(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00004722

fig|262723.5.peg.153   Mycoplasma synoviae 53     FEDLNLYLMLFDKYSFLLTQNQKQIFQLYFHEDLSYSEIAKILVTSRTNVYDSINKTLKKLIKLEEK          
fig|45361.3.peg.242   Mycoplasma conjunctivae     IEDKDKFDNLYNKFSFLLTQNQKQIFHLYYKENLSLSEIAKILATTRASVFDSLKKAKQKMLKIEQKM         
fig|512564.3.peg.643   Mycoplasma crocodyli MP145     IESIEKYTKLYEKYSSFLTQSQSQVFQLFYFEDLSYGEIAQILATSRTNAYDTLAKTIKKLEKIDEKMN        
fig|747682.4.peg.188   Mycoplasma alligatoris A21JP2     IESIEKYTHLFEKYSSFLTQSQKQVFQLFYFEDLSYAEIAEILACTRTNAYDTLKKAVAKLEKIEQKMN        
fig|2110.3.peg.207   Mycoplasma agalactiae     IKNIEHLCSLFEKYEGLLTQTQKQAFRLYFYENLSYAEIAKITATTRTAAYDSVHKAINNLKKIESK          
fig|347257.4.peg.220   Mycoplasma agalactiae PG2     IKNIEHLCSLFEKYEGLLTQTQKQTFRLYFYENLSYAEIAKITATTRTAAYDSVHKAINNLKKIEAK          
fig|267748.1.peg.53   Mycoplasma mobile 163K     IKELEDIALLLEKFENFLTENQRKVLSYRFLEDYSYQEIADILKISKPASYDAVNKAKQKLLDISKKLQ        
fig|1267000.3.peg.407   Mycoplasma hominis ATCC 27545     IEERDYYVKLFEKYGDLLPQSQKQALQLLLYEDLSYGELAQELAMSRPGAYDAVKKAKLHLKQIDEKLK        
fig|243272.4.peg.49   Mycoplasma arthritidis 158L3-1     IEERSKFIELYEKFGALLAQSQKQALYLHLFEDLSLAEISQELAMTRSGVYDAIKKGKVKL                
fig|272635.4.peg.686   Mycoplasma pulmonis UAB CTIP      ENREKIIELFEKFGLLLSKGQKLTLELYLIEDLSMNEIADELSISKSAVHDSIKKGVQKLFAIQEKL         
fig|272635.1.peg.673   Mycoplasma pulmonis UAB CTIP      ENREKIIELFEKFGLLLSKGQKLTLELYLIEDLSMNEIADELSISKSAVHDSIKKGVQKLFAIQEKL         
fig|234267.13.peg.2667   Solibacter usitatus Ellin6076                      LSEKQRTVFLLHFLEEMSAAEIEAATGISRAAIKVHLFRAVHAI−−−REKLG        
fig|483218.5.peg.599   Bacteroides pectinophilus ATCC 43243                      LPPKYRDVIFLYYYEELSTAEIAGILGIMQTGVRSRLKRARDILKKEADNYE        
fig|358681.3.peg.5070   Brevibacillus brevis NBRC 100599                  YIQSLAPKYRQVILLHYYEDLSIAEVADILSVSQEVVRTRLHRARKQLKETMSK          
fig|269798.16.peg.533   Cytophaga hutchinsonii ATCC 33406      LEQKEEAEILLSVIEKLPERQKAVFVLYQFEDMSYKEIASTLEISVSAVDSLMSRAKKQLRE              
fig|316055.16.peg.798   Rhodopseudomonas palustris BisA53          EVSLLLEAAMQRLPEQQRIAMILSYHQDMSNGEIAEVMETTVAAVESLLKRGRQQLRDL             
fig|269796.9.peg.2644   Rhodospirillum rubrum ATCC 11170             DRVRQALRFLSEPQRMAITLYYNEDLTAAEVATVMDLSLNAVESLLKRGRHKLREL             
fig|1085.1.peg.186   Rhodospirillum rubrum             DRVRQALRFLSEPQRMAITLYYNEDLTAAEVATVMDLSLNAVESLLKRGRHKLREL             
fig|525280.3.peg.825   Erysipelothrix rhusiopathiae ATCC 19414      EKAVELNRLFDYYESLLTEKQIQVFQYYYQDDLSYQEIADILNISRSAVYDNLNRTTRLLEEYEQKLGVATSYQKL
fig|265311.3.peg.284   Mesoplasma florum L1     LEKTLELSSLFYLYKNMLTEKQIEYFELYFEEDLSFQEIADQLGISKAAAHDAINKIIKSLNDLEDKLQLNHKKISI
fig|436113.7.peg.426   Mycoplasma mycoides subsp. capri str. GM12 (Prj:39245)     LEKTLELSELFKIYKELLTDKQKQYFELYIDEDLSLSEIADEFNISKTAVYDSISKTSKLLFNLETKLHLKQK    
fig|340047.17.peg.476   Mycoplasma capricolum subsp. capricolum ATCC 27343     LEKTLELSELFKIYKELLTDKQKQYFELYIDEDLSLSEIADEFNISKTAVYDSISKTSKLLFSLEKKLHLKQKEE  
fig|272632.1.peg.465   Mycoplasma mycoides subsp. mycoides SC str. PG1     LEKTLELSELFKIYKELLTDKQKQYFELYIDEDLSLSEIADEFNISKTAVYDSISKTSKLLFSLEKKLHLKQK    
fig|865867.3.peg.532   Mycoplasma mycoides subsp. mycoides SC str. Gladysdale     LEKTLELSELFKIYKELLTDKQKQYFELYIDEDLSLSEIADEFNISKTAVYDSISKTSKLLFSLEKKLHLKQK    
fig|699246.3.peg.1140   Clostridiales genomosp. BVAB3 str. UPII9-5     LKKDLTVTSLFDFYGELLPPETKEILHLKYEEDFSYSEIAEHLSISRQAVHLRLQRAVQKLWECETALHGIQRWQER
fig|518637.5.peg.1924   Eubacterium biforme DSM 3989     MISKLDANDLFDVYGDLLTKRQREILSLYYEEDFSYTEISEELEISRAAAMDSVHRATKLLEKYEAAIGYVAK    
fig|699218.3.peg.17   Megasphaera genomosp. type_1 str. 28L     LDDVIRKGRLLDLYGALLTEKQRQCVHLYYNQDWSLREIGEALSVSRQGVYDMLHRSVQALEEYEKQLHLLAKNEK 
fig|246194.6.peg.1375   Carboxydothermus hydrogenoformans Z-2901     IDEFARNGSLLELYGGLLTEKQREILELYYIENWSLAEIAEYLKISRQGVYDILQRAIRQLNIFEEKLGLLRKNEQ 
fig|592010.4.peg.286   Abiotrophia defectiva ATCC 49176     LDERLRISELFDYYGVLLKEGQSKLLEAYILEDLSLSEIAETEGISRQGVHDNLKRSIKQLEEFDNKLGLIKKSEEI
fig|658085.3.peg.2594   Lachnospiraceae bacterium 5_1_57FAA     MNEILEQALLYDFYGELLTKHQKEIYEQFVLEDLSLGEIAKEAGISRQGVHDLIKRCNQTLKDYEDKLQLVAKFVAV
fig|553973.6.peg.2536   Clostridium hylemonae DSM 15053     MNEILEQALLYDFYGELLTEHQKEIYEQFVLEDLSLGEIAVEAGISRQGVHDLVKRCGRTLKGYEDKLHLVEKFVSI
fig|411462.6.peg.1117   Dorea longicatena DSM 13814     MNEILEQALLYDFYGELLTDHQKEVYEQFVLEDLSLGEIAREEGISRQGVHDLVKRCSQTLKGYEEKLHLVEKFVSI
fig|742765.5.peg.1861   Dorea formicigenerans 4_6_53AFAA      NEILKQALLFDFYGELLTDHQKEIYGQFLLEDLSLGEIARDAGISRQGVHDIVKRCEQALAGYEEKLHLVEKFM  
fig|665950.3.peg.531   Lachnospiraceae bacterium 3_1_46FAA     MDKILEQALLYDFYGELLTAHQKEIYEQFVLDDLSLGEIAADAGISRQGVHDIVKRCARSLEEYERKLHLVEKFLAV
fig|658082.3.peg.1635   Lachnospiraceae bacterium 2_1_58FAA     MNDILEQALLYDFYGELLTSHQKEIYEQFVLEDLSLSEIAGEAGISRQGVHDLIKRCQKALEGYEEKLHLVEKFLSI
fig|500632.7.peg.2860   Clostridium nexile DSM 1787     MNEILEQALLYDFYGELLTSHQKEIYEQFVLEDLSLSEIAEDAGISRQGVHDLIKRCNKTLEGYEAKLHLVEKFLSI
fig|471875.6.peg.1986   Ruminococcus lactaris ATCC 29176     MNKFLEQALLYDFYGELLTEHQKDVYEQVVLEDYSLSEIAQMKGISRQGVHDLVKRCQKILEGYEAKLHLVEKFLSV
fig|470146.3.peg.1002   Coprococcus comes ATCC 27758     MDEILKQTLLYDFYGELLTKHQKEIYEQAVLEDYSLSEIARDAGISRQGVHDMIRRCNKSLEDYEAKLHLVEKFMSV
fig|483218.5.peg.1861   Bacteroides pectinophilus ATCC 43243     MEKILEQTLLYDFYGELLTEHQKAVYSDVVFNDYSLSEVAEEYDISRQGVHDLIKRCNAILTGYEDKLHLVEKFM  
fig|478749.5.peg.1226   Bryantella formatexigens DSM 14469     MERIVEQTLLFDFYGELLTEHQRNVYEDVILNDCSCAEAAEQYHISRQGVHDLIRRCNRTLEDYEAKLHLVEKFLSI
fig|658083.3.peg.31   Lachnospiraceae bacterium 6_1_63FAA     MEKFVEQTLLYDFYGELLTVHQRRIYEDVVLNDYSLSEVADDLGISRQGVHDNIKRCNKALQDYEAKLHLVEKFLSI
fig|411459.7.peg.1339   Ruminococcus obeum ATCC 29174     MEKFVEQTLLYDFYGELLTERQQQVYESVVLEDYSLSEVAEDLGISRQGVHDMIKRCNHTLEEYESRLHLVEKFL  
fig|476272.5.peg.802   Blautia hydrogenotrophica DSM 10507     MEEFVKQTFLYDFYGELLTKRQRQVYESVVLEDYSLSEVAQELGISRQGVFDMIKRCNKTLEEYEKKLHLVEKFLHI
fig|457412.4.peg.1136   Ruminococcus sp. 5_1_39BFAA     MEKFVEQGYLYDFYGELLTERQQQVYESVVLEDYSLSEVAEDLGISRQGVHDMIKRCNKTLEEYEQKLHLVEKFLNI
fig|515620.4.peg.983   Eubacterium eligens ATCC 27750     MERIVEQNLLYDFYGELLNDHQKKIYEDAIYNDLSLSEIADEYGISRQGVHDLIKRVTKTLDGYEAKLHLIQKFLET
fig|411486.3.peg.1982   Clostridium sp. M62/1     MEKIVEQTLLYDFYGELLTDHQKEIYEDAVFNDLSLSEIADQQGISRQGVHDLIKRCDKTLAGYEEKLGLIRKFQRT
fig|457421.5.peg.5343   Clostridiales bacterium 1_7_47FAA     MEKIVEQGLLYDFYGELLTAHQRKVYEDVVFNDLSPSEIAGELGISRQGVHDLMKRCDKILEEYEAKLHLVAKFVKI
fig|518636.5.peg.4666   Clostridium asparagiforme DSM 15981     MEKIVEQGLLYDFYGELLTDHQRSVYEDVVFNDLSPSEIAKEQGISRQGVHDLIRRCNKILEEYEAKLHLVAKFVKI
fig|997895.4.peg.2335   Clostridium bolteae 90B3     MEKIVEQGLLYDFYGELLTEHQRRIYEDVVFGDLSPSEIAGEQGISRQGVHDLIKRCDKILKDYEAKLHLVAKFIKV
fig|411489.7.peg.906   Clostridium sp. L2-50     MEKIVRQSLLYDFYGELLTEHQKAIYEDVVNNDMSYSEIARMNQISRQGVYDMIKRCDKILEEYEDKLQLVDKFMK 
fig|411474.6.peg.1257   Coprococcus eutactus ATCC 27759     MEKIVRQSMLYDFYGELLTEHQKSVYEDVVNNDMSYSEIARLNNISRQGVYDMVRRCDKILEEYEEKLMLVHKFMK 
fig|411469.3.peg.1999   Eubacterium hallii DSM 3353     MDRIVEKSLLFDFYGELLTQHQKEVYGEYIQNDLSPTEIAVLRGISRQGAYDLIKRCEKILTDYENRLHLVEHFQKV
fig|411484.7.peg.1688   Clostridium sp. SS2/1     MERIVEQNLLYDFYGELLTAHQKEIYGEHILNDMTATEIAAEFGITRQAVHDMIRRCDKILADYEARLHLVAKFL  
fig|665937.3.peg.671   Anaerostipes sp. 3_2_56FAA     MEWIVEQTLLYDFYGELLTEHQKEIYEDHVLNDLSPSEIAGEHGITRQAAYDMIRRCNKILAGYERKLHLVEKFLRT
fig|357809.8.peg.2514   Clostridium phytofermentans ISDg     LQEVVTLSMLFDFYGELLGDHKKQVFSDYILNDYSLSEIADDTGLSRQGVHDIIKRCTRKLKEYEEKLRLVEKFNST
fig|411463.4.peg.1848   Eubacterium ventriosum ATCC 27560     MKDIFKSSLLYDFYGELLTEHQKEIYEDFILNDLSLGEIAQDRGISRQGVHDLVKRCDKILNGYEEKLHLVERFTKT
fig|626523.3.peg.878   Shuttleworthia satelles DSM 14600     MEEKIIRGYLYDFYGQLLNAHQREIYEAYAFDDLSLSEIAEQEGISRQGVYDIIRRCTRSLENYEQALHLVARFMKI
fig|515619.6.peg.1275   Eubacterium rectale ATCC 33656     MEEKLEQAYLYDFYGELLNEHQRQVYEDFVFNDLSLGEIASEEGISRQGVADLIKRCNKKLLDYEAKLHLVEKFMSI
fig|657315.3.peg.2148   Roseburia intestinalis M50/1     MEEKIEQAYLYDFYGELLNEHQRKIYEDFVFNDLSLGEIADEEGISRQGVHDMVKRCTKTLEGYESKLHLIEKFQ  
fig|622312.4.peg.53   Roseburia inulinivorans DSM 16841     MEEKIEQAYLYDFYGELLNEHQRRIYEDFVFNDLSLGEIANEEGISRQGVHDMIKRCTKSLEGYEEKLHLIAKFQS 
fig|511680.4.peg.36   Butyrivibrio crossotus DSM 2876     MEKIFEQAMLYDFYGELLKDNQKEVFENYVLDNLSLSEIAEERNISRQAVYDMIKRADRALNEYEDKLHLLEKFLTI
fig|585501.3.peg.331   Oribacterium sinus F0268     MEAFVEKGNLFLLYSGLLKEKQRQIYEYHILEDMSFTEIGLEMGITRQAAQAVFRKADEKLKFIEENLHLAEKWLSI
fig|608534.3.peg.1658   Oribacterium sp. oral taxon 078 str. F0262     MEDFVRKGNLYELYGGLLKENPRRVYEYHVVDDMSFSEIGEELSISRQAAQELFRRADRKLQSFEEILRLQEKLLRI
fig|592015.5.peg.1523   Anaerobaculum hydrogeniformans ATCC BAA-1850     LKSRIEMSLLYDIYGGLLTDKQRKAFELHEMSDWSLSEVADAIEVSRQGVFELLQRARKRLVEIEEVVGFKRTLLAL
fig|572547.3.peg.570   Aminobacterium colombiense DSM 12261     LEDRIYLNQLYDLYGALLTEKQRNAYEHHEFSDLSITETAERLDTTRQAAFDLISRA                    
fig|525903.6.peg.1419   Thermanaerovibrio acidaminovorans DSM 6589     LDERLRLCELYDLYGGLLTEKQRRAFELVVLEDCSLSEAAVELGVSRQGAHDLVQRSREHLVEAERALGVLEDRERL
fig|645512.3.peg.497   Jonquetella anthropi E3_33 E1     LEQRVKDAQLYDLYGPLLTGRQRRAFELHSDEDLSLSEMARELGTSRQAASALVQSSRAKLADYEALLGFCAKIRAV
fig|469381.5.peg.618   Dethiosulfovibrio peptidovorans DSM 11002     LDRRFYIAGLYDLYGPVLTEKQRRIYEMHDLQDLSLSEISDELGISRQGISDQLQRARDRLDELENLLGFFERS   
fig|352165.3.peg.1362   Pyramidobacter piscolens W5455     LERRVQLSRLYDLYGPLLTERQRRVYEMHELDDLSLSEIADELGISRQGVSDQLQRARDRLDEIETLLGCGERFRRI
fig|642492.3.peg.1487   Clostridium lentocellum DSM 5427     MEKFVVITYLFDFYQELLTDKQRDLLKEYYFEDLSLGELAEQHDISRQSAFDTIKKAEQKLLDYENKLALFAKYQAE
fig|500635.8.peg.1158   Mitsuokella multacida DSM 20544     MEQLLYLSALFDFYGALLTEKQQECLKMHLFEDFSLSEIGEELGISRQAVYDNIHRSEKAMESYEAKLGLVARYQKE
fig|546271.5.peg.1472   Selenomonas sputigena ATCC 35185     LERLFHLAELFDMYGMLLTEKQRRCLELHLFGDFSLAEVGEAVGVSRQAAYDIIHRSEQALEGYEEKLGLLRRLAKE
fig|585503.3.peg.1533   Selenomonas noxia ATCC 43541     MERLYYLARLYDLYGGLLTGKQRESLRLHIAEDFSLAEIGEELGITRQAAHDNIRRAERALTEMEETLGLLARQQAQ
fig|638302.3.peg.1891   Selenomonas flueggei ATCC 43531     MDQLYYRAKLYDFYGGLLTGKQRECLHLHIAEDFSLAEIGEELGITRQAAHDNIRRAERALAEMEETLGLFARQQEQ
fig|525919.4.peg.1781   Anaerococcus prevoti prevotii DSM 20548     MEKIVKVAQLFDIYGALLNEKQRDVINCYYNEDLSLQEIADNTDRSKQAISDMIKRSEDKLFEFEDELSLLKSREEL
fig|525255.3.peg.181   Anaerococcus tetradius ATCC 35098     MEKIVKVAQLFDIYGALLNEKQRDVINCYYNEDLSLQEIADNTARSKQAISDMMARSVDKLFEFEDELSLLKSREEL
fig|525254.4.peg.1776   Anaerococcus lactolyticus ATCC 51172     MEKIVKIAQLYDMYGPLLNDKQRDVINCYYNEDLSLQEIADSDGKSKQAISDMINRSVDKLFEFENELSLLKSKTEL
fig|561177.4.peg.3   Anaerococcus hydrogenalis DSM 7454     MEKLVQVARLFDTYGSLLNEKQKDVINCYYNEDLSLNEIAQNNNKSKQAISDMIQRSVDKLFEFENELSLLKKKDEL
fig|655811.4.peg.461   Anaerococcus vaginalis ATCC 51170     MEKLVQVARLFDTYGSLLNEKQKDVINCYYNEDLSLNEIAQNNNKSKQAISDMIQRSVDKLFEFENELSLIKKKNQL
fig|411465.10.peg.1338   Parvimonas micra ATCC 33270     MEKIVEIAVLFDYYGKLLSDKQYNVIDQHCNEDLSLKEIAELNGISKQGISDILSRAEKKLRFYEDELKLISKFDKI
fig|309798.3.peg.656   Coprothermobacter proteolyticus DSM 5265      EKVDRYVRLLDLYGKLLGKTEYEVAQAYLYYGLSVIEIASQRGTSRQAVAKQLDSAVRKLEQIEENVGFLR     
fig|334413.6.peg.728   Finegoldia magna ATCC 29328     MEKLLNITMMFDYYGKLLTKREYDVIDKYYNEDLSLNEIAQICDISKQAVSDSLKRAENKLYEYEQKLGLIEKSKK 
fig|592031.3.peg.483   Eubacterium saphenum ATCC 49989     IEKMTNILLALDYYDFLLTQAQSRIVRLYHESNLTFEEIGEELGMSKQNASNVYRKAVVRLGEAEDKLGLLKNEKN 
fig|596330.3.peg.1173   Peptoniphilus lacrimalis 315-B      DKFFRINTLMDFYGSLLPQKQRRVMSMYYIYDCSLNEIANEFNISKQAVSDNMKRAENNLENYEKKLKLIDITEKR
fig|575609.3.peg.681   Peptoniphilus sp. oral taxon 386 str. F0131     IDKVIEINTLLDFYGKLLSEKQERAITMYYIYDCSINEIAEELCISKQAVSDNIKRAEQKLIDYEKKLDLVKSYEER
fig|471871.7.peg.1183   Clostridium sporogenes ATCC 15579     MEEIVEMSLLLDFYGSLLTEKQNKIMDLYYNNDYSLKEISELTNTSRQAVHDIVKRCHKTLLQYEEKLHMMERFINL
fig|1232188.3.peg.27   Clostridium botulinum CFSAN001628           MSLLLDFYGSLLTEKQNKIMDLYYNNDYSLKEISELTNTSRQAVHDIVKRCHKALLQYEEKLHMMERFINL
fig|441771.4.peg.2138   Clostridium botulinum A str. Hall     MEEIVEMSLLLDFYGSLLTEKQNKIMDLYYNNDYSLKEISELTNTSRQAVHDIVKRCHKALLQYEEKLHMMERFINL
fig|441772.13.peg.2421   Clostridium botulinum F str. Langeland     MEEIVEVSLLLDFYGSLLTEKQNKIMDLYYNNDYSLKEISELTNTSRQAVHDIVKRCHKALLQYEEKLHMMERFINL
fig|445336.4.peg.3396   Clostridium botulinum Bf           MSLLLDFYGSLLTEKQNKIMDLYYNNDYSLKEISELTNTSRQAVHDIVKRCHKALIQYEEKLHMMERFINL
fig|498214.7.peg.2741   Clostridium botulinum A3 str. Loch Maree     MEEIVEMSLLLDFYGSLLTEKQNKIMDLYYNNDYSLKEISELTNTSRQAVHDIVKRCHKALIQYEERLHMMERFINL
fig|212717.1.peg.1100   Clostridium tetani E88     MEEKIEMSMLLDFYGILLTDKQKSIMNLYCNEDFSLAEISEHTKTSRQAVHDIIKRCGKLLKSYEEKLKLMGKHIE 
fig|536227.4.peg.773   Clostridium carboxidivorans P7     MEERVKLSILLDLYGELLTEKQKDVMDLYYNDDLSLSEISELTNTSRQAVHDIIKRCHKLLVQYEEKLDLM      
fig|431943.4.peg.1447   Clostridium kluyveri DSM 555     MEERIRLSILLDIYGELLTEKQRNVLDLYYNQDLSLAEIAEHTSTSRQAVYDIIKRCHMLLVHYEDKLNLMEEKKNI
fig|592027.3.peg.1077   Clostridium botulinum D str. 1873     MEDRIKISILMDYYGELLTEKQKYVMELYFNQDLSLAEISELTNTSRQAIYDIIKRCNKLLLDYEEKLKLANKNKRL
fig|445337.5.peg.2662   Clostridium botulinum C str. Eklund     MEDRIKISILMDYYRELLTEKQKYVMELYFNQDLSLAEISELTSTSRQAIYDIIKRCNKLLVDYEKKLNLARKNKEL
fig|386415.7.peg.1318   Clostridium novyi NT     MEDRIKISILMDYYRELLTEKQKYVMELYFNQDLSLAEISELTNTSRQAIYDIIKRCNKLLVDYEKKLNLARKNKEL
fig|991791.3.peg.1792   Clostridium acetobutylicum DSM 1731     MEERIYLSMLLSTYGSLLTEKQVNVMRLYYDDDLSMPEIAELNNTTRQAIHDLIKRCHKMLLNYENKLKLVEKYKR 
fig|290402.34.peg.1166   Clostridium beijerincki beijerinckii NCIMB 8052     MEDRVEISLLMDFYGPLLTEKQSEIMQWYYNDDLSLAEIAELNQTSRQAIHDLIKRCYKQLLSYESKLNLLQKSINR
fig|447214.4.peg.785   Clostridium butyricum 5521     MVDRVEVSLLMDYYGSLLTDKQRDIMEWYYNDDLSLAEIAEVNKTSRQAIHDLIKRCYKQLLSYESKLNLLQKSINR
fig|457396.3.peg.1702   Clostridium sp. 7_2_43FAA     MEDRVEISLLMDLYGPLLTEKQYKIMELYYNEDLSLAEIAELNNTSRQAIHDLIKRCYKQFLSYESKLNLLKKSFNQ
fig|536233.3.peg.2496   Clostridium botulinum E1 str. 'BoNT E Beluga'     MEDRVEISMLMDLYSSLLTEKQRSVMALYYDDDLSLAEIAELNKTSRQAIHDLIKRCDKQLLSYESKLNLLQKSMR 
fig|1221327.3.peg.1443   Clostridium botulinum CDC66177     MEDRVEISMLMDFYSSLLTEKQRSVMALYYDDDLSLAEIAELNKTSRQAIHDLIKRCDKQLLSYESKLNLLQKSMR 
fig|573061.5.peg.1949   Clostridium cellulovorans 743B     MDDRFEMSLLLDFYGVLLTEKQFDLMKLYYDEDLSLGEIAEINSTSRQATFDTIKRCHKLLYSYEEKLMLLKKSEEE
fig|195102.1.peg.1777   Clostridium perfringens str. 13     MENRFEISMLIDYYGTLLTEKQFNVMTLYYNEDLSLAEIAEINKTSRQAIYDLIKRCSKQLHSYDEKLKLSKKVDKR
fig|445334.5.peg.586   Clostridium perfringens C str. JGS1495     MENRFEISMLIDYYGTLLTEKQFNVMTLYYNEDLSLAEIAEINKTSRQAIYDLIKRCSKQLHSYDEKLKLSKKVDKR
fig|451754.5.peg.2018   Clostridium perfringens B str. ATCC 3626     MENRFEISMLIDYYGTLLTEKQFNVMTLYYNEDLSLAEIAEINKTSRQAIYDLIKRCCKQLHSYDEKLKLSKKIDKR
fig|451755.5.peg.3517   Clostridium perfringens E str. JGS1987     MENRFEISMLIDYYGTLLTEKQFNVMTLYYNEDLSLAEIAEINKTSRQAIYDLIKRCSKQLHSYDEKLKLSEKIDKR
fig|451757.5.peg.1511   Clostridium perfringens NCTC 8239                              MTLYYNEDLSLAEIAEINKTSRQAIYDLIKRCSKQLHSYDEKLKLSKKIDKR
fig|635013.3.peg.2203   Thermincola sp. JR                              MEMYYNNDLSLGEIAEEHSVSRQAVYDIIKRGEKILEEYENKLGLVKKFNKE
fig|350688.5.peg.1531   Alkaliphilus oremlandii OhILAs     LQKTIEISVLYDYYNQLLTEKQSDIIDLYYNQDLSLGEIAEEFNISRQAVYDMLKRTEKLLYQYEEKLGFIE     
fig|293826.4.peg.2652   Alkaliphilus metalliredigens QYMF     IEKTIQISMLYDFYNQLLTQKQREMVDLYHNQDLSLSEIAEEFEISRQAVYDTIKRTEKILYDYEEKLKLLDLFTN 
fig|373903.4.peg.781   Halothermothrix orenii H 168     LEKVIEMGMLFDFYGKLLTDRQQEVIYLYYYRDLSLGEIAEQLDISRQGVYDHIHRGEEVLKSYEQKLGLVSKYKRL
fig|203119.11.peg.813   Clostridium thermocellum ATCC 27405     MDKVYEAALLLDFYGQLLTKRQFEILDLYLNNDYSLGEIAEHLNISRQGVYDNIKRGRAMLDRMEEKLGLVHKFLQQ
fig|394503.7.peg.732   Clostridium cellulolyticum H10     MNKIYETSLLLDFYGQLLTERQYEILDLYYNNDFTFTEIAEQLNISRQGVFDNEKRGIAQLLEYENKLGLLGKFLHQ
fig|588581.3.peg.3395   Clostridium papyrosolvens DSM 2782     MNKIYETSLLLDFYGQLLTDRQYEILDLHYNNDFTLTEIAEQLNISRQGVYDNEKRGRALLVEYENKLGLLGKFSQQ
fig|246199.4.peg.3751   Ruminococcus albus 8     MAKSIEMYSLLDLYGKLLTEKQFNIMDLYYNDDLSLGEIAAECGISRQGVHDAVKHCEKALTEYEEKLGLLA     
fig|411483.3.peg.2255   Faecalibacterium prausnitzii A2-165     MAKDFEMGYLLDFYGEVLTPKQREMLNQYYNDDLSLSEIGENFGITRQGARDAIKHGETTLKELEAKVGFAGRYRRV
fig|411485.10.peg.109   Faecalibacterium prausnitzii M21/2     MAKDLEMGYLLDFYGEVLTQKQREMLRQYYNDDLSLSEIGENFGITRQGARDAIKHGETTLKELEEKVGFAARYRRV
fig|411471.5.peg.352   Subdoligranulum variabile DSM 15176      QKNLAYSVLLDFYGPVLTEKQRLILTEYYDEDLSLAEIAENFGITRQGVRDAIKHGEAALDELEAKLGNARHHTAT
fig|411471.5.peg.4076   Subdoligranulum variabile DSM 15176      QKNLAYSVLLDFYGPVLTEKQRLILTEYYDEDLSLAEIAENFGITRQGVRDAIKHGEAALDELEAKLGNARHHTAT
fig|663278.4.peg.2263   Ethanoligenens harbinense YUAN-3      EKNLEISFLLDFYGEILTEKQREVIELYYNDDLSLAEIAEHAGITRQGVRDAIKRGESTLLFMEEKLGLAAKFDAM
fig|428125.8.peg.1688   Clostridium leptum DSM 753     MEKNLNVSILLDFYGAMLTEKQREAVEYYYNDDLSLSEIADNQGISRQGVRDAIKRAEALLFEMEECLGFARRFR  
fig|411467.6.peg.1645   Bacteroides capillosus ATCC 29799         YRMALLFDFYGDMLTDRQKEFFDLYYNEDLSLAEIAENYDITRQGVRDVIVRAEGIMQELEDKTGIIRRFQKM
fig|641112.4.peg.3741   Ruminococcus flavefaciens FD-1     MAKELKFVMLLDCYGDLLTDHQRSVMELYYCEDLSLAEIGDPLGITRQAVRSLIKRTEDILLHYEDKLGFAERLGKM
fig|445972.6.peg.780   Anaerotruncus colihominis DSM 17241     MAKNLEISVLLDFYGEMLTEKQRDVVELYYNEDLSLSEIAAHSQITRQGVRDSIKRAEGI                 
fig|428128.7.peg.1820   Eubacterium siraeum DSM 15702     MSKNIENAILLDTYGSMLTEKQYDTLSLYYDEDLSLSEIAENMGITRQGVHKCIRTAEEYLAQLEETLGFAQKYRNV
fig|537013.3.peg.1524   Clostridium methylpentosum DSM 5476     MSKNLEVSPLLDYYGGMLTEKQRDLAKLYYNEDLSLAEIAELTGITRQGVHDSIKRTESMLLEYEKNIGIARKTAET
fig|445971.6.peg.2166   Anaerofustis stercorihominis DSM 17244     MEKYFKMSYLIDIYSSLLTDKQLKVLEYYYNDDISLSEIASMLNISRQGVYDTLKRAEKIISEYDDKLNLLEKYER 
fig|1214564.3.peg.650   Caldicellulosiruptor sp. F32      ENKVYLSLLYDFYKDFLTERQKKIIELYVNEDLTLGEISKELGISRQGVFDAFRKAEIALKRYEAKLKLADKYYK 
fig|351627.4.peg.2076   Caldicellulosiruptor saccharolyticus DSM 8903      ENKVYLSLLYDFYKDFLTERQKKIIELYVNEDLTLGEISKELGISRQGVFDAFRKAEIALKRYEAKLKLADKYYK 
fig|521460.8.peg.1029   Anaerocellum thermophilum DSM 6725      ENKVYLSLLYDFYKDFLTERQKKIIELYVNEDLTLGEISKELGISRQGVFDAFRKAKIALKRYEAKLKLADKYYK 
fig|1198630.3.peg.68   Thermoanaerobacter thermohydrosulfuricus WC1      DDFLFMTLLYDFYGALLTDKQREIFEMYYLNDYSLGEISELLDISRQGVYDTLKRAESSLEFFEEKLGLVKRHQEI
fig|589861.3.peg.141   Thermoanaerobacter ethanolicus CCSD1      DDFLFMTLLYDFYGALLTDKQREIFEMYYLNDYSLGEISELLDISRQGVYDTLKRAESSLEFFEEKLGLVKRHQEI
fig|580331.4.peg.1285   Thermoanaerobacter italicus Ab9      EDFLFMTLLYDFYGALLTDKQREIFEMYYLNDYSLGEISELLDISRQGVYDTLKRAESSLEFFEEKLGLVKRHQEI
fig|273068.5.peg.1472   Thermoanaerobacter tengcongensis MB4      DDFLFMTLLYDFYGALLTDKQREIFEMYYLNDYSLGEISEILDISRQGVYDALKRAEDSLEFYEEKLGLVKKHQEM
fig|698948.3.peg.1433   Thermoanaerobacterium thermosaccharolyticum M0795       DFVEMNVLFDFYGSLLTGKQMDIFKMYYMDDYSLGEISQELNISRQGVYDSLKRAESVLRFYEEKLGLVKKY   
fig|1035196.3.peg.1001   Peptostreptococcus anaerobius VPI 4330     IQKMVEIEILYAQYGPLLTEKQRDILSMYYEEDYSLGEISNILGTSRQSIFDSLRRSEKSLRDYEDKLGMAKKLSKI
fig|546269.3.peg.482   Filifactor alocis ATCC 35896     LEKFVEIELLFSLYQQLLTEKQRQVMEYYYQEDYSLSEISDLLGISRQAVHDNIKRTEIQLFEYESKLRLSDKLSKT
fig|445973.7.peg.2085   Clostridium bartlettii DSM 16795     IEKMVEIGLLFEQYKELLTEKQREMVSLYYEEDYSLGEISENLGVSRQGVYDTLKRSEKILREYENKLHLVAKLKEQ
fig|500633.7.peg.932   Clostridium hiranonis DSM 13275     LEKMIEVGQLFEVYKDLLTDKQKEIVSLYYEEDYSLGEISENLNVSRQGVYDTLKRAEKVMKDYEQKLHLLSELQK 
fig|1496.1.peg.39   Clostridium difficile 630                             IVALYYEEDYSLGEISENLNVSRQGVYDTLKRSEKILRDYEEKLHLVSKIQEQ
fig|479831.4.peg.406   Clostridium difficile QCD-63q42     IEKMVEIGLLFEQYKELLTDKQKEIVALYYEEDYSLGEISENLNVSRQGVYDTLKRSEKILRDYEEKLHLVSKIQEQ
fig|997827.4.peg.1899   Clostridium difficile 002-P50-2011     IEKMVEIGLLFEQYKELLTDKQKEIVALYYEEDYSLGEISENLNVSRQGVYDTLKRSEKILRDYEEKLHLVSKIQEQ
fig|457570.7.peg.1380   Natranaerobius thermophilus JW/NM-WN-LF     LEKTNKLIMLFDFYGELLTPRQKEIFKLYYYEDFSLGEISELEGISRQAVYDLLQRCEELLQDYESRLGFVDRF   
fig|457570.14.peg.1402   Natranaerobius thermophilus JW/NM-WN-LF     LEKTNKLIMLFDFYGELLTPRQKEIFKLYYYEDFSLGEISELEGISRQAVYDLLQRCEELLQDYESRLGFVDRF   
fig|292459.5.peg.1460   Symbiobacterium thermophilum IAM 14863     MKDVQRIALLFDFYGPLLTERQQELIRAYYLEDHSLAEIADADGVSRQAVHELIRRSEAALQEYEQRLGFVAEHQRR
fig|335541.7.peg.1608   Syntrophomonas wolfei subsp. wolfei str. Goettingen     LEKTEHMIMLKDFYGPLLTLKQQDLMSLYYEDDWSLSEIAENRGTSRQAVYDVLKRAETALQEYEERLGLVDKFI  
fig|643648.3.peg.938   Syntrophothermus lipocalidus DSM 12680     LEKIERMAWLFDFYGPLLTDKQRRIVELHYENDWSLGEIAAEFGVSRQAIYDILKRAEKALEHYEQRLGLVGKFM  
fig|498761.4.peg.1975   Heliobacterium modesticaldum Ice1     LEKLTRMALLNDFYGQLLTERQRQVLSLYYEDNFSLAEIAEEFSVTRQAVFDLLKRAEKILLGYEDKLGLVKRWQ  
fig|272564.4.peg.1122   Desulfitobacterium hafniense DCB-2           MALLADFYGPLLTPKQGRIWDLHYEQDFSLVEIADLEKISRQAVYDLLKRTEKILQGYEDKLGLIRRF   
fig|537010.4.peg.2781   Desulfitobacterium hafniense DP7     MERFAKMALLADFYGPLLTPKQGRIWDLHYEQDFSLVEIADLEKISRQAVYDLLKRTEKILQGYEDKLGLIRRF   
fig|264732.9.peg.945   Moorella thermoacetica ATCC 39073     LDDLARVARLYDFYGPLLTPKQRHWLELHYHHDLSLGEIAGEEGISRQAVYDGLQRAVKALEEYESRLGYLRRDMAL
fig|555088.4.peg.1929   Dethiobacter alkaliphilus AHT 1     LEDTTRINMLYDFYGNLLTDKQRECLELYYQDDLSLAEIADNSGISRQGVHDLIKRAVKTLEKAEEKLALVKRFMDQ
fig|562970.4.peg.1517   Bacillus tusciae DSM 2912     LEKTTRVNLLYDHYGALLTEKQRRFVELHYLEDLSLGEIAIQFGVSRQAVHDHLKRAVDQLEQYEAALGLVSRHMRR
fig|485916.5.peg.1202   Desulfotomaculum acetoxidans DSM 771     LEKVAWVTLLYDFYGQLLTEKQQKFLELYYEDDLSLGEIADKFTVSRQAVHDSLKRAVQILVKYEEELGLAANFTEQ
fig|485916.4.peg.1487   Desulfotomaculum acetoxidans DSM 771     LEKVAWVTLLYDFYGQLLTEKQQKFLELYYEDDLSLGEIADKFTVSRQAVHDSLKRAVQILVKYEEELGLAANFTEQ
fig|477974.3.peg.619   Desulforudis audaxviator MP104C     MDRFAWINLLYDFYGPLLTDRQRQLLELYYEQDYSLGEIAGELSVTRQAVHDTLKRAEESLEYFERKLNLAMRYLN 
fig|349161.4.peg.2022   Desulfotomaculum reducens MI-1     MKEFHKINLLNDYYGSLLTERQQNFIELYYGEDLSLGEIAEQYNVTRQAVHDTLKRAEQTLTNYEEKLGLVSKFSQE
fig|370438.4.peg.1939   Pelotomaculum thermopropionicum SI     IEKVALMNLLYDFYGQLLTERQKNFIELYYCQNLSLGEIADEYAVTRQAVHDTLKRAEQLLCEYEKKLGLVEKFNN 
fig|457416.3.peg.1764   Veillonella sp. 3_1_44     MEERVLISLLLDFYGPLLTDKQRMSLQLHHEDDMSLGEIAEELGVSRQAVHDNLQRARHILNDYESKLHLVAQYEQR
fig|546273.3.peg.1469   Veillonella dispar ATCC 17748     MEERVLISLLLDFYGPLLTDKQRMSLQLHHEDDMSLGEIAEELGVSRQAVHDNLQRARHILNDYESKLHLVAQYEQR
fig|479436.4.peg.876   Veillonella parvula DSM 2008     MEERVLISLLLDFYGPLLTDKQRMSLQLHHEDDMSLGEIAEELGVSRQAVYDNLQRARHILNDYESKLHLVAQYEQR
fig|521098.5.peg.1308   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446     MRDVTRVGDLYAFYEPLLTERQRQIVELYHFEDMSLGEIAEILSISRQAVHDQLRRVEDQLESYEAALHLRE     
fig|521098.4.peg.2804   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446     MRDVTRVGDLYAFYEPLLTERQRQIVELYHFEDMSLGEIAEILSISRQAVHDQLRRVEDQLESYEAALHLRE     
fig|592028.3.peg.1767   Dialister invisus DSM 15470     LENIVQKGELLDCYGALLTVRQRECLELYYNENLTLAEIAEYFHISRQAVHDAMRHGEEQLENYEAALHVAAARLKR
fig|401526.3.peg.584   Thermosinus carboxydivorans Nor1     LDKVLRIGVLYDYYGALLTNRQKECLEMHYFQDYSLSEIAEEFNVSRQAVHDILRRAELILEEFEAKLRLVERRQSE
fig|592026.3.peg.89   Catonella morbi ATCC 51271     LAKVMRVNQLLGFYGGLLTDKQQAMLGLYYEEDFSLAEIADHYDISRQAVRDNLKRAEQTLEHYEDQLHLLARREAR
fig|393480.8.peg.1660   Fusobacterium nucleatum subsp. polymorphum ATCC 10953     LDEFVEIANLLEIYSSLLSEKQKEYLEDHFENDLSLSEIAKNNNVSRQAIYDNIKRGVALLYDYEDKLKFYQ     
fig|190304.8.peg.1956   Fusobacterium nucleatum subsp. nucleatum ATCC 25586     LDEFVEIANLLEIYSSLLSEKQKEYLEDHFENDLSLSEIAKNNNVSRQAIYDNIKRGVALLYDYEDKLKFYQ     
fig|469599.3.peg.1642   Fusobacterium sp. 2_1_31     LDEFIEIANLLEIYSPLLSEKQREYLEDHFENDLSISEIAKNNNVSRQAIFDNIKRGVALLYEYENKLKF       
fig|546275.3.peg.129   Fusobacterium periodonticum ATCC 33693     LDEFIEIANLLEIYSPLLSEKQREYLEDHFENDLSISEIAKNNNVSRQAIFDNIKRGVALLYEYENKLKF       
fig|469602.7.peg.2009   Fusobacterium nucleatum subsp. vincentii 3_1_27     LDEFVEIANLLEIYSSLLSEKQKEYLEDHFENDLSLSEIAKNNNVSRQAIYDNIKRGMALLYDYESKLKFYQ     
fig|469604.3.peg.1433   Fusobacterium sp. 3_1_36A2     LDEFVEIANLLEIYSSLLSEKQKEYLEDHFENDLSLSEIAKNNNVSRQAIYDNIKRGMALLYDYESKLKFYQ     
fig|469606.8.peg.1558   Fusobacterium nucleatum subsp. vincentii 4_1_13     LDEFVEIANLLEIYSSLLSEKQKEYLEDHFENDLSLSEIAKNNNVSRQAIYDNIKRGMALLYDYESKLKFYQ     
fig|469603.7.peg.1573   Fusobacterium nucleatum subsp. animalis 3_1_33     LDKFVEIANLFEIYSSLLSEKQKEYLEDHFENDLSLSEIAKNNNVSRQAIYDNIKRGIALLYDYEDKLKFYQ     
fig|457403.8.peg.1801   Fusobacterium nucleatum subsp. animalis 11_3_2     LDKFVEIANLFEIYSSLLSEKQKEYLEDHFENDLSLSEIAKNNNVSRQAIYDNIKRGIALLYDYEDKLKFYQ     
fig|556263.8.peg.236   Fusobacterium necrophorum D12     LQEFLEIGSLLELYKNLLSEKQKEYLIEHFEKDYSLSEIANTHNVSRQAVSDNIKRGIKLLNEYEKKLKMFEQKRKL
fig|469605.3.peg.1060   Fusobacterium sp. 3_1_5R     LQEFLEIGSLLELYKNLLSEKQKEYLIEHFEEDYSLSEIATTHNVSRQAVSDNIKRGIKVLNDYEKKLKMFEQKRKL
fig|469618.3.peg.774   Fusobacterium varium ATCC 27725     LDEFLEVSTLLDYYKNLLSDKQREYLINHFEEDLSLSEIAKNNNVSRQAVYDNIKRGIKLLKDYEERLGFHEREKQI
fig|457404.3.peg.2296   Fusobacterium sp. 12_1B     LDEFLEVSTLLDYYKNLLSDKQREYLINHFEDDLSLSEIAKNNDVSRQAVYDNIKRGIKLLKDYEEKLGFHEKEKQV
fig|469616.3.peg.431   Fusobacterium mortiferum ATCC 9817     LDEFLEVSTLLDYYRNLLSDKQKEYLINHFEEDLSLSEIAKNNGVSRQAVYDNIKRGIKQLREYEEKLGFHERERRV
fig|519441.4.peg.1325   Streptobacillus moniliformis DSM 12112     IEEYIKYSILFIYYKELFSDKQKKYLSAYLEEDNSLTEIAEAFNVSRQAVFDNIKRGCKQLDKYEKLLGVMEREENI
fig|526218.4.peg.3436   Sebaldella termitidis ATCC 33386     LADFLKYSNLFFYYKNLFSKKQKIYLELYFEEDYSFSEIAEEYGVTRQAVFDNIKRGMKQLDDYENKLNIYKR    
fig|634994.3.peg.2720   Leptotrichia hofstadii F0254     LENFLKYSVLFSYYGELFPKKKRQYLELYLEENSSLSEIAEQCGVTRQAVFDNIKKGVQKLDEYENKLGIFEKEKEL
fig|523794.4.peg.565   Leptotrichia buccalis DSM 1135     LDDFLKYSVLFSYYGELFPKKKKQYLELYLEENSSLSEIAEQYGVTRQAVFDNIKKGVKKLDEYESKLRIFEKEREL
fig|523794.5.peg.180   Leptotrichia buccalis C-1013-b     LDDFLKYSVLFSYYGELFPKKKKQYLELYLEENSSLSEIAEQYGVTRQAVFDNIKKGVKKLDEYESKLRIFEKEREL
fig|708616.3.peg.181   Mycoplasma gallisepticum str. F     FEQWNLLNELFSYYHKLLSDKIKLYLEEFLINNLSYNEIATNYQISKYAVYDQIQKGIEQLKNYEQLLLLNQLSKQR
fig|233150.3.peg.167   Mycoplasma gallisepticum R     FEQWNLLNELFSYYHKLLSDKIKLYLEEFLINNLSYNEIATNYQISKYAVYDQIQKGIEQLKNYEQLLLLNQLSKQR
fig|546270.5.peg.1577   Gemella haemolysans ATCC 10379     IEQVIKISQLYDFYSELLSDKQRQYLDDYYFNDLSLTEISENYNISKQAVSNNIKRTILELEQFEEKLNLIKLNNQR
fig|272633.1.peg.485   Mycoplasma penetrans HF-2          QISLLIDFYGNLLTDKQLQNLIDYYFNDLSLSEIAANNNVSRTAIHDSIKKSKNELEQFENKLKFIYRFNLR
fig|273035.4.peg.1440   Spiroplasma kunkelii CR2-3x     LANSNELILLYELYWKLLTTKQIKYFELYFFDDYSLSEIAGLKNVSRNAVYDSLVKITNALHKFENNLKLGYKQHQR
fig|550748.3.peg.124   Ureaplasma urealyticum serovar 4 str. ATCC 27816           MIALYDIYQGLLTTKQCEYFNLHYFKDLSFSEIAELKEVSKSAISDCLNKVCDQLLKYEQALLIYEKNKKR
fig|95667.5.peg.142   Ureaplasma urealyticum serovar 13      NKRWYLIALYDIYQGLLTTKQCEYFNLHYFKDLSFSEIAELKEVSKSAISDCLNKVCDQLLKYEQALLIYEKNKKR
fig|273119.1.peg.143   Ureaplasma parvum serovar 3 ATCC 700970      NKRWYLIALYDIYQGLLTTKQCEYFNLHYFKDLSFSEIAELKEISKSAISDCLNKVCDQLLKYEQALLIYEKNKKR
fig|203120.4.peg.1530   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293     LAKKTHINELFGFYEKLLTDKQQAYLRYYFEDDYSIVEIAEAETVSRQAVSDNINRAIEQLEKYENILHLQVDFAKR
fig|586220.3.peg.402   Leuconostoc mesenteroides subsp. cremoris ATCC 19254     LAKKTHINELFGFYEKLLTDKQQAYLRYYFEDDYSIVEIAEAETVSRQAVSDNINRAIEQLEKYENILHLQVDFSKR
fig|1127129.3.peg.1449   Leuconostoc citreum LBAE E16     FEEKNRINGLFGFYGELLTTKQQDYLRYYFEDDYSIVEIAEAELVSRQAVSDNIKRGIDQLVKYEHVLHLQRNFEAR
fig|762051.3.peg.1586   Leuconostoc kimchii IMSNU11154     FEEKNRINALFGFYGALLTPKQQAYLRSYFEDDYSIVEIAEAETVSRQAVSDNIRRGIDQLVKYESILHLQSDFEAR
fig|1206769.3.peg.636   Oenococcus oeni AWRIB418     LAEKQLSTELFAFYGPLISKKQQNDLQALLVDDLGVSEIAENEGISRQAVSDRIRHALDSLNEFESKLHLRENYLER
fig|665945.3.peg.942   Lactobacillus sp. 7_1_47FAA     LQKNELYSNLYGFYGKLLTKRQQDYFEDYYYSDLSLGEIADNHGVSRQAVFDNLKRSCKLLNNFETKLRMKSDY   
fig|596325.3.peg.413   Lactobacillus jensenii 269-3     LIKNEELADLYSFYGQLLTKGQQAYFEDYYYDDLSLGEIADNHGVSRQAVYDNLRRSSKSLENYEKKLHLKRDYLQM
fig|575606.3.peg.292   Lactobacillus jensenii 27-2-CHN     LIKNENLADLYSFYGQLLTKGQQAYFEDYYYDDLSLGEIADNHGVSRQAVYDNLRRSSKSLENYEKKLHLKSDYVKM
fig|585524.3.peg.331   Lactobacillus amylolyticus DSM 11664     LTKNEKLGDLYAYYGSLLTAGQQSYFEDYYYNDLSLGEIADNHGVSRQAVYDNLRRSSKALENYEAKLHMQKDYNQI
fig|575595.3.peg.521   Lactobacillus crispatus 125-2-CHN     LTKNEELGDLYAYYGSLLTQGQQSYFEDYYYNDLSLGEIAANHQVSRQAVYDNLKRSSKILQNYEEKLHMKRDNNQV
fig|748671.3.peg.1275   Lactobacillus crispatus ST1     LTKNEELGDLYAYYGSLLTRGQQSYFEDYYYNDLSLGEIAANHQVSRQAIYDNLKRSSKILQNYEEKLHMKRDNNQV
fig|405566.6.peg.1451   Lactobacillus helveticus DPC 4571     LTKNEELGDLYAYYGSLLTKGQQSYFEDYYYNDLSLGEIAVNHDVSRQAIYDNLKRSSKILQNYEAKLHMRRDNNHI
fig|525365.3.peg.1326   Lactobacillus ultunensis DSM 16047     LTKNEELGDLYAYYGSLLTDGQKSYFEDYYYNDLSLGEIAINHHVSRQAVYDNLKRSSKILQNYESKLHMRRDNDHI
fig|525306.3.peg.989   Lactobacillus acidophilus ATCC 4796     LTKNEELGDLYAYYGSLLTKGQQSYFEDYYYNDLSLGEIAINHHVSRQAVYDNLKRSSKSLQNYEEKLHMRKD    
fig|321956.5.peg.1112   Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365     LSKNEALGDLYAMYSALLTQGQQDYFEDYYYNDLSLGEIADNRHVSRQAVYDNLRRSAKSLEKYEDKLRLLASYSQL
fig|390333.6.peg.1224   Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842     LSKNEALGDLYAMYSALLTHGQQDYFEDYYYNDLSLGEIADNRHVSRQAVYDNLRRSAKSLEKYEDKLRLLASYSQL
fig|1334627.3.peg.559   Lactobacillus gasseri K7     LEKNERLGDLFAYYGPLLTKGQQDYFEDYYYNDLSLGEIADNHHVSRQAVYDNLKRSSKALEKYEDKLHMKRDYIRI
fig|324831.13.peg.766   Lactobacillus gasseri ATCC 33323     LEKNERLGDLFAYYGPLLTKGQQDYFEDYYYNDLSLGEIADNHHVSRQAVYDNLKRSSKALEKYEDKLHMKRDYTRI
fig|633699.4.peg.679   Lactobacillus johnsonii FI9785     LEKNERLGNLFAYYGPLLTKGQQEYFEDYYYNDLSLGEIADNHHVSRQAVYDNLKRSSRALEKYEDKLHMKRDYTQI
fig|909954.3.peg.745   Lactobacillus johnsonii DPC 6026     LEKNERLGDLFAYYGPLLTKGQQEYFEDYYYNDLSLGEIADNHHVSRQAVYDNLKRSSRALEKYEDKLHMKRDYTQI
fig|568816.4.peg.386   Acidaminococcus intestini RyC-MR95     FAKRIRIGRLYDVYGSLLTVRQQKIMEQYFYDDLSLGEIADAGGTSRQAVYDLLKRVEESLEKYEKKLRVLQKEESM
fig|591001.3.peg.493   Acidaminococcus fermentans DSM 20731     FEKRIRFGQLYAIYGGLLTEKQQKIMEEYFYDDLSLGEIAENTRTSRQAVYDLLRRVEQTLEKYESRLHLLHQDQER
fig|441768.5.peg.332   Acholeplasma laidlawii PG-8A     LEKTEYLNTLYSFYSELLTDKQQAYYTNYYHMDLTLQEIADIFDVSRNAVHTQLKNVEQILNNFEAKLKLVETSQKR
fig|1213463.3.peg.239   Mycoplasma pneumoniae 19294     LNQRLKQQQLFDIYGELLTKRQACYFNEYINLDLSMQEIADKYQVKKSSIHQHIKTCNLIFNRFEAKLQLFKKQQLR
fig|679192.3.peg.1131   Bulleidia extructa W1219     MSDKLYYDQLLDFYEELLSQSQQEMVKYYYRQDLSLQEISELEGVSRSAIYDRLKRIRLELDHLEKVLGLYRKKEKR
fig|469597.4.peg.1411   Coprobacillus sp. 8_2_54BFAA     LEKKQRVNLLMDCYSDLLTEKQQTYLEYYYQEDYSLSEIAQILDVSRNAVFDNLKKAVHSLENYEEKLQLLKKHQER
fig|556270.3.peg.1516   Mollicutes bacterium D7     LEKKQRVNLLMDCYSDLLTEKQQTYLEYYYQEDYSLSEIAQILDVSRNAVFDNLKKAVHSLENYEEKLQLLKKHQER
fig|428126.7.peg.62   Clostridium spiroforme DSM 1552     LEKKQRVNLLMDCYGDLLTEKQQMYLDYYYHDDYSLSEIAEILDVSRNAVFDNLKKAVHLLENYEEKLQLMKKHQER
fig|451640.5.peg.410   Catenibacterium mitsuokai DSM 15897     LKKKEQVILLMDCYRELLTDKQKQYLTLYYEEDLSLSEIAEDLGVSKNAVFDNIKRSVMSLEKYESKLHILENHRKR
fig|457402.3.peg.1166   Eubacterium sp. 3_1_31     IEKTEEMNALLDFYETLLTEKQAEVMKLYYQEDFSLSEIAETLAISRSAVSDHMKRSSLILQEYEKKLHLVQNYETR
fig|428127.7.peg.1219   Eubacterium dolichum DSM 3991     IDETQRINLLLDLYEPLLTPKQQHVMDLHFKEDFSLSEISEQLGISRAAVNDHIKRSTAFLENYEKKLQLVVNLEKR
fig|545696.5.peg.2891   Holdemania filiformis DSM 12042     LAQTERMNLLIDFYGTLLTEKQRTILDYYFQEDYSLSEIAELQQTSRSAVYDLLKRCEKILEDYESKLHLLRHYQVR
fig|910310.3.peg.251   Turicibacter sp. HGF1     LEKVNRMNELYDAYQVLLTSKQKTYLELYYQEDLSLSEIAEQFEVSRNAVFDNIKRTEKLLEDYETKLQLLKKREIR
fig|908341.3.peg.5410   Paenibacillus sp. HGF5     LEKTNRINLLFDFYEQLLTEKQQTFLKYYFHDDFSLGEIAGEFEISRQAVYEHIKRAEQVLESYEEKLGLLSKHEAR
fig|324057.4.peg.3474   Paenibacillus sp. JDR-2     LAKTTRINLLFDFYEPLLTEKQRTFLKYYFHDDYSLGEIAAESGISRQAVYEHVKRAEQVLEGYEAKLSLVAKHESM
fig|621372.3.peg.121   Paenibacillus sp. oral taxon 786 str. D14     LEKTNRINLLFDFYEALLTEKQQTFLKYYFLDDFSLGEIAAEFEISRQAVYEHIKRAEGMLETYEEKLGLLKKHEAR
fig|358681.3.peg.3585   Brevibacillus brevis NBRC 100599     LEKTNQVNLLFDFYAPLLKGKQREYLELYYLDDLSLGEIAEMHEVSRQAVYDHIKRAEKQLFEYDQKLRLAERHENR
fig|40041.11.peg.1010   Streptococcus equi subsp. zooepidemicus     IEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIAEEFGVSRQAVYDNIKRTEKILEAYEMKLHMYSDYIVR
fig|1074494.5.peg.794   Streptococcus salivarius M18     IEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIAEEFGVSRQAVYDNIKRTEKILEAYEMKLHMYSDYIVR
fig|471872.6.peg.1029   Streptococcus infantarius subsp. infantarius ATCC BAA-102     IEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIAEEFGVSRQAVYDNIKRTEKILEAYEMKLHMYSDYIVR
fig|637909.5.peg.1070   Streptococcus gallolyticus UCN34     IEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIAEEFGVSRQAVYDNIKRTEKILEAYEMKLHMYSDYIVR
fig|1051072.7.peg.1107   Streptococcus equi subsp. zooepidemicus ATCC 35246     IEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIAEEFGVSRQAVYDNIKRTEKILEAYEMKLHMYSDYIVR
fig|205921.3.peg.974   Streptococcus agalactiae A909           MNALFEFYAALLTDKQMNYIELYYADDYSLAEIAEESGVSRQAVYDNIKRTEKILEAYEMKLHMYSDYIVR
fig|1154853.3.peg.1513   Streptococcus agalactiae STIR-CD-25     IEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIAEESGVSRQAVYDNIKRTEKILEAYEMKLHMYSDYIVR
fig|1349.21.peg.1487   Streptococcus uberis     IEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIAEEFGVSRQAVYDNIKRTEKILESYEMKLHMYSDYIVR
fig|617121.3.peg.994   Streptococcus dysgalactiae subsp. equisimilis RE378     IEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIAEEFGVSRQAVYDNIKRTEKILETYEMKLHMYSDYIVR
fig|370554.3.peg.1065   Streptococcus pyogenes MGAS10750     IEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIADEFGVSRQAVYDNIKRTEKILETYEMKLHMYSDYVVR
fig|160491.17.peg.919   Streptococcus pyogenes str. Manfredo     IEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIADEFGVSRQAVYDNIKRTEKILETYEMKLHMYSDYVVR
fig|286636.1.peg.905   Streptococcus pyogenes MGAS10394     IEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIADEFGVSRQAVYDNIKRTEKILETYEMKLHMYSDYVVR
fig|1313.5.peg.909   Streptococcus pneumoniae OXC141           MNALFEFYAALLTDKQMNYIELYYADDYSLAEIAEEFGVSRQAVYDNIKRTEKILEDYEMKLHMYSDYIVR
fig|469609.3.peg.694   Streptococcus sp. 2_1_36FAA     IEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIAEEFGVSRQAVYDNIKRTEKILEDYEMKLHMYSDYIVR
fig|299768.3.peg.1770   Streptococcus thermophilus CNRZ1066     IEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIAEEFGVSRQAVYDNIKRTEKILEDYEMKLHMYSDYIVR
fig|864570.3.peg.1308   Streptococcus sp. oral taxon 071 str. 73H25AP     IEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIAEEFGVSRQAVYDNIKRTEKILEDYEMKLHMYSDYIVR
fig|1315309.3.peg.1278   Streptococcus pneumoniae MNZ37     IEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIAEEFGVSRQAVYDNIKRTEKILEDYEMKLHMYSDYIVR
fig|561276.4.peg.1256   Streptococcus pneumoniae ATCC 700669     IEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIAEEFGVSRQAVYDNIKRTEKILEDYEMKLHMYSDYIVR
fig|760842.3.peg.1231   Streptococcus pneumoniae GA47597     IEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIAEEFGVSRQAVYDNIKRTEKILEDYEMKLHMYSDYIVR
fig|467705.8.peg.1084   Streptococcus gordonii str. Challis substr. CH1     IEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIAEEFGVSRQAVYDNIKRTEKILEDYEMKLHMYSDYIVR
fig|760570.3.peg.840   Streptococcus parasanguinis ATCC 15912     IEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIAEEFGVSRQAVYDNIKRTEKILEDYEMKLHMYSDYIVR
fig|388919.9.peg.1108   Streptococcus sanguinis SK36           MNALFEFYAALLTDKQMNYIELYYADDYSLAEIAEEFGVSRQAVYDNIKRTEKILEDYEKKLHMYSDYIVR
fig|388919.8.peg.1043   Streptococcus sanguinis SK36     IEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIAEEFGVSRQAVYDNIKRTEKILEDYEKKLHMYSDYIVR
fig|1005042.3.peg.975   Streptococcus suis D9     IEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIAEEFQVSRQAVYDNIKRTEKLLEDYEMKLHMYSDYVVR
fig|218494.4.peg.774   Streptococcus suis P1/7     IEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIAEEFQVSRQAVYDNIKRTEKLLEDYEMKLHMYSDYVVR
fig|1074130.3.peg.867   Streptococcus mutans TCI-154     IEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIAEEFDVSRQAVYDNIKRTEKILEDYEMKLHMYSDYVVR
fig|272623.7.peg.1541   Lactococcus lactis subsp. lactis Il1403     IEKTNRMNTLFEFYATLLTDKQMNYIELYYADDYSLAEIAEEFNISRQAVYDNIKRTEKVLESYEEKLHLFSNYVVR
fig|1104322.3.peg.1131   Lactococcus lactis subsp. cremoris A76     IEKTNRMNTLFEFYATLLTDKQMNYIELYYADDYSLAEIAEEFNISRQAVYDNIKRTEKVLESYEEKLHLFSNYVVR
fig|749503.3.peg.2252   Enterococcus faecalis TX0309A     MEKTNRMNALFEFYSTLLTEKQMNYMELYYADDFSLGEIAEEYEVSRQAVYDNIKRTEKILEEYEKKLHLYSNYVVR
fig|1169310.3.peg.1563   Enterococcus faecalis D173     MEKTNRMNALFEFYSTLLTEKQMNYMELYYADDFSLGEIAEEYEVSRQAVYDNIKRTEKILEEYEKKLHLYSNYVVR
fig|742813.4.peg.1783   Enterococcus saccharolyticus 30_1     IEKTNRMNALFEFYSTLLTEKQMNYMELYYADDFSLGEIAEEYHVSRQAVYDNIKRTEKILEDYEKKLHMFSDYMMR
fig|888066.3.peg.2612   Enterococcus casseliflavus ATCC 12755     IEKTNRMNALFEFYSTLLTEKQMNYMELYYADDFSLGEIAEEYQVSRQAVYDNIKRTERILEDYEKKLHMFSDYIMR
fig|1245478.3.peg.93   Enterococcus faecium LCT-EF258     IEKTNRMNALFEFYSTLLTEKQMNYMELYYADDFSLGEIAEEYEVSRQAVYDNIKRTSKILEDYEKKLHLFSDYIVR
fig|1157423.3.peg.1752   Enterococcus faecium 7330884-2     IEKTNRMNALFEFYSTLLTEKQMNYMELYYADDFSLGEIAEEYEVSRQAVYDNIKRTSKILEDYEKKLHLFSNYIVR
fig|333990.5.peg.1390   Carnobacterium sp. AT7     IEKTNQMNALFDFYGSLLTEKQKSYMQLYYADDFSLGEIAEEFEVSRQAIYDNIRRTENSLMEYERKLHLLEDF   
fig|655812.3.peg.887   Aerococcus viridans ATCC 11563     IQKTNEMNTLLIFYGDLLTEKQRVYIELYYAEDFSLGEIAEHFDVSRQAVYDNIRRTEKSLLKYENHLHLARDYYAR
fig|626369.3.peg.303   Granulicatella elegans ATCC 700633     IEKTTQMNLLLEFYGKLLTEKQLGYMELYYGEDYSLGEIAEEFEVSRQAVYDNIRRSAQLLEDYEQELHLVNDFYKR
fig|638301.3.peg.455   Granulicatella adiacens ATCC 49175     LEKTTQMNLLVEFYGSLLTDKQLEYMELYYGDDYSLGEIAEEFDVSRQAVYDNIRRSAKLLENYEEKLHLVADFYKR
fig|525310.3.peg.2327   Lactobacillus brevis subsp. gravesensis ATCC 27305     LEKTNYINSLFEFYEPLLTRKQANYIQLYYADDFSLGEIAEEYEISRQAVYDNIRRSEKILQQYEDKLNLYHSFIER
fig|525318.3.peg.2214   Lactobacillus buchneri ATCC 11577     LEKTNYINSLFEFYEPLLTKKQANYIQLYYADDFSLGEIAEEYEISRQAVYDNIRRSEKILQQYEDKLNLYHSFVER
fig|362948.14.peg.708   Lactobacillus salivarius UCC118     IEKTNRINALFDFYEPLLTPKQMTYIGLYYRDDYSLGEIAENYEVSRQAVYDNIRRTEKILEEYESKLHLYRNFQ  
fig|525362.3.peg.1521   Lactobacillus ruminis ATCC 25644     IEKTNRINALFDFYEPLLTEKQMTYIALYYRDDYSLGEIAENFEVSRQAVYDNIKRTEKILEEYEKKLGLYRQFEQQ
fig|1080365.4.peg.788   Pediococcus acidilactici MA18/5M     IEKNNRVNSLLEFYEQLLTPKQKEYITLYYADDYSLGEISEEFHVSRQAVYDNIKRTVKILEKYEQQLHLLRNFEAR
fig|1133596.3.peg.852   Pediococcus pentosaceus IE-3     IEKNNRINSLLEFYEQLLTPKQKEYITLYYADDYSLGEISEEFQVSRQAVYDNIKRTVNILEKYEQQLHLLSNFEVR
fig|889932.4.peg.1330   Lactobacillus plantarum subsp. plantarum ST-III     IEKNYRINSLFEFYEPLLTNKQKAYIQLYYADDYSLGEIAAEFSVSRQAVYDNIKRTEKILEGYEAKLHLYHDFVER
fig|321967.8.peg.1569   Lactobacillus casei ATCC 334     IEKNYRMNSLFEFYGPLLTDKQHAYLALYYGDDYSLGEIATEFNVSRQAVYDNIRRTEASLEEYEKKLHLFANYQAQ
fig|1256218.3.peg.44   Lactobacillus paracasei subsp. paracasei Lpp122     IEKNYRMNSLFEFYGPLLTDKQHAYLALYYGDDYSLGEIATEFNVSRQAVYDNIRRTEASLEEYEKKLHLFANYQAQ
fig|568703.30.peg.1647   Lactobacillus rhamnosus GG (Prj:40637)     IEKNYRMNSLFEFYGPLLTDKQHAYLALYYGDDYSLGEIATEFNVSRQAVYDNIRRTEASLEEYEQKLHLFANYQAQ
fig|314315.12.peg.691   Lactobacillus sakei subsp. sakei 23K     LAQNARMNSLFEFYGALLTAKQHSYLSLYYGDDFSLGEIAEEYQVSRQAVYDNIRRTEKILEGYEAKLHLFQNYEQQ
fig|387344.13.peg.922   Lactobacillus brevis ATCC 367     IEKNYRINSLFAFYQPLLTAKQNNYMQLYYGDDYSLGEIAEEFNVSRQAVYDNLRRTEKILEDYEEKLHLYQEFTAR
fig|1001583.3.peg.1008   Lactobacillus brevis KB290     IEKNYRINSLFAFYQPLLTAKQNNYMQLYYGDDYSLGEIAEEFNVSRQAVYDNLRRTEKILEDYEEKLHLYQEFTAR
fig|525309.3.peg.200   Lactobacillus antri DSM 16041     IEKNYRINSLFEFYQPLLTKKQNDYLELYYGDDYSLGEIAENFNVSRQAVYDNIKRTESILEDYEKKLHLYAEFQAR
fig|557433.4.peg.1203   Lactobacillus reuteri JCM 1112     IEKNYRINSLFEFYQPLLTKKQNDYLELYYGDDYSLGEIAENFHVSRQAVYDNIKRTESILEDYEAKLHLYAEFQVR
fig|525366.3.peg.1233   Lactobacillus vaginalis ATCC 49540     IEKNERINSLFEFYQPLLTEKQNQYLELYYADDFSLGEIAENFNVSRQAVYDNIKRTEKILESYEAKLHLDAEFQAR
fig|575594.3.peg.418   Lactobacillus coleohominis 101-4-CHN     LEKNERINDLFEFYSPLLTKKQYDYMQLYYADDYSLGEIAEDFSVSRQAVYDNIKRTEKALEGYEQKLHLYAEFSRR
fig|767453.3.peg.1357   Lactobacillus fermentum F-6     LEKNERINALFAFYQPLLTAKQNDYLQLYYADDYSLGEIATEFSVSRQAVYDNIKRTEKILEGYEQKLHLYAEFKAR
fig|575599.3.peg.1587   Lactobacillus fermentum 28-3-CHN     LEKNERINALFAFYQPLLTAKQNDYLQLYYADDYSLGEIATEFSVSRQAVYDNIKRTEKILEGYEQKLHLYAEFEAR
fig|585506.3.peg.1275   Weissella paramesenteroides ATCC 33313     LEKSMRLNMLFDFYQPLLTTKQNDYLQLYYADDYSLGEIADEYQVSRQAVYDNIKRSTQLLENYEKKLHLYDDYHNR
fig|882096.3.peg.1876   Listeria monocytogenes SLCC5850           MNLLFDFYQELLTTKQKAYVSFYYLDDYSLGEIAEEFEVSRQAIYDNIKRTEESLEKYEEKLGMLKKYQQR
fig|386043.9.peg.1830   Listeria welshimeri serovar 6b str. SLCC5334           MNLLFDFYQELLTTKQKAYVSFYYLDDYSLGEIAEEFEVSRQAIYDNIKRTEESLEKYEEKLGMLKKYQQR
fig|683837.3.peg.1775   Listeria seeligeri serovar 1/2b str. SLCC3954           MNLLFDFYQELLTTKQKAYVSFYYLDDYSLGEIAEEFEVSRQAIYDNIKRTEESLEKYEEKLGMLKKYQQR
fig|563174.3.peg.1912   Listeria monocytogenes L99           MNLLFDFYQELLTTKQKAYVSFYYLDDYSLGEIAEEFEVSRQAIYDNIKRTEESLEKYEEKLGMLKKYQQR
fig|393123.3.peg.1608   Listeria monocytogenes FSL N1-017     FEKTNRMNLLFDFYQELLTTKQKAYVSFYYLDDYSLGEIAEEFEVSRQAIYDNIKRTEESLEKYEEKLGMLKKYQQR
fig|386043.6.peg.1769   Listeria welshimeri serovar 6b str. SLCC5334     FEKTNRMNLLFDFYQELLTTKQKAYVSFYYLDDYSLGEIAEEFEVSRQAIYDNIKRTEESLEKYEEKLGMLKKYQQR
fig|393133.3.peg.1497   Listeria monocytogenes 10403S     FEKTNRMNLLFDFYQELLTTKQKAYVSFYYLDDYSLGEIAEEFEVSRQAIYDNIKRTEESLEKYEEKLGMLKKYQQR
fig|393125.3.peg.2567   Listeria monocytogenes FSL R2-503     FEKTNRMNLLFVFYQELLTTKQKAYVSFYYLDDYSLGEIAEEFEVSRQAIYDNIKRTEESLEKYEEKLGMLKK    
fig|1002366.3.peg.245   Listeria innocua ATCC 33091           MNLLFDFYQELLTTKQKSYVSFYYLDDYSLGEIAEEFEVSRQAIYDNIKRTEESLEKYEEKLGMLRKYQQR
fig|272626.1.peg.1903   Listeria innocua Clip11262     FEKTNRMNLLFDFYQELLTTKQKSYVSFYYLDDYSLGEIAEEFEVSRQAIYDNIKRTEESLEKYEEKLGMLRKYQQR
fig|525367.9.peg.1101   Listeria grayi DSM 20601     FEKTNRMNLLFDFYQGLLTEKQKNYVSLYYLEDFSLGEIADEYEVSRQAVYDNIKRTEESLENYEQKLGMLAKYEER
fig|649639.5.peg.2600   Bacillus cellulosilyticus DSM 2522     IEKTIRMNYLYDFYQVLLTDKQNHYMTMYYLDDLSLGEIADQFEVSRQAVYDNIKRTESLLEEYETKLMLLQRYQER
fig|342451.11.peg.1535   Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305     LIKTIRMNYLFDFYQALLTKKQRNYLELFYLQDYSLSEIANTFDVSRQAVYDNIRRTGDLVEDYEEKLGLYRNFEQR
fig|525377.3.peg.601   Staphylococcus lugdunensis M23590     LVKTLRMNYLFDFYQALLTKKQRNYLELFYLQDFSLSEIADTFEVSRQAVYDNIRRTGDLVEDYEQKLKLYEKFEQR
fig|396513.4.peg.860   Staphylococcus carnosus subsp. carnosus TM300     LVKTLRMNYLFDFYQALLTKKQRNYLELFYLQDYSLSEIADTFDVSRQAVYDNIRRTGDLVEDYETKLELYSKFEQR
fig|1169255.3.peg.2097   Staphylococcus aureus M0946     LVKTLRMNYLFDFYQSLLTNKQRNYLELFYLEDYSLSEIADTFNVSRQAVYDNIRRTGDLVEDYEKKLELYQKFEQR
fig|1116223.3.peg.1128   Staphylococcus aureus subsp. aureus VRS10     LVKTLRMNYLFDFYQSLLTNKQRNYLELFYLEDYSLSEIADTFNVSRQAVYDNIRRTGDLVEDYEKKLELYQKFEQR
fig|596319.3.peg.479   Staphylococcus warneri L37603     LVKTLRMNYLFDFYQSLLTDKQRNYLELFYLQDYALSEIADTFNVSRQAVYDNIRRTGDLVEDYETKLGLYKRFEQR
fig|525378.3.peg.430   Staphylococcus epidermidis M23864:W1     LVKTLRMNYLFDFYQSLLTQKQRNYLELFYLQDYSLSEIADTFEVSRQAVYDN