−−−−VFE−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SVS−−MI−−−−−−−−−−−−−−−−−FVALTN−−SIGGFEQ−−−−−−−−−−IV−−−−−−−−−−−−−−P−−−−−−DAKL−−−−DDGNFTLLMVK−−−−−−−−−−−−−−−−−−−−−−−TGNL−−−−−−−−−FEILHLIRQ−−−−−−−−−−−−−−−−VLDGGKH−−−−IESDLVEYIKTKSLSIENLNPDNRLLLNLDGEFG                                          
fig|1246365.4.peg.1102   Streptococcus suis SC070731       KRARLIYNPTSGQE−−−I−−MKKNVAEVLEIL−−−−−−EGYGYETSAFQTT−−−A−−EKDSAK−−−−−−NEATR−−−−−AALA−−−−−−−−−G−−−−−−F−−−−−−DLIIAAGGDGTINEVVNGI−−AP−−LE−−−KR−−−−−−−−PQ−−−MAIIPTGTTND−−−−YAR−−−A−−LK−−VP−−−R−−−GNPVEAAKVIGK−−−−−−−−Q−−−QT−−−−−ILMDI−−−−−−−−−GLAKNQKNG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FH−−−−−−−−−−−−−−−−−−−−−QEH−−−YFINIAAAG−−TLTELTY−−−S−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPSQLKT−−−−−MF−−GYLAYVV−−−K−−−−−−−−−−−GAEL−−−−−−−−−−−−LPQV−−−−−−−−QFTPVRVEH−−−−−−−−−−DEG−−−−−−VFE−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SVS−−MI−−−−−−−−−−−−−−−−−FVALTN−−SIGGFEQ−−−−−−−−−−IV−−−−−−−−−−−−−−P−−−−−−DAKL−−−−DDGNFTLLMVK−−−−−−−−−−−−−−−−−−−−−−−TGNL−−−−−−−−−FEILHLIRQ−−−−−−−−−−−−−−−−VLDGGKH−−−−IESDLVEYIKTKSLSIENLNPDNRLLLNLDGEFG                                          
fig|1005042.3.peg.1298   Streptococcus suis D9       KRARLIYNPTSGQE−−−I−−MKKNVAEVLEIL−−−−−−EGYGYETSAFQTT−−−A−−EKDSAK−−−−−−NEATR−−−−−AALA−−−−−−−−−D−−−−−−F−−−−−−DLIIAAGGDGTINEVVNGI−−AP−−LE−−−KR−−−−−−−−PQ−−−MAIIPTGTTND−−−−YAR−−−A−−LK−−VP−−−R−−−GNPVEAAKVIGK−−−−−−−−Q−−−QT−−−−−ILMDI−−−−−−−−−GLAKNQKNG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FH−−−−−−−−−−−−−−−−−−−−−QEH−−−YFINIAAAG−−TLTELTY−−−S−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPSQLKT−−−−−MF−−GYLAYVV−−−K−−−−−−−−−−−GAEL−−−−−−−−−−−−LPQV−−−−−−−−QFTPVRVEH−−−−−−−−−−DEG−−−−−−VFE−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SVS−−MI−−−−−−−−−−−−−−−−−FVALTN−−SIGGFEQ−−−−−−−−−−IV−−−−−−−−−−−−−−P−−−−−−DAKL−−−−DDGNFTLLMVK−−−−−−−−−−−−−−−−−−−−−−−TGNL−−−−−−−−−FEILHLIRQ−−−−−−−−−−−−−−−−VLDGGKH−−−−IESDLVEYIKTKSLSIENLNPDNRLLLNLDGEFG                                          
fig|1007064.3.peg.1175   Streptococcus suis ST3       KRARLIYNPTSGQE−−−I−−MKKNVAEVLEIL−−−−−−EGYGYETSAFQTT−−−A−−EKDSAK−−−−−−NEATR−−−−−AALA−−−−−−−−−D−−−−−−F−−−−−−DLIIAAGGDGTINEVVNGI−−AP−−LE−−−KR−−−−−−−−PQ−−−MAIIPTGTTND−−−−YAR−−−A−−LK−−VP−−−R−−−GNPVEAAKVIGK−−−−−−−−Q−−−QT−−−−−ILMDI−−−−−−−−−GLAKNQKNG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FH−−−−−−−−−−−−−−−−−−−−−QEH−−−YFINIAAAG−−TLTELTY−−−S−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPSQLKT−−−−−MF−−GYLAYVV−−−K−−−−−−−−−−−GAEL−−−−−−−−−−−−LPQV−−−−−−−−QFTPVRVEH−−−−−−−−−−DEG−−−−−−VFE−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SVS−−MI−−−−−−−−−−−−−−−−−FVALTN−−SIGGFEQ−−−−−−−−−−IV−−−−−−−−−−−−−−P−−−−−−DAKL−−−−DDGNFTLLMVK−−−−−−−−−−−−−−−−−−−−−−−TGNL−−−−−−−−−FEILHLIRQ−−−−−−−−−−−−−−−−VLDGGKH−−−−IESDLVEYIKTKSLSIENLNPDNRLLLNLDGEFG                                          
fig|1105273.3.peg.2001   Streptococcus agalactiae LMG 15083       KKARLIYNPTSGQE−−−I−−MKKNVAEVLDIL−−−−−−EGFGYETSAFQTT−−−P−−TKNSAR−−−−−−DEATR−−−−−AAQA−−−−−−−−−G−−−−−−F−−−−−−DLIVAAGGDGTINEVVNGI−−AP−−LK−−−RR−−−−−−−−PK−−−MAIIPTGTTND−−−−FAR−−−A−−LK−−IP−−−R−−−GNPIEATKLIGK−−−−−−−−N−−−QI−−−−−VKMDI−−−−−−−−−GQAQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EDN−−−YFINIAAAG−−SLTELTY−−−S−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPSQLKT−−−−−TF−−GYLAYLA−−−K−−−−−−−−−−−GVEL−−−−−−−−−−−−LPRV−−−−−−−−RKVPVKITH−−−−−−−−−−DKG−−−−−−EFI−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DAS−−MI−−−−−−−−−−−−−−−−−FVAITN−−SVGGFEQ−−−−−−−−−−IA−−−−−−−−−−−−−−P−−−−−−DAKL−−−−DDGKFTLILVK−−−−−−−−−−−−−−−−−−−−−−−TANL−−−−−−−−−IEIMHLIRL−−−−−−−−−−−−−−−−VLAGGKH−−−−INDKRVEYIKTSYLTIEPLSDERMMINLDGEYG                                          
fig|208435.3.peg.857   Streptococcus agalactiae 2603V/R       KKARLIYNPTSGQE−−−I−−MKKNVAEVLDIL−−−−−−EGFGYETSAFQTT−−−P−−TKNSAR−−−−−−DEATR−−−−−AAQA−−−−−−−−−G−−−−−−F−−−−−−DLIVAAGGDGTINEVVNGI−−AP−−LK−−−RR−−−−−−−−PK−−−MAIIPTGTTND−−−−FAR−−−A−−LK−−IP−−−R−−−GNPIEATKLIGK−−−−−−−−N−−−QI−−−−−VKMDI−−−−−−−−−GQAQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EDN−−−YFINIAAAG−−SLTELTY−−−S−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPSQLKT−−−−−TF−−GYLAYLA−−−K−−−−−−−−−−−GVEL−−−−−−−−−−−−LPRV−−−−−−−−RKVPVKITH−−−−−−−−−−DKG−−−−−−EFI−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DAS−−MI−−−−−−−−−−−−−−−−−FVAITN−−SVGGFEQ−−−−−−−−−−IA−−−−−−−−−−−−−−P−−−−−−DAKL−−−−DDGKFTLILVK−−−−−−−−−−−−−−−−−−−−−−−TANL−−−−−−−−−IEIMHLIRL−−−−−−−−−−−−−−−−VLAGGKH−−−−INDKRVEYIKTSYLTIEPLSDERMMINLDGEYG                                          
fig|1105231.3.peg.1605   Streptococcus agalactiae BSU260       KKARLIYNPTSGQE−−−I−−MKKNVAEVLDIL−−−−−−EGFGYETSAFQTT−−−P−−TKNSAR−−−−−−DEAAR−−−−−AAQA−−−−−−−−−G−−−−−−F−−−−−−DLIVAAGGDGTINEVVNGI−−AP−−LK−−−RR−−−−−−−−PK−−−MAIIPTGTTND−−−−FAR−−−A−−LK−−IP−−−R−−−GNPIEATKLIGK−−−−−−−−N−−−QI−−−−−VKMDI−−−−−−−−−GQAQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EDN−−−YFINIAAAG−−SLTELTY−−−S−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPSQLKT−−−−−TF−−GYLAYLA−−−K−−−−−−−−−−−GVEL−−−−−−−−−−−−LPRV−−−−−−−−RKVPVKITH−−−−−−−−−−DKG−−−−−−EFI−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DAS−−MI−−−−−−−−−−−−−−−−−FVAITN−−SVGGFEQ−−−−−−−−−−IA−−−−−−−−−−−−−−P−−−−−−DAKL−−−−DDGKFTLILVK−−−−−−−−−−−−−−−−−−−−−−−TANL−−−−−−−−−IEIMHLIRL−−−−−−−−−−−−−−−−VLAGGKH−−−−INDKRVEYIKTSYLTIEPLSDERMMINLDGEYG                                          
fig|379360.3.peg.837   Oenococcus oeni ATCC BAA-1163       KRARIVYNPSSGRE−−−A−−IQRDLLKIMKVY−−−−−−ERAGYETSVYETT−−−P−−KAFSAR−−−−−−DEAKR−−−−−AAQA−−−−−−−−−G−−−−−−F−−−−−−DLIVAAGGDGTVNEVVNGI−−SL−−LK−−−KR−−−−−−−−PL−−−MAVIPSGTTND−−−−YAR−−−A−−LK−−IP−−−R−−−DDLVEAAKVINK−−−−−−−−H−−−ET−−−−−LKMDI−−−−−−−−−GEITSGNS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RLN−−−YFMNIGALG−−TLSELTY−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPSMLKT−−−−−LY−−GYLAYIT−−−K−−−−−−−−−−−GAEL−−−−−−−−−−−−ITRI−−−−−−−−QSVPVRITY−−−−−−−−−−DEG−−−−−−KFE−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QVS−−LI−−−−−−−−−−−−−−−−−LLALTN−−SVGGFEK−−−−−−−−−−IV−−−−−−−−−−−−−−P−−−−−−DAKL−−−−DDGKFSLLIVE−−−−−−−−−−−−−−−−−−−−−−−KSNI−−−−−−−−−AQLFNLITK−−−−−−−−−−−−−−−−ALNNGSH−−−−IKDKLITYIKTSKVKVEPLSNDKMKVNLDGEFG                                          
fig|1167631.3.peg.1162   Oenococcus oeni AWRIB318       KRARIVYNPSSGRE−−−A−−IQRDLLKIMKVY−−−−−−ERAGYETSVYETT−−−P−−KAFSAR−−−−−−DEAKR−−−−−AAQA−−−−−−−−−G−−−−−−F−−−−−−DLIVAAGGDGTVNEVVNGI−−SP−−LK−−−KR−−−−−−−−PL−−−MAVIPSGTTND−−−−YAR−−−A−−LK−−IP−−−R−−−DDLVEAAKVINK−−−−−−−−H−−−ET−−−−−LKMDI−−−−−−−−−GEITSGNS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RLN−−−YFMNIGALG−−TLSELTY−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPSMLKT−−−−−LY−−GYLAYIT−−−K−−−−−−−−−−−GAEL−−−−−−−−−−−−ITRI−−−−−−−−QSVPVRITY−−−−−−−−−−DEG−−−−−−KFE−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QVS−−LI−−−−−−−−−−−−−−−−−LLALTN−−SVGGFEK−−−−−−−−−−IV−−−−−−−−−−−−−−P−−−−−−DAKL−−−−DDGKFSLLIVE−−−−−−−−−−−−−−−−−−−−−−−KSNI−−−−−−−−−AQLFNLITK−−−−−−−−−−−−−−−−ALNNGSH−−−−IKDKLITYIKTSKVKVEPLSNDKMKVNLDGEFG                                          
fig|203123.7.peg.1708   Oenococcus oeni PSU-1       KRARIVYNPSSGRE−−−A−−IQRDLLKIMKVY−−−−−−ERAGYETSVYETT−−−P−−KAFSAR−−−−−−DEAKR−−−−−AAQA−−−−−−−−−G−−−−−−F−−−−−−DLIVAAGGDGTVNEVVNGI−−SP−−LK−−−KR−−−−−−−−PL−−−MAVIPSGTTND−−−−YAR−−−A−−LK−−IP−−−R−−−DDLVEAAKVINK−−−−−−−−H−−−ET−−−−−LKMDI−−−−−−−−−GEITSGNS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RLN−−−YFMNIGALG−−TLSELTY−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPSMLKT−−−−−LY−−GYLAYIT−−−K−−−−−−−−−−−GAEL−−−−−−−−−−−−ITRI−−−−−−−−QSVPVRITY−−−−−−−−−−DEG−−−−−−KFE−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QVS−−LI−−−−−−−−−−−−−−−−−LLALTN−−SVGGFEK−−−−−−−−−−IV−−−−−−−−−−−−−−P−−−−−−DAKL−−−−DDGKFSLLIVE−−−−−−−−−−−−−−−−−−−−−−−KSNI−−−−−−−−−AQLFNLITK−−−−−−−−−−−−−−−−ALNNGSH−−−−IKDKLITYIKTSKVKVEPLSNDKMKVNLDGEFG                                          
fig|1203259.4.peg.1317   Lactobacillus rhamnosus LRHMDP3       KRARLIYNPTSGNE−−−G−−LKRFVPDILNIM−−−−−−EQAGYESSTFQTT−−−P−−KPFSAR−−−−−−EEAKR−−−−−ATEA−−−−−−−−−G−−−−−−F−−−−−−ELIVAAGGDGTINEVVNGI−−AP−−AK−−−KR−−−−−−−−PK−−−MAIIPAGTTND−−−−YAR−−−A−−LR−−IS−−−R−−−DDPVEAARVILK−−−−−−−−G−−−QT−−−−−LAMDI−−−−−−−−−GQA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NHH−−−YFMNIAAGG−−LLSELTY−−−S−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPSEVKS−−−−−IF−−GYFAYVI−−−K−−−−−−−−−−−GAEM−−−−−−−−−−−−LPAV−−−−−−−−RTMPMKLEY−−−−−−−−−−DGG−−−−−−VYD−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PAS−−MF−−−−−−−−−−−−−−−−−FLGLTN−−SVGGFEQ−−−−−−−−−−IV−−−−−−−−−−−−−−P−−−−−−DAEL−−−−GDGKFSLIIVK−−−−−−−−−−−−−−−−−−−−−−−TANM−−−−−−−−−ANLLKLMAL−−−−−−−−−−−−−−−−VFNGGRH−−−−VDDPNIVYTKTKKLKVKTSGQDTLKINLDGEYG                                          
fig|568703.9.peg.960   Lactobacillus rhamnosus GG       KRARLIYNPTSGNE−−−G−−LKRFVPDILNIM−−−−−−EQAGYESSTFQTT−−−P−−KPFSAR−−−−−−EEAKR−−−−−ATEA−−−−−−−−−G−−−−−−F−−−−−−ELIVAAGGDGTINEVVNGI−−AP−−AK−−−KR−−−−−−−−PK−−−MAIIPAGTTND−−−−YAR−−−A−−LR−−IS−−−R−−−DDPVEAARVILK−−−−−−−−G−−−QT−−−−−LAMDI−−−−−−−−−GQA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NHH−−−YFMNIAAGG−−LLSELTY−−−S−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPSEVKS−−−−−IF−−GYFAYVI−−−K−−−−−−−−−−−GAEM−−−−−−−−−−−−LPAV−−−−−−−−RTMPMKLEY−−−−−−−−−−DGG−−−−−−VYD−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PAS−−MF−−−−−−−−−−−−−−−−−FLGLTN−−SVGGFEQ−−−−−−−−−−IV−−−−−−−−−−−−−−P−−−−−−DAEL−−−−GDGKFSLIIVK−−−−−−−−−−−−−−−−−−−−−−−TANM−−−−−−−−−ANLLKLMAL−−−−−−−−−−−−−−−−VFNGGRH−−−−VDDPNIVYTKTKKLKVKTSGQDTLKINLDGEYG                                          
fig|1088720.3.peg.1003   Lactobacillus rhamnosus ATCC 8530       KRARLIYNPTSGNE−−−G−−LKRFVPDILNIM−−−−−−EQAGYESSAFQTT−−−P−−KPFSAR−−−−−−EEAKR−−−−−ATEA−−−−−−−−−G−−−−−−F−−−−−−ELIVAAGGDGTINEVVNGI−−AP−−AK−−−KR−−−−−−−−PK−−−MAIIPAGTTND−−−−YAR−−−A−−LR−−IS−−−R−−−DDPVEAARVILK−−−−−−−−G−−−QT−−−−−LAMDI−−−−−−−−−GQA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NHH−−−YFMNIAAGG−−LLSELTY−−−S−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPSEVKS−−−−−IF−−GYFAYVI−−−K−−−−−−−−−−−GAEM−−−−−−−−−−−−LPAV−−−−−−−−RTMPMKLEY−−−−−−−−−−DGG−−−−−−VYD−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PAS−−MF−−−−−−−−−−−−−−−−−FLGLTN−−SVGGFEQ−−−−−−−−−−IV−−−−−−−−−−−−−−P−−−−−−DAEL−−−−GDGKFSLIIVK−−−−−−−−−−−−−−−−−−−−−−−TANM−−−−−−−−−ANLLKLMAL−−−−−−−−−−−−−−−−VFNGGRH−−−−VDDPNIVYTKTKKLKVKTSGQDTLKINLDGEYG                                          
fig|486408.6.peg.501   Lactobacillus rhamnosus HN001       KRARLIYNPTSGNE−−−G−−LKRFVPDILNIM−−−−−−EQAGYESSAFQTT−−−P−−KPFSAR−−−−−−EEAKR−−−−−ATEA−−−−−−−−−G−−−−−−F−−−−−−ELIVAAGGDGTINEVVNGI−−AP−−AK−−−KR−−−−−−−−PK−−−MAIIPAGTTND−−−−YAR−−−A−−LR−−IS−−−R−−−DDPVEAARVILK−−−−−−−−G−−−QT−−−−−LAMDI−−−−−−−−−GQA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NHH−−−YFMNIAAGG−−LLSELTY−−−S−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPSEVKS−−−−−IF−−GYFAYVI−−−K−−−−−−−−−−−GAEM−−−−−−−−−−−−LPAV−−−−−−−−RTMPMKLEY−−−−−−−−−−DGG−−−−−−VYD−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PAS−−MF−−−−−−−−−−−−−−−−−FLGLTN−−SVGGFEQ−−−−−−−−−−IV−−−−−−−−−−−−−−P−−−−−−DAEL−−−−GDGKFSLIIVK−−−−−−−−−−−−−−−−−−−−−−−TANM−−−−−−−−−ANLLKLMAL−−−−−−−−−−−−−−−−VFNGGRH−−−−VDDPNIVYTKTKKLKVKTSGQDTLKINLDGEYG                                          
fig|321967.8.peg.1019   Lactobacillus casei ATCC 334                                               QAGYESSTFQTT−−−P−−KPFSAR−−−−−−EEAKR−−−−−ATEA−−−−−−−−−G−−−−−−F−−−−−−DLIVAAGGDGTINEVVNGI−−AP−−AK−−−KR−−−−−−−−PK−−−MAIIPAGTTND−−−−YAR−−−A−−LR−−IS−−−R−−−DDPVEAAQVILK−−−−−−−−G−−−QT−−−−−LAMDI−−−−−−−−−GQA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NHH−−−YFMNIAAGG−−LLSELTY−−−S−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPSEVKS−−−−−IF−−GYFAYVI−−−K−−−−−−−−−−−GAEM−−−−−−−−−−−−LPAV−−−−−−−−RTVPMKLEY−−−−−−−−−−DGG−−−−−−VYD−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PAS−−MF−−−−−−−−−−−−−−−−−FLGLTN−−SVGGFEQ−−−−−−−−−−IV−−−−−−−−−−−−−−P−−−−−−DAAL−−−−GDGKFSLIIVK−−−−−−−−−−−−−−−−−−−−−−−TANM−−−−−−−−−ANLLKLMAL−−−−−−−−−−−−−−−−VFNGGRH−−−−VDDPNIIYTKTKKLRVKAGGDDPLKINLDGEYG                                          
fig|321967.11.peg.1032   Lactobacillus casei ATCC 334       KRARLIYNPTSGNE−−−G−−LKRFVPDILDIM−−−−−−EQAGYESSTFQTT−−−P−−KPFSAR−−−−−−EEAKR−−−−−ATEA−−−−−−−−−G−−−−−−F−−−−−−DLIVAAGGDGTINEVVNGI−−AP−−AK−−−KR−−−−−−−−PK−−−MAIIPAGTTND−−−−YAR−−−A−−LR−−IS−−−R−−−DDPVEAAQVILK−−−−−−−−G−−−QT−−−−−LAMDI−−−−−−−−−GQA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NHH−−−YFMNIAAGG−−LLSELTY−−−S−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPSEVKS−−−−−IF−−GYFAYVI−−−K−−−−−−−−−−−GAEM−−−−−−−−−−−−LPAV−−−−−−−−RTVPMKLEY−−−−−−−−−−DGG−−−−−−VYD−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PAS−−MF−−−−−−−−−−−−−−−−−FLGLTN−−SVGGFEQ−−−−−−−−−−IV−−−−−−−−−−−−−−P−−−−−−DAAL−−−−GDGKFSLIIVK−−−−−−−−−−−−−−−−−−−−−−−TANM−−−−−−−−−ANLLKLMAL−−−−−−−−−−−−−−−−VFNGGRH−−−−VDDPNIIYTKTKKLRVKAGGDDPLKINLDGEYG                                          
fig|1051659.3.peg.1116   Lactobacillus casei UCD174       KRARLIYNPTSGNE−−−G−−LKRFVPDILDIM−−−−−−EQAGYESSTFQTT−−−P−−KPFSAR−−−−−−EEAKR−−−−−ATEA−−−−−−−−−G−−−−−−F−−−−−−DLIVAAGGDGTINEVVNGI−−AP−−AK−−−KR−−−−−−−−PK−−−MAIIPAGTTND−−−−YAR−−−A−−LR−−IS−−−R−−−DDPVEAAQVILK−−−−−−−−G−−−QT−−−−−LAMDI−−−−−−−−−GQA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NHH−−−YFMNIAAGG−−LLSELTY−−−S−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPSEVKS−−−−−IF−−GYFAYVI−−−K−−−−−−−−−−−GAEM−−−−−−−−−−−−LPAV−−−−−−−−RTVPMKLEY−−−−−−−−−−DGG−−−−−−VYD−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PAS−−MF−−−−−−−−−−−−−−−−−FLGLTN−−SVGGFEQ−−−−−−−−−−IV−−−−−−−−−−−−−−P−−−−−−DAAL−−−−GDGKFSLIIVK−−−−−−−−−−−−−−−−−−−−−−−TANM−−−−−−−−−ANLLKLMAL−−−−−−−−−−−−−−−−VFNGGRH−−−−VDDPNIIYTKTKKLRVKAGGDDPLKINLDGEYG                                          
fig|525337.3.peg.391   Lactobacillus paracasei subsp. paracasei ATCC 25302       KRARLIYNPTSGNE−−−G−−LKRFVPDILDIM−−−−−−EQAGYESSTFQTT−−−P−−KPFSAR−−−−−−EEAKR−−−−−ATEA−−−−−−−−−G−−−−−−F−−−−−−DLIVAAGGDGTINEVVNGI−−AP−−AK−−−KR−−−−−−−−PK−−−MAIIPAGTTND−−−−YAR−−−A−−LR−−IS−−−R−−−DDPVEAAQVILK−−−−−−−−G−−−QT−−−−−LAMDI−−−−−−−−−GQA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NHH−−−YFMNIAAGG−−LLSELTY−−−S−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPSEVKS−−−−−IF−−GYFAYVI−−−K−−−−−−−−−−−GAEM−−−−−−−−−−−−LPAV−−−−−−−−RTVPMKLEY−−−−−−−−−−DGG−−−−−−VYD−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PAS−−MF−−−−−−−−−−−−−−−−−FLGLTN−−SVGGFEQ−−−−−−−−−−IV−−−−−−−−−−−−−−P−−−−−−DAAL−−−−GDGKFSLIIVK−−−−−−−−−−−−−−−−−−−−−−−TANM−−−−−−−−−ANLLKLMAL−−−−−−−−−−−−−−−−VFNGGRH−−−−VDDPNIIYTKTKKLRVKAGGDDPLKINLDGEYG                                          
fig|537973.8.peg.422   Lactobacillus paracasei subsp. paracasei 8700:2       KRARLIYNPTSGNE−−−G−−LKRFVPDILDIM−−−−−−EQAGYESSTFQTT−−−P−−KPFSAR−−−−−−EEAKR−−−−−ATEA−−−−−−−−−G−−−−−−F−−−−−−DLIVAAGGDGTINEVVNGI−−AP−−AK−−−KR−−−−−−−−PK−−−MAIIPAGTTND−−−−YAR−−−A−−LR−−IS−−−R−−−DDPVEAAQVILK−−−−−−−−G−−−QT−−−−−LAMDI−−−−−−−−−GQA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NHH−−−YFMNIAAGG−−LLSELTY−−−S−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPSEVKS−−−−−IF−−GYFAYVI−−−K−−−−−−−−−−−GAEM−−−−−−−−−−−−LPAV−−−−−−−−RTVPMKLEY−−−−−−−−−−DGG−−−−−−VYD−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PAS−−MF−−−−−−−−−−−−−−−−−FLGLTN−−SVGGFEQ−−−−−−−−−−IV−−−−−−−−−−−−−−P−−−−−−DAAL−−−−GDGKFSLIIVK−−−−−−−−−−−−−−−−−−−−−−−TANM−−−−−−−−−ANLLKLMAL−−−−−−−−−−−−−−−−VFNGGRH−−−−VDDPNIIYTKTKKLRVKAGGDDPLKINLDGEYG                                          
fig|543734.4.peg.1142   Lactobacillus casei BL23       KRARLIYNPTSGNE−−−G−−LKRFVPDILDIM−−−−−−EQAGYESSTFQTT−−−P−−KPFSAR−−−−−−EEAKR−−−−−ATEA−−−−−−−−−G−−−−−−F−−−−−−DLIVAAGGDGTINEVVNGI−−AP−−AK−−−KR−−−−−−−−PK−−−MAIIPAGTTND−−−−YAR−−−A−−LR−−IS−−−R−−−DDPVEAAQVILK−−−−−−−−G−−−QT−−−−−LAMDI−−−−−−−−−GQA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NHH−−−YFMNIAAGG−−LLSELTY−−−S−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPSEVKS−−−−−IF−−GYFAYVI−−−K−−−−−−−−−−−GAEM−−−−−−−−−−−−LPAV−−−−−−−−RTVPMKLEY−−−−−−−−−−DGG−−−−−−VYD−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PAS−−MF−−−−−−−−−−−−−−−−−FLGLTN−−SVGGFEQ−−−−−−−−−−IV−−−−−−−−−−−−−−P−−−−−−DAAL−−−−GDGKFSLIIVK−−−−−−−−−−−−−−−−−−−−−−−TANM−−−−−−−−−ANLLKLMAL−−−−−−−−−−−−−−−−VFNGGRH−−−−VDDPNIIYTKTKKLRVKAGGDDPLKINLDGEYG                                          
fig|333990.5.peg.12   Carnobacterium sp. AT7       MRARVIYNPTSGRE−−−M−−VKKNLVEILQVY−−−−−−EDAGYETSAYATT−−−P−−KPHSAQ−−−−−−FEAER−−−−−AAKA−−−−−−−−−G−−−−−−F−−−−−−DLIVAAGGDGTINEVVNGI−−AG−−LD−−−KR−−−−−−−−PK−−−LAIIPAGTTND−−−−YAR−−−A−−LH−−IP−−−R−−−NNLVEAAKIIQK−−−−−−−−D−−−QS−−−−−FFMDV−−−−−−−−−GEAVMGE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NLS−−−YFINIGGGG−−MLTELTY−−−D−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPSQLKS−−−−−VF−−GYLAYFV−−−K−−−−−−−−−−−GAEM−−−−−−−−−−−−LPRI−−−−−−−−KPIPMHIEY−−−−−−−−−−DDG−−−−−−IFE−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EAT−−MF−−−−−−−−−−−−−−−−−LVALTN−−SIGGFEQ−−−−−−−−−−IA−−−−−−−−−−−−−−P−−−−−−DALL−−−−DDGKFTLIIVK−−−−−−−−−−−−−−−−−−−−−−−TSNL−−−−−−−−−ADMMYLVAQ−−−−−−−−−−−−−−−−VLNGGKH−−−−ITNSKIIYKKTSKI−−VARSGDFSKMMINLDGEYG                                          
fig|525366.3.peg.380   Lactobacillus vaginalis ATCC 49540       KRARIIYNPTSGRE−−−T−−FRSDLVDILSIY−−−−−−EKAGYETSAFATT−−−P−−APDSAK−−−−−−NEATR−−−−−AAKE−−−−−−−−−G−−−−−−F−−−−−−DLIVAAGGDGTLNEVINGI−−AG−−LE−−−HR−−−−−−−−PT−−−LAIIPAGTTND−−−−YAR−−−A−−LR−−IP−−−R−−−DDPIAAAKLILKK−−−−−−−−N−−−KK−−−−−FKIDI−−−−−−−−−GKA−−GE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−N−−−−−−YFMNIAAGG−−TMTELTY−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPSQMKS−−−−−LF−−GYAAYFA−−−K−−−−−−−−−−−GAEL−−−−−−−−−−−−IPRI−−−−−−−−KPIEMQIKY−−−−−−−−−−DGK−−−−−−EYR−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NAT−−MF−−−−−−−−−−−−−−−−−MIALTN−−SVGGFEQ−−−−−−−−−−IV−−−−−−−−−−−−−−P−−−−−−DASL−−−−DDGKFTMIIVK−−−−−−−−−−−−−−−−−−−−−−−KTNM−−−−−−−−−IDMLSLMAK−−−−−−−−−−−−−−−−ALQGKH−−−−LDDPRIIYEKATDIEVIPLNKDDRLMVNLDGEYG                                          
fig|349123.6.peg.623   Lactobacillus reuteri 100-23       KRARIIYNPTSGRE−−−T−−FRSDLVDILSIY−−−−−−EKAGYETSAFATT−−−P−−APNSAK−−−−−−NEATR−−−−−AAKD−−−−−−−−−G−−−−−−F−−−−−−DLIVAAGGDGTLNEVVNGI−−AG−−LE−−−HR−−−−−−−−PT−−−LAIIPAGTTND−−−−YAR−−−A−−LR−−IP−−−R−−−DDPIAAAKLILKK−−−−−−−−N−−−KK−−−−−FKIDI−−−−−−−−−GRA−−GD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−N−−−−−−YFMNIAAGG−−TMTEVTY−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPSQMKS−−−−−LF−−GYAAYFA−−−K−−−−−−−−−−−GAEL−−−−−−−−−−−−IPRI−−−−−−−−KPIEMLIKY−−−−−−−−−−DGQ−−−−−−EYR−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NAT−−MF−−−−−−−−−−−−−−−−−MIALTN−−SVGGFEQ−−−−−−−−−−IV−−−−−−−−−−−−−−P−−−−−−DASL−−−−DDGKFTMIIIK−−−−−−−−−−−−−−−−−−−−−−−KSNV−−−−−−−−−IDMLSLMAK−−−−−−−−−−−−−−−−ALQGKH−−−−LDDPRIIYAKATDIEVIPLNKDDRLMVNLDGEYG                                          
fig|299033.6.peg.1409   Lactobacillus reuteri F275       KRARIIYNPTSGRE−−−T−−LRSDLVDILAIY−−−−−−EKAGYETSAFATT−−−P−−APNSAK−−−−−−NEATR−−−−−AAED−−−−−−−−−G−−−−−−F−−−−−−DLIVAAGGDGTLNEVVNGI−−AG−−LE−−−HR−−−−−−−−PT−−−LAIIPAGTTND−−−−YAR−−−A−−LR−−IP−−−R−−−DDPIAAAKLILKK−−−−−−−−N−−−KK−−−−−FKIDI−−−−−−−−−GRA−−GE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−N−−−−−−YFMNIAAGG−−TMTELTY−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPSQMKS−−−−−LF−−GYAAYFA−−−K−−−−−−−−−−−GAEL−−−−−−−−−−−−MPRI−−−−−−−−KPVDMLIKY−−−−−−−−−−DNQ−−−−−−EYR−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SAS−−MF−−−−−−−−−−−−−−−−−MIALTN−−SVGGFEQ−−−−−−−−−−IV−−−−−−−−−−−−−−P−−−−−−DASL−−−−DDGKFTMIIVK−−−−−−−−−−−−−−−−−−−−−−−KSSV−−−−−−−−−IDMLSLMAK−−−−−−−−−−−−−−−−ALQGKH−−−−LDDPRIIYAKATDIEVIPLNKDDRLMVNLDGEYG                                          
fig|557436.4.peg.1454   Lactobacillus reuteri DSM 20016       KRARIIYNPTSGRE−−−T−−LRSDLVDILAIY−−−−−−EKAGYETSAFATT−−−P−−APNSAK−−−−−−NEATR−−−−−AAED−−−−−−−−−G−−−−−−F−−−−−−DLIVAAGGDGTLNEVVNGI−−AG−−LE−−−HR−−−−−−−−PT−−−LAIIPAGTTND−−−−YAR−−−A−−LR−−IP−−−R−−−DDPIAAAKLILKK−−−−−−−−N−−−KK−−−−−FKIDI−−−−−−−−−GRA−−GE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−N−−−−−−YFMNIAAGG−−TMTELTY−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPSQMKS−−−−−LF−−GYAAYFA−−−K−−−−−−−−−−−GAEL−−−−−−−−−−−−MPRI−−−−−−−−KPVDMLIKY−−−−−−−−−−DNQ−−−−−−EYR−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SAS−−MF−−−−−−−−−−−−−−−−−MIALTN−−SVGGFEQ−−−−−−−−−−IV−−−−−−−−−−−−−−P−−−−−−DASL−−−−DDGKFTMIIVK−−−−−−−−−−−−−−−−−−−−−−−KSSV−−−−−−−−−IDMLSLMAK−−−−−−−−−−−−−−−−ALQGKH−−−−LDDPRIIYAKATDIEVIPLNKDDRLMVNLDGEYG                                          
fig|629742.3.peg.2145   Staphylococcus hominis SK119       KRARIIYNPTSGKE−−−L−−FKRTLPDVLIKL−−−−−−ERAGYETSAYATE−−−−−−REGDAT−−−−−−LEAER−−−−−ALEQ−−−−−−−−−N−−−−−−Y−−−−−−DIIIAAGGDGTLNEVVNGI−−AE−−QP−−−NR−−−−−−−−PK−−−LGIIPMGTVND−−−−FGR−−−A−−LH−−LP−−−−−−−NDIMGAVDVIIK−−−−−−−−G−−−HT−−−−−TKVDI−−−−−−−−−GKM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NNR−−−YFINLAAGG−−KLTQVSY−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TPSRLKS−−−−−IV−−GPFAYYI−−−K−−−−−−−−−−−GFEM−−−−−−−−−−−−LPQM−−−−−−−−KAVDLRIEY−−−−−−−−−−DNE−−−−−−VFQ−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EAL−−LF−−−−−−−−−−−−−−−−−LLGLTN−−SMAGFEK−−−−−−−−−−LV−−−−−−−−−−−−−−P−−−−−−DAKL−−−−DDGYYTLIIVE−−−−−−−−−−−−−−−−−−−−−−−KANL−−−−−−−−−AELGHIMTL−−−−−−−−−−−−−−−−ASRGEH−−−−TKHPKVIYKKAKSINISSFTD−−−MQLNVDGEYG                                          
fig|1134914.3.peg.1177   Staphylococcus haemolyticus R1P1     MRKCARIIYNPTSGKE−−−L−−FKRTLPDVLIKL−−−−−−ERAGYETSAYATE−−−−−−REGDAT−−−−−−LEAER−−−−−ALKR−−−−−−−−−D−−−−−−Y−−−−−−DIIIAAGGDGTLNEVVNGI−−AE−−QP−−−NR−−−−−−−−PK−−−LGIIPMGTVND−−−−FGR−−−A−−LH−−LP−−−−−−−SDIMGAVDVIID−−−−−−−−D−−−HT−−−−−TKVDI−−−−−−−−−GKM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NNR−−−YFINLAAGG−−QLTQVSY−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TPSRLKS−−−−−IV−−GPFAYYI−−−K−−−−−−−−−−−GFEM−−−−−−−−−−−−LPQM−−−−−−−−KAVDLRIEY−−−−−−−−−−DNQ−−−−−−VFQ−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EAL−−LF−−−−−−−−−−−−−−−−−LLGLTN−−SMAGFEK−−−−−−−−−−LV−−−−−−−−−−−−−−P−−−−−−DAKL−−−−DDGHFTLIIVE−−−−−−−−−−−−−−−−−−−−−−−KANL−−−−−−−−−AELGHIMTL−−−−−−−−−−−−−−−−ASRGEH−−−−IKHPKVIYEKAKSINISSFTE−−−MQLNVDGEYG                                          
fig|525378.3.peg.2320   Staphylococcus epidermidis M23864:W1       KRARIIYNPTSGKE−−−L−−FKRVLPDVLIKL−−−−−−EKAGYETSAYATE−−−−−−KAGDAT−−−−−−IEAER−−−−−ALSS−−−−−−−−−H−−−−−−Y−−−−−−DLLIAAGGDGTLNEVVNGI−−AE−−QP−−−NR−−−−−−−−PK−−−LGIIPMGTVND−−−−FGR−−−A−−LH−−LP−−−−−−−NDIMGAVDVIID−−−−−−−−G−−−HT−−−−−TKVDI−−−−−−−−−GKM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NNR−−−YFINLAAGG−−RLTQVSY−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TPSKLKS−−−−−IV−−GPFAYYI−−−K−−−−−−−−−−−GFEM−−−−−−−−−−−−LPQM−−−−−−−−KAVDIRIEY−−−−−−−−−−DDK−−−−−−VFQ−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EAL−−LF−−−−−−−−−−−−−−−−−LLGLTN−−SMAGFEK−−−−−−−−−−LV−−−−−−−−−−−−−−P−−−−−−DAKL−−−−DDGHFTLIIVE−−−−−−−−−−−−−−−−−−−−−−−KANL−−−−−−−−−AELGHIMTL−−−−−−−−−−−−−−−−ASRGEH−−−−TKHPKVIYEKAKSINISSYTE−−−MQLNVDGEYG                                          
fig|553212.3.peg.1827   Staphylococcus capitis SK14       KRARIIYNPTSGKE−−−L−−FKRVLPDVLIKL−−−−−−EKAGYETSAFATE−−−−−−KAGDAT−−−−−−IEAER−−−−−ALSS−−−−−−−−−H−−−−−−Y−−−−−−DLLIVAGGDGTLNEVVNGI−−AE−−QP−−−NR−−−−−−−−PK−−−LGIIPMGTVND−−−−FGR−−−A−−LH−−LP−−−−−−−NDIMGAVDIIIE−−−−−−−−G−−−HT−−−−−TKVDI−−−−−−−−−GKM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NNR−−−YFINLAAGG−−RLTQVSY−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TPSKLKS−−−−−IV−−GPFAYYI−−−K−−−−−−−−−−−GFEM−−−−−−−−−−−−LPQM−−−−−−−−KAVDIRIEY−−−−−−−−−−DNK−−−−−−VFQ−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EAL−−LF−−−−−−−−−−−−−−−−−LLGLTN−−SMAGFEK−−−−−−−−−−LV−−−−−−−−−−−−−−P−−−−−−DAKL−−−−DDGYFTLIIVE−−−−−−−−−−−−−−−−−−−−−−−KANL−−−−−−−−−AELGHIMTL−−−−−−−−−−−−−−−−ASRGEH−−−−TKHPKVIYEKAKSINISSYTE−−−MQLNVDGEYG                                          
fig|1294272.3.peg.587   Staphylococcus epidermidis 528m       KRARIIYNPTSGKE−−−L−−FKRVLPDALIKL−−−−−−EKAGYETSAYATE−−−−−−KIGDAT−−−−−−FEAER−−−−−ALES−−−−−−−−−E−−−−−−Y−−−−−−DLLIAAGGDGTLNEVVNGI−−AE−−QP−−−NR−−−−−−−−PK−−−LGVIPMGTVND−−−−FGR−−−A−−LH−−LP−−−−−−−SDIMGAIDVIID−−−−−−−−G−−−HT−−−−−TKVDI−−−−−−−−−GKM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NNR−−−YFINLAAGG−−KLTQVSY−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TPSKLKS−−−−−IV−−GPFAYYI−−−K−−−−−−−−−−−GFEM−−−−−−−−−−−−LPQM−−−−−−−−KAVDVRIEY−−−−−−−−−−DDN−−−−−−IFQ−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EAL−−LF−−−−−−−−−−−−−−−−−LLGLTN−−SMAGFEK−−−−−−−−−−LV−−−−−−−−−−−−−−P−−−−−−DAKL−−−−DDGYFTLIIVE−−−−−−−−−−−−−−−−−−−−−−−KANL−−−−−−−−−AELGHIMTL−−−−−−−−−−−−−−−−ASRGEH−−−−TKHPKVIYAKAKSINISSFTD−−−MQLNVDGEYG                                          
fig|904323.3.peg.918   Staphylococcus epidermidis VCU057       KRARIIYNPTSGKE−−−L−−FKRVLPDALIKL−−−−−−EKAGYETSAYATE−−−−−−KIGDAT−−−−−−FEAER−−−−−ALES−−−−−−−−−E−−−−−−Y−−−−−−DLLIAAGGDGTLNEVVNGI−−AE−−QP−−−NR−−−−−−−−PK−−−LGVIPMGTVND−−−−FGR−−−A−−LH−−LP−−−−−−−SDIMGAIDVIID−−−−−−−−G−−−HT−−−−−TKVDI−−−−−−−−−GKM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NNR−−−YFINLAAGG−−KLTQVSY−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TPSKLKS−−−−−IV−−GPFAYYI−−−K−−−−−−−−−−−GFEM−−−−−−−−−−−−LPQM−−−−−−−−KAVDVRIEY−−−−−−−−−−DDN−−−−−−IFQ−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EAL−−LF−−−−−−−−−−−−−−−−−LLGLTN−−SMAGFEK−−−−−−−−−−LV−−−−−−−−−−−−−−P−−−−−−DAKL−−−−DDGYFTLIIVE−−−−−−−−−−−−−−−−−−−−−−−KANL−−−−−−−−−AELGHIMTL−−−−−−−−−−−−−−−−ASRGEH−−−−TKHPKVIYAKAKSINISSFTD−−−MQLNVDGEYG                                          
fig|1213731.3.peg.1318   Staphylococcus epidermidis M0881       KRARIIYNPTSGKE−−−L−−FKRVLPDALIKL−−−−−−EKAGYETSAYATE−−−−−−KIGDAT−−−−−−FEAER−−−−−ALES−−−−−−−−−E−−−−−−Y−−−−−−DLLIAAGGDGTLNEVVNGI−−AE−−QP−−−NR−−−−−−−−PK−−−LGVIPMGTVND−−−−FGR−−−A−−LH−−LP−−−−−−−SDIMGAIDVIID−−−−−−−−G−−−HT−−−−−TKVDI−−−−−−−−−GKM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NNR−−−YFINLAAGG−−KLTQVSY−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TPSKLKS−−−−−IV−−GPFAYYI−−−K−−−−−−−−−−−GFEM−−−−−−−−−−−−LPQM−−−−−−−−KAVDVRIEY−−−−−−−−−−DDN−−−−−−IFQ−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EAL−−LF−−−−−−−−−−−−−−−−−LLGLTN−−SMAGFEK−−−−−−−−−−LV−−−−−−−−−−−−−−P−−−−−−DAKL−−−−DDGYFTLIIVE−−−−−−−−−−−−−−−−−−−−−−−KANL−−−−−−−−−AELGHIMTL−−−−−−−−−−−−−−−−ASRGEH−−−−TKHPKVIYAKAKSINISSFTD−−−MQLNVDGEYG                                          
fig|904789.3.peg.973   Staphylococcus aureus subsp. aureus IS-250       KRARIIYNPTSGKE−−−L−−FKRVLPDALIKL−−−−−−EKAGYETSAYATE−−−−−−KIGDAT−−−−−−FEAER−−−−−ALES−−−−−−−−−E−−−−−−Y−−−−−−DLLIAAGGDGTLNEVVNGI−−AE−−QP−−−NR−−−−−−−−PK−−−LGVIPMGTVND−−−−FGR−−−A−−LH−−LP−−−−−−−SDIMGAIDVIID−−−−−−−−G−−−HT−−−−−TKVDI−−−−−−−−−GKM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NNR−−−YFINLAAGG−−KLTQVSY−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TPSKLKS−−−−−IV−−GPFAYYI−−−K−−−−−−−−−−−GFEM−−−−−−−−−−−−LPQM−−−−−−−−KAVDVRIEY−−−−−−−−−−DDN−−−−−−IFQ−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EAL−−LF−−−−−−−−−−−−−−−−−LLGLTN−−SMAGFEK−−−−−−−−−−LV−−−−−−−−−−−−−−P−−−−−−DAKL−−−−DDGYFTLIIVE−−−−−−−−−−−−−−−−−−−−−−−KANL−−−−−−−−−AELGHIMTL−−−−−−−−−−−−−−−−ASRGEH−−−−TKHPKVIYAKAKSINISSFTD−−−MQLNVDGEYG                                          
fig|1327991.3.peg.312   Staphylococcus epidermidis UC7032       KRARIIYNPTSGKE−−−L−−FKRVLPDALIKL−−−−−−EKAGYETSAYATE−−−−−−KIGDAT−−−−−−FEAER−−−−−ALEN−−−−−−−−−E−−−−−−Y−−−−−−DLLIAAGGDGTLNEVVNGI−−AE−−QP−−−NR−−−−−−−−PK−−−LGVIPMGTVND−−−−FGR−−−A−−LH−−LP−−−−−−−NDIMGAIDVIID−−−−−−−−G−−−HT−−−−−TKVDI−−−−−−−−−GKM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NNR−−−YFINLAAGG−−KLTQVSY−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TPSKLKS−−−−−IV−−GPFAYYI−−−K−−−−−−−−−−−GFEM−−−−−−−−−−−−LPQM−−−−−−−−KAVDVRIEY−−−−−−−−−−DDN−−−−−−IFQ−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EAL−−LF−−−−−−−−−−−−−−−−−LLGLTN−−SMAGFEK−−−−−−−−−−LV−−−−−−−−−−−−−−P−−−−−−DAKL−−−−DDGYFTLIIVE−−−−−−−−−−−−−−−−−−−−−−−KANL−−−−−−−−−AELGHIMTL−−−−−−−−−−−−−−−−ASRGEH−−−−TKHPKVIYAKAKSINISSFTD−−−MQLNVDGEYG                                          
fig|764544.3.peg.2087   Staphylococcus epidermidis FRI909       KRARIIYNPTSGKE−−−L−−FKRVLPDALIKL−−−−−−EKAGYETSAYATE−−−−−−KIGDAT−−−−−−FEAER−−−−−ALEN−−−−−−−−−E−−−−−−Y−−−−−−DLLIAAGGDGTLNEVVNGI−−AE−−QP−−−NR−−−−−−−−PK−−−LGVIPMGTVND−−−−FGR−−−A−−LH−−LP−−−−−−−NDIMGAIDVIID−−−−−−−−G−−−HT−−−−−TKVDI−−−−−−−−−GKM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NNR−−−YFINLAAGG−−KLTQVSY−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TPSKLKS−−−−−IV−−GPFAYYI−−−K−−−−−−−−−−−GFEM−−−−−−−−−−−−LPQM−−−−−−−−KAVDVRIEY−−−−−−−−−−DDN−−−−−−IFQ−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EAL−−LF−−−−−−−−−−−−−−−−−LLGLTN−−SMAGFEK−−−−−−−−−−LV−−−−−−−−−−−−−−P−−−−−−DAKL−−−−DDGYFTLIIVE−−−−−−−−−−−−−−−−−−−−−−−KANL−−−−−−−−−AELGHIMTL−−−−−−−−−−−−−−−−ASRGEH−−−−TKHPKVIYAKAKSINISSFTD−−−MQLNVDGEYG                                          
fig|1158466.3.peg.2494   Staphylococcus aureus M1092       KRARIIYNPTSGKE−−−L−−FKRELPDALIKL−−−−−−EKAGYETSAYATE−−−−−−KIGDAT−−−−−−LEAER−−−−−AMHE−−−−−−−−−N−−−−−−Y−−−−−−DVLIAAGGDGTLNEVVNGI−−AE−−KP−−−NR−−−−−−−−PK−−−LGVIPMGTVND−−−−FGR−−−A−−LH−−IP−−−−−−−NDIMGALDVIIE−−−−−−−−G−−−HS−−−−−TKVDI−−−−−−−−−GKM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NNR−−−YFINLAAGG−−QLTQVSY−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TPSKLKS−−−−−IV−−GPFAYYI−−−K−−−−−−−−−−−GFEM−−−−−−−−−−−−LPQM−−−−−−−−KAVDLRIEY−−−−−−−−−−DGN−−−−−−VFQ−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EAL−−LF−−−−−−−−−−−−−−−−−FLGLTN−−SMAGFEK−−−−−−−−−−LV−−−−−−−−−−−−−−P−−−−−−DAKL−−−−DDGYFTLIIVE−−−−−−−−−−−−−−−−−−−−−−−KSNL−−−−−−−−−AELGHIMTL−−−−−−−−−−−−−−−−ASRGEH−−−−TKHPKVIYEKAKAINISSFTD−−−LQLNVDGEYG                                          
fig|680649.3.peg.2279   Staphylococcus aureus subsp. aureus MR1       KRARIIYNPTSGKE−−−L−−FKRELPDALIKL−−−−−−EKAGYETSAYATE−−−−−−KIGDAT−−−−−−LEAER−−−−−AMHE−−−−−−−−−N−−−−−−Y−−−−−−DVLIAAGGDGTLNEVVNGI−−AE−−KP−−−NR−−−−−−−−PK−−−LGVIPMGTVND−−−−FGR−−−A−−LH−−IP−−−−−−−NDIMGALDVIIE−−−−−−−−G−−−HS−−−−−TKVDI−−−−−−−−−GKM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NNR−−−YFINLAAGG−−QLTQVSY−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TPSKLKS−−−−−IV−−GPFAYYI−−−K−−−−−−−−−−−GFEM−−−−−−−−−−−−LPQM−−−−−−−−KAVDLRIEY−−−−−−−−−−DGN−−−−−−VFQ−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EAL−−LF−−−−−−−−−−−−−−−−−FLGLTN−−SMAGFEK−−−−−−−−−−LV−−−−−−−−−−−−−−P−−−−−−DAKL−−−−DDGYFTLIIVE−−−−−−−−−−−−−−−−−−−−−−−KSNL−−−−−−−−−AELGHIMTL−−−−−−−−−−−−−−−−ASRGEH−−−−TKHPKVIYEKAKAINISSFTD−−−LQLNVDGEYG                                          
fig|548474.3.peg.2581   Staphylococcus aureus subsp. aureus TCH130       KRARIIYNPTSGKE−−−Q−−FKRELPDALIKL−−−−−−EKAGYETSAYATE−−−−−−KIGDAT−−−−−−LEAER−−−−−AMHE−−−−−−−−−N−−−−−−Y−−−−−−DILIAAGGDGTLNEVVNGI−−AE−−KP−−−NR−−−−−−−−PK−−−LGVIPMGTVND−−−−FGR−−−A−−LH−−IP−−−−−−−NDIMGALDVIIE−−−−−−−−G−−−HS−−−−−TKVDI−−−−−−−−−GKM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NNR−−−YFINLAAGG−−QLTQVSY−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TPSKLKS−−−−−IV−−GPFAYYI−−−K−−−−−−−−−−−GFEM−−−−−−−−−−−−LPQM−−−−−−−−KAVDLRIEY−−−−−−−−−−DGN−−−−−−VFQ−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EAL−−LF−−−−−−−−−−−−−−−−−FLGLTN−−SMAGFEK−−−−−−−−−−LV−−−−−−−−−−−−−−P−−−−−−DAKL−−−−DDGYFTLIIVE−−−−−−−−−−−−−−−−−−−−−−−KSNL−−−−−−−−−AELGHIMTL−−−−−−−−−−−−−−−−ASRGEH−−−−TKHPKVIYEKAKAINISSFTD−−−LQLNVDGEYG                                          
fig|273036.3.peg.1773   Staphylococcus aureus RF122       KRARIIYNPTSGKE−−−Q−−FKRELPDALIKL−−−−−−EKAGYETSAYATE−−−−−−KIGDAT−−−−−−LEAER−−−−−AMHE−−−−−−−−−N−−−−−−Y−−−−−−DVLIAAGGDGTLNEVVNGI−−AE−−KP−−−NR−−−−−−−−PK−−−LGVIPMGTVND−−−−FGR−−−A−−LH−−IP−−−−−−−NDIMGALDVIIE−−−−−−−−G−−−HS−−−−−TKVDI−−−−−−−−−GKM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NNR−−−YFINLAAGG−−QLTQVSY−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TPSKLKS−−−−−IV−−GPFAYYI−−−K−−−−−−−−−−−GFEM−−−−−−−−−−−−LPQM−−−−−−−−KAVDLRIEY−−−−−−−−−−DGN−−−−−−VFQ−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EAL−−LF−−−−−−−−−−−−−−−−−FLGLTN−−SMAGFEK−−−−−−−−−−LV−−−−−−−−−−−−−−P−−−−−−DAKL−−−−DDGYFTLIIVE−−−−−−−−−−−−−−−−−−−−−−−KSNL−−−−−−−−−AELGHIMTL−−−−−−−−−−−−−−−−ASRGEH−−−−TKHPKVIYEKAKAINISSLTD−−−LQLNVDGEYG                                          
fig|1158485.3.peg.1293   Staphylococcus aureus M1311       KRARIIYNPTSGKE−−−Q−−FKRELPDALIKL−−−−−−EKAGYETSAYATE−−−−−−KIGDAT−−−−−−LEAER−−−−−AMHE−−−−−−−−−N−−−−−−Y−−−−−−DVLIAAGGDGTLNEVVNGI−−AE−−KP−−−NR−−−−−−−−PK−−−LGVIPMGTVND−−−−FGR−−−A−−LH−−IP−−−−−−−NDIMGALDVIIE−−−−−−−−G−−−HS−−−−−TKVDI−−−−−−−−−GKM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NNR−−−YFINLAAGG−−QLTQVSY−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TPSKLKS−−−−−IV−−GPFAYYI−−−K−−−−−−−−−−−GFEM−−−−−−−−−−−−LPQM−−−−−−−−KAVDLRIEY−−−−−−−−−−DGN−−−−−−VFQ−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EAL−−LF−−−−−−−−−−−−−−−−−FLGLTN−−SMAGFEK−−−−−−−−−−LV−−−−−−−−−−−−−−P−−−−−−DAKL−−−−DDGYFTLIIVE−−−−−−−−−−−−−−−−−−−−−−−KSNL−−−−−−−−−AELGHIMTL−−−−−−−−−−−−−−−−ASRGEH−−−−TKHPKVIYEKAKAINISSFTD−−−LQLNVDGEYG                                          
fig|931454.3.peg.2303   Staphylococcus aureus subsp. aureus CIG1524       KRARIIYNPTSGKE−−−Q−−FKRELPDALIKL−−−−−−EKAGYETSAYATE−−−−−−KIGDAT−−−−−−LEAER−−−−−AMHE−−−−−−−−−N−−−−−−Y−−−−−−DVLIAAGGDGTLNEVVNGI−−AE−−KP−−−NR−−−−−−−−PK−−−LGVIPMGTVND−−−−FGR−−−A−−LH−−IP−−−−−−−NDIMGALDVIIE−−−−−−−−G−−−HS−−−−−TKVDI−−−−−−−−−GKM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NNR−−−YFINLAAGG−−QLTQVSY−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TPSKLKS−−−−−IV−−GPFAYYI−−−K−−−−−−−−−−−GFEM−−−−−−−−−−−−LPQM−−−−−−−−KAVDLRIEY−−−−−−−−−−DGN−−−−−−VFQ−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EAL−−LF−−−−−−−−−−−−−−−−−FLGLTN−−SMAGFEK−−−−−−−−−−LV−−−−−−−−−−−−−−P−−−−−−DAKL−−−−DDGYFTLIIVE−−−−−−−−−−−−−−−−−−−−−−−KSNL−−−−−−−−−AELGHIMTL−−−−−−−−−−−−−−−−ASRGEH−−−−TKHPKVIYEKAKAINISSFTD−−−LQLNVDGEYG                                          
fig|1137131.3.peg.1071   Staphylococcus aureus subsp. aureus 122051       KRARIIYNPTSGKE−−−Q−−FKRELPDALIKL−−−−−−EKAGYETSAYATE−−−−−−KIGDAT−−−−−−LEAER−−−−−AMHE−−−−−−−−−N−−−−−−Y−−−−−−DVLIAAGGDGTLNEVVNGI−−AE−−KP−−−NR−−−−−−−−PK−−−LGVIPMGTVND−−−−FGR−−−A−−LH−−IP−−−−−−−NDIMGALDVIIE−−−−−−−−G−−−HS−−−−−TKVDI−−−−−−−−−GKM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NNR−−−YFINLAAGG−−QLTQVSY−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TPSKLKS−−−−−IV−−GPFAYYI−−−K−−−−−−−−−−−GFEM−−−−−−−−−−−−LPQM−−−−−−−−KAVDLRIEY−−−−−−−−−−DGN−−−−−−VFQ−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EAL−−LF−−−−−−−−−−−−−−−−−FLGLTN−−SMAGFEK−−−−−−−−−−LV−−−−−−−−−−−−−−P−−−−−−DAKL−−−−DDGYFTLIIVE−−−−−−−−−−−−−−−−−−−−−−−KSNL−−−−−−−−−AELGHIMTL−−−−−−−−−−−−−−−−ASRGEH−−−−TKHPKVIYEKAKAINISSFTD−−−LQLNVDGEYG                                          
fig|585160.3.peg.1438   Staphylococcus aureus subsp. aureus WBG10049       KRARIIYNPTSGKE−−−Q−−FKRELPDALIKL−−−−−−EKAGYETSAYATE−−−−−−KIGDAT−−−−−−LEAER−−−−−AMHE−−−−−−−−−N−−−−−−Y−−−−−−DVLIAAGGDGTLNEVVNGI−−AE−−KP−−−NR−−−−−−−−PK−−−LGVIPMGTVND−−−−FGR−−−A−−LH−−IP−−−−−−−NDIMGALDVIIE−−−−−−−−G−−−HS−−−−−TKVDI−−−−−−−−−GKM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NNR−−−YFINLAAGG−−QLTQVSY−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TPSKLKS−−−−−IV−−GPFAYYI−−−K−−−−−−−−−−−GFEM−−−−−−−−−−−−LPQM−−−−−−−−KAVDLRIEY−−−−−−−−−−DGN−−−−−−VFQ−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EAL−−LF−−−−−−−−−−−−−−−−−FLGLTN−−SMAGFEK−−−−−−−−−−LV−−−−−−−−−−−−−−P−−−−−−DAKL−−−−DDGYFTLIIVE−−−−−−−−−−−−−−−−−−−−−−−KSNL−−−−−−−−−AELGHIMTL−−−−−−−−−−−−−−−−ASRGEH−−−−TKHPKVIYEKAKAINISSFTD−−−LQLNVDGEYG                                          
fig|546271.3.peg.505   Selenomonas sputigena ATCC 35185       RKFLLIYNPVSGNA−−−S−−FKQRLDEMIWRF−−−−−−QKLGCMLVLYRTD−−−R−−ELTNLA−−−−−−LYVRE−−−−−SEAE−−−−−−−−−G−−−−−−−−−−−−−−−VLVAGGDGTVHEVVNVI−−VR−−EK−−−LA−−−−−−−−VP−−−LAIIGSGTSND−−−−FAT−−−Y−−LG−−LA−−−−−−−DGLEAYIERILA−−−−−−−−H−−−KT−−−−−MRVDL−−−−−−−−−GRIG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EE−−−−−YFINVASAG−−VMTNIAH−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDVRLKN−−−−−TL−−GKMAYYL−−−K−−−−−−−−−−−GISE−−−−−−−−−−−−LPKF−−−−−−−−RSVKFSIEA−−−−−−−−−−DGE−−−−−−MRE−−−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EGF−−LF−−−−−−−−−−−−−−−−−VIANSG−−IVGSFNN−−−−−−−−−−VA−−−−−−−−−−−−−−A−−−−−−HASI−−−−DDGKFDLLLVK−−−−−−−−−−−−−−−−−−−−−−−KCSL−−−−−−−−−PELVALTAE−−−−−−−−−−−−−−−−IVSGRG−−−−ISEKNVLYL                                                                    
fig|638302.3.peg.51   Selenomonas flueggei ATCC 43531           LIYNPVSGHA−−−L−−FKEKLDTLIELF−−−−−−QRHDIILSSYRTR−−−G−−NGQDQLS−−−−−−QFLCE−−−−−IAPA−−−−−−−−−G−−−−−−−−−−−−−−−ILAAGGDGTVHAVVNAL−−QD−−AK−−−ID−−−−−−−−IP−−−LGILGSGTSND−−−−FAT−−−H−−LG−−IG−−−−−−−GDWESYVERIAA−−−−−−−−D−−−ES−−−−−RRVDL−−−−−−−−−GVLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GQGR−−−YFVNVLSAG−−VLTGIAH−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VKSVYKN−−−−−SL−−GRIAYYL−−−K−−−−−−−−−−−GIGE−−−−−−−−−−−−LPRL−−−−−−−−HSFPVHITA−−−−−−−−−−DGE−−−−−−HYE−−−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EIF−−LF−−−−−−−−−−−−−−−−−VIANSP−−VVAGMKQ−−−−−−−−−−IG−−−−−−−−−−−−−−S−−−−−−DIAI−−−−DDGMLDLLAVK−−−−−−−−−−−−−−−−−−−−−−−KTGL−−−−−−−−−PQFMSVAAD−−−−−−−−−−−−−−−−LFAGKP−−−−VSERD                                                                        
fig|411463.4.peg.98   Eubacterium ventriosum ATCC 27560       KKLLFIINPKAGVK−−−K−−NKHFVDDALEIF−−−−−−EKAGYKVGVKYT−−−K−−KRADGT−−−−−−RIARD−−−−−YGA−−−−−−−−−K−−−−−−A−−−−−−DLIVCMGGDGTLNEVMQGM−−LE−−−GEIST−−−−−−−−P−−−−LGYIPAGSTND−−−−FAN−−−S−−LG−−LR−−−−−−−TNPKDQAEFIME−−−−−−−−T−−−EA−−−−−KSLDL−−−−−−−−−GWF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NGR−−−YFVYTASAG−−IFTETSY−−−S−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TPQELKN−−−−−RL−−GHFAYVL−−−H−−−−−−−−−−−GIRE−−−−−−−−−−−−VFKI−−−−−−−−RRLKLRIET−−−−−−−−−−EDE−−−−−−VYE−−−−−−−−−−−N−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KYI−−FV−−−−−−−−−−−−−−−−−AINNAK−−KVGGIMR−−−−−−−−−−LDK−−−−−−−−−−−−−A−−−−−−HVEF−−−−NDGEFELMLVE−−−−−−−−−−−−−−−−−−−−−−−FPKDF−−−−−−−−−IQLMKTVGK−−−−−−−−−−−−−−−−IFMQDF−−−−SGNITF                                                                       
fig|411486.3.peg.1023   Clostridium sp. M62/1       KKMLFIMNPRSGRE−−−K−−LRTRLMDILDLF−−−−−−VRVGYEVTVHVT−−−Q−−AQGDAK−−−−−−KKAGN−−−−−SGD−−−−−−−−−S−−−−−−V−−−−−−ALLVCSGGDGTLNEVVSGL−−MT−−LDREKR−−−−−−−−PV−−−IGYIPSGSTND−−−−YAA−−−S−−LK−−IS−−−−−−−KNMMKAAEEAVN−−−−−−−−G−−−SP−−−−−FAVDI−−−−−−−−−GRF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GADR−−−YFVYVAAFG−−AFTEVSY−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TSQETKN−−−−−VL−−GHQAYML−−−E−−−−−−−−−−−AVRR−−−−−−−−−−−−IAGL−−−−−−−−KSYRLKFHW−−−−−−−−−−NGQ−−−−−−TLE−−−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EFI−−LG−−−−−−−−−−−−−−−−−MVTNTM−−SIGGFKS−−−−−−−−−−LVP−−−−−−−−−−−−−P−−−−−−GVAL−−−−NDGEFEVMLVR−−−−−−−−−−−−−−−−−−−−−−−TPRTP−−−−−−−−−KDIQSIVAY−−−−−−−−−−−−−−−−LINKEG−−−−END                                                                          
fig|411474.6.peg.499   Coprococcus eutactus ATCC 27759       KNMLFIMNPKAGRT−−−T−−LKNSLVDVLEVF−−−−−−CNNDYAVRTYLT−−−K−−SADDAE−−−−−−RIVQE−−−−−EGA−−−−−−−−−N−−−−−−Y−−−−−−DVIVCAGGDGTLGNTVTGY−−MK−−−SGIKV−−−−−−−−P−−−−LGYIPCGSTND−−−−FAR−−−S−−MD−−IP−−−−−−−RETVEAAEMIVK−−−−−−−−A−−−EP−−−−−FSIDI−−−−−−−−−GSL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NDK−−−NFVYVAAFG−−MFSDTSY−−−A−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TPQNMKN−−−−−IF−−GHAAYVL−−−Q−−−−−−−−−−−GIKS−−−−−−−−−−−−LANV−−−−−−−−PSYKMKVTI−−−−−−−−−−DGD−−−−−−EQE−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EFI−−FG−−−−−−−−−−−−−−−−−MVSNSI−−SVGGFKS−−−−−−−−−−ITR−−−−−−−−−−−−−K−−−−−−GVEF−−−−DDGLFEGVLIR−−−−−−−−−−−−−−−−−−−−−−−TIKTP−−−−−−−−−ADLERVVRA−−−−−−−−−−−−−−−−LLTGDV−−−−NERSMVSF                                                                     
fig|1138910.3.peg.1748   Enterococcus faecium E1634       KKVLLVVNPSSGGE−−−Q−−AKEFEQLAIAKL−−−−−−ESVFDEVVVLHT−−−K−−KAGDAK−−−−−−NFTRE−−−−−AATE−−−−−−−−−G−−−−−−Y−−−−−−HSVFVMGGDGTVNEGISGI−−AE−−QE−−−HR−−−−−−−−PN−−−FGFFPLGTVND−−−−LAR−−−A−−LG−−IP−−−−−−−LEPEEAINHFSI−−−−−−−−E−−−SV−−−−−KPLDI−−−−−−−−−GKI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NDD−−−YFMNVVAIG−−SIPEAIN−−−D−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDAEKKT−−−−−KF−−GKLAYFM−−−S−−−−−−−−−−−GIKQ−−−−−−−−−−−−LAST−−−−−−−−QSYSFHVEI−−−−−−−−−−DGK−−−−−−KEE−−−−−−−−−−−I−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ESS−−TL−−−−−−−−−−−−−−−−−LIGLTN−−SVGGFET−−−−−−−−−−LL−−−−−−−−−−−−−−P−−−−−−NAKV−−−−DDGKLHLVYLK−−−−−−−−−−−−−−−−−−−−−−−DSSL−−−−−−−−−IDTLKTLPD−−−−−−−−−−−−−−−−LLKGVD−−−−ESTKNLAYLTC                                                                  
fig|565665.3.peg.2024   Enterococcus faecium D344SRF       KKVLLVVNPSSGGE−−−Q−−AKEFEQLAIAKL−−−−−−ESVFDEVVVLHT−−−K−−KAGDAK−−−−−−NFTRE−−−−−AATE−−−−−−−−−G−−−−−−Y−−−−−−HSVFVMGGDGTVNEGISGI−−AE−−QE−−−HR−−−−−−−−PN−−−FGFFPLGTVND−−−−LAR−−−A−−LG−−IP−−−−−−−LEPEEAINHFSI−−−−−−−−E−−−SV−−−−−KPLDI−−−−−−−−−GKI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NDD−−−YFMNVVAIG−−SIPEAIN−−−D−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDAEKKT−−−−−KF−−GKLAYFM−−−S−−−−−−−−−−−GIKQ−−−−−−−−−−−−LAST−−−−−−−−QSYSFHVEI−−−−−−−−−−DGK−−−−−−KEE−−−−−−−−−−−I−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ESS−−TL−−−−−−−−−−−−−−−−−LIGLTN−−SVGGFET−−−−−−−−−−LL−−−−−−−−−−−−−−P−−−−−−NAKV−−−−DDGKLHLVYLK−−−−−−−−−−−−−−−−−−−−−−−DSSL−−−−−−−−−IDTLKTLPD−−−−−−−−−−−−−−−−LLKGVD−−−−ESTKNLAYLTC                                                                  
fig|645663.4.peg.750   Enterococcus faecium E1039       KKVLLVVNPSSGGE−−−Q−−AKEFEQLAIAKL−−−−−−KSVFDEVVVLHT−−−K−−KAGDAK−−−−−−NFTRE−−−−−AATE−−−−−−−−−G−−−−−−Y−−−−−−HSVFVMGGDGTVNEGISGI−−AE−−QE−−−HR−−−−−−−−PN−−−FGFFPLGTVND−−−−LAR−−−A−−LG−−IP−−−−−−−LEPEEAINHFSI−−−−−−−−E−−−SV−−−−−KPLDI−−−−−−−−−GKI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NDD−−−YFMNVVAIG−−SIPEAIN−−−D−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDAEKKT−−−−−KF−−GKLAYFM−−−S−−−−−−−−−−−GIKQ−−−−−−−−−−−−LAST−−−−−−−−QSYSFHVEV−−−−−−−−−−DGK−−−−−−KEE−−−−−−−−−−−I−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ESS−−TL−−−−−−−−−−−−−−−−−LIGLTN−−SVGGFET−−−−−−−−−−LL−−−−−−−−−−−−−−P−−−−−−NAKV−−−−DDGKLHLVYLK−−−−−−−−−−−−−−−−−−−−−−−DSSL−−−−−−−−−IDTLKTLPD−−−−−−−−−−−−−−−−LLKGVD−−−−ESTKNLAYLTC                                                                  
fig|1157469.3.peg.2284   Enterococcus faecium VAN 335       KKVLLVVNPSSGGE−−−Q−−AKEFEQLAIAKL−−−−−−ESVFDEVVVLHT−−−K−−KAGDAK−−−−−−NFTRE−−−−−AATE−−−−−−−−−G−−−−−−Y−−−−−−HSVFVMGGDGTVNEGISGI−−AE−−QE−−−HR−−−−−−−−PN−−−FGFFPLGTVND−−−−LAR−−−A−−LG−−IP−−−−−−−LEPEEAINHFSI−−−−−−−−E−−−SV−−−−−KPLDI−−−−−−−−−GKI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NDD−−−YFMNVVAIG−−SIPEAIN−−−D−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDAEKKT−−−−−KF−−GKLAYFM−−−S−−−−−−−−−−−GIKQ−−−−−−−−−−−−LAST−−−−−−−−QSYSFHVEV−−−−−−−−−−DGK−−−−−−KEE−−−−−−−−−−−I−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ESS−−TL−−−−−−−−−−−−−−−−−LIGLTN−−SVGGFET−−−−−−−−−−LL−−−−−−−−−−−−−−P−−−−−−NAKV−−−−DDGKLHLVYLK−−−−−−−−−−−−−−−−−−−−−−−DSSL−−−−−−−−−IDTLKTLPD−−−−−−−−−−−−−−−−LLKGVD−−−−ESTKNLAYLTC                                                                  
fig|565658.4.peg.1199   Enterococcus faecium 1,231,501       KKVLLVVNPSSGGE−−−Q−−AKEFEQLAIAKL−−−−−−ESVFDEVVVLHT−−−K−−KAGDAK−−−−−−NFTRE−−−−−AATE−−−−−−−−−G−−−−−−Y−−−−−−HSVFVMGGDGTVNEGISGI−−AE−−QE−−−HR−−−−−−−−PN−−−FGFFPLGTVND−−−−LAR−−−A−−LG−−IP−−−−−−−LEPEEAINHFSI−−−−−−−−E−−−SV−−−−−KPLDI−−−−−−−−−GKI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NDD−−−YFMNVVAIG−−SIPEAIN−−−D−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDAEKKT−−−−−KF−−GKLAYFM−−−S−−−−−−−−−−−GIKQ−−−−−−−−−−−−LAST−−−−−−−−QSYSFHVEV−−−−−−−−−−DGK−−−−−−KEE−−−−−−−−−−−I−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ESS−−TL−−−−−−−−−−−−−−−−−LIGLTN−−SVGGFET−−−−−−−−−−LL−−−−−−−−−−−−−−P−−−−−−NAKV−−−−DDGKLHLVYLK−−−−−−−−−−−−−−−−−−−−−−−DSSL−−−−−−−−−IDTLKTLPD−−−−−−−−−−−−−−−−LLKGVD−−−−ESTKNLAYLTC                                                                  
fig|565659.3.peg.1080   Enterococcus faecium 1,141,733       KKVLLVVNPSSGGE−−−Q−−AKEFEQLAIAKL−−−−−−ESVFDEVVVLHT−−−K−−KAGDAK−−−−−−NFTRE−−−−−AAVE−−−−−−−−−G−−−−−−Y−−−−−−HSVFVMGGDGTVNEGISGI−−AE−−QE−−−HR−−−−−−−−PN−−−FGFFPLGTVND−−−−LAR−−−A−−LG−−IP−−−−−−−LEPEEAINHFSI−−−−−−−−E−−−SV−−−−−KPLDI−−−−−−−−−GKI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NDD−−−YFMNVVAIG−−SIPEAIN−−−D−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDAEKKT−−−−−KF−−GKLAYFM−−−S−−−−−−−−−−−GIKQ−−−−−−−−−−−−LAST−−−−−−−−QSYSFHVEV−−−−−−−−−−DGK−−−−−−KEE−−−−−−−−−−−I−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ESS−−TL−−−−−−−−−−−−−−−−−LIGLTN−−SVGGFET−−−−−−−−−−LL−−−−−−−−−−−−−−P−−−−−−NAKV−−−−DDGKLHLVYLK−−−−−−−−−−−−−−−−−−−−−−−DSSL−−−−−−−−−IDTLKTLPD−−−−−−−−−−−−−−−−LLKGVG−−−−ESTKNLAYLTC                                                                  
fig|1138914.3.peg.1180   Enterococcus faecium E1861       KKVLLVVNPSSGGE−−−Q−−AKEFEQLAIAKL−−−−−−ESVFDEVVVLHT−−−K−−KAGDAK−−−−−−NFTRE−−−−−AAVE−−−−−−−−−G−−−−−−Y−−−−−−HSVFVMGGDGTVNEGISGI−−AE−−QE−−−HR−−−−−−−−PN−−−FGFFPLGTVND−−−−LAR−−−A−−LG−−IP−−−−−−−LEPEEAINHFSI−−−−−−−−E−−−SV−−−−−KPLDI−−−−−−−−−GKI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NDD−−−YFMNVVAIG−−SIPEAIN−−−D−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDAEKKT−−−−−KF−−GKLAYFM−−−S−−−−−−−−−−−GIKQ−−−−−−−−−−−−LAST−−−−−−−−QSYSFHVEV−−−−−−−−−−DGK−−−−−−KEE−−−−−−−−−−−I−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ESS−−TL−−−−−−−−−−−−−−−−−LIGLTN−−SVGGFET−−−−−−−−−−LL−−−−−−−−−−−−−−P−−−−−−NAKV−−−−DDGKLHLVYLK−−−−−−−−−−−−−−−−−−−−−−−DSSL−−−−−−−−−IDTLKTLPD−−−−−−−−−−−−−−−−LLKGVD−−−−ESTKNLAYLTC                                                                  
fig|565661.4.peg.564   Enterococcus faecium 1,231,408       KKVLLVVNPSSGGE−−−Q−−AKEFEQLAIAKL−−−−−−ESVFDEVVVLHT−−−K−−KAGDAK−−−−−−NFTRE−−−−−AAVE−−−−−−−−−G−−−−−−Y−−−−−−HSVFVMGGDGTVNEGISGI−−AE−−QE−−−HR−−−−−−−−PN−−−FGFFPLGTVND−−−−LAR−−−A−−LG−−IP−−−−−−−LEPEEAINHFSI−−−−−−−−E−−−SV−−−−−KPLDI−−−−−−−−−GKI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NDD−−−YFMNVVAIG−−SIPEAIN−−−D−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDAEKKT−−−−−KF−−GKLAYFM−−−S−−−−−−−−−−−GIKQ−−−−−−−−−−−−LAST−−−−−−−−QSYSFHVEV−−−−−−−−−−DGK−−−−−−KEE−−−−−−−−−−−I−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ESS−−TL−−−−−−−−−−−−−−−−−LIGLTN−−SVGGFET−−−−−−−−−−LL−−−−−−−−−−−−−−P−−−−−−NAKV−−−−DDGKLHLVYLK−−−−−−−−−−−−−−−−−−−−−−−DSSL−−−−−−−−−IDTLKTLPD−−−−−−−−−−−−−−−−LLKGVD−−−−ESTKNLAYLTC                                                                  
fig|565663.4.peg.865   Enterococcus faecium Com15       KKVLLVVNPSSGGE−−−Q−−AKEFEQLAIAKL−−−−−−ESVFDEVVVLHT−−−K−−KVGDAK−−−−−−NFTRE−−−−−AAVE−−−−−−−−−G−−−−−−Y−−−−−−HSVFVMGGDGTVNEGISGI−−AE−−QD−−−HR−−−−−−−−PN−−−FGFFPLGTVND−−−−LAR−−−A−−LG−−IP−−−−−−−LEPEEAINHFSI−−−−−−−−E−−−SV−−−−−KPLDI−−−−−−−−−GKI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NDD−−−YFMNVVAIG−−SIPEAIN−−−D−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDAEKKT−−−−−KF−−GKLAYFM−−−S−−−−−−−−−−−GIKQ−−−−−−−−−−−−LAST−−−−−−−−QSYSFHVEV−−−−−−−−−−DGK−−−−−−KEE−−−−−−−−−−−I−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ESS−−TL−−−−−−−−−−−−−−−−−LIGLTN−−SVGGFET−−−−−−−−−−LL−−−−−−−−−−−−−−P−−−−−−NAKV−−−−DDGKLHLVYLK−−−−−−−−−−−−−−−−−−−−−−−DSSL−−−−−−−−−IDTLKTLPD−−−−−−−−−−−−−−−−LLKGVD−−−−ESTKNLAYLTC                                                                  
fig|535205.4.peg.187   Enterococcus faecium E1071       KKVLLVVNPSSGGE−−