(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00004720

fig|553973.6.peg.3409   Clostridium hylemonae DSM 15053          KEVDARGLSCPEPLMLTADALKDA−−KE−−−AVKVLVTEPHQKMNVEKYAKEHGKSAVSTERE         
fig|411468.9.peg.2393   Clostridium scindens ATCC 35704          KEVDARGLSCPEPLMLTAEALKGA−−SE−−−PVKILVTEPHQKMNVEKYAK                      
fig|411462.6.peg.1220   Dorea longicatena DSM 13814          KEVDARGLSCPEPLMLTAEALKGE−−TG−−−PVKILVTEPHQKMNVEKFAKSK                    
fig|470146.3.peg.1792   Coprococcus comes ATCC 27758          KEVDARGLSCPEPLMLTAEALKNA−−NG−−−PIKVLVSEPHQKTNIEKFAKDK                    
fig|411461.4.peg.271   Dorea formicigenerans ATCC 27755          VEVDARGLSCPEPIMLTAEALKNE−−KG−−−PIKVLVSEPVQKENVEKYAKSQ                    
fig|742765.5.peg.2729   Dorea formicigenerans 4_6_53AFAA          VEVDARGLSCPEPIMLTAEALKNE−−KG−−−PIKVLVSEPVQKENVEKYAKSQ                    
fig|500632.7.peg.2411   Clostridium nexile DSM 1787          YEVDARGLSCPEPLMMTAEALKKQ−−KG−−−QIKVLVSEPHQRTNVEKFAK                      
fig|997896.4.peg.5850   Clostridium bolteae 90B7          YEVDARGLSCPEPVMLTAAALKKH−−KGE−−PVKVLVSEPHTRMNVEKYAKSQ                    
fig|411486.3.peg.433   Clostridium sp. M62/1          YEVDARGLSCPEPVMMTADAIKKH−−GSE−−TIRVLVSEVHTRQNVEKYAKSQGKNVSVRE           
fig|411465.10.peg.196   Parvimonas micra ATCC 33270          KELDVRGLSCPEPVLILQDALKEN−−KNE−−TYKVLASEAHVVKNITHFANSQ                    
fig|596329.3.peg.910   Peptostreptococcus anaerobius 653-L          REVDVRGLSCPEPVMIVSEEIK−−−−KGD−−EILVLSNEAHSMKNIVRFCKS                     
fig|398767.5.peg.2371   Geobacter lovleyi SZ          KTIDCRGQACPAPVIATKKALEES−−−AA−−GVCVLVDDGAPRENVGRFARNRGYQVTETAQ          
fig|351605.6.peg.4020   Geobacter uraniireducens Rf4          KTIDCRNMACPQPVVMVKRALEEN−−PGE−−PLNVLLDDGAPRENVGRFAANR                    
fig|443143.4.peg.662   Geobacter sp. M18            LDVRGMACPLPVVQVKRALESA−−QGE−−−LRVLLDDGAPRENVKRFAQGRGYQVQEER           
fig|443144.3.peg.3411   Geobacter sp. M21            LDVRGMACPLPVVSVKRALEST−−EGE−−−LRVLLDDGAPRENVKRFVQGRGYQVREEQ           
fig|404380.3.peg.3360   Geobacter bemidjiensis Bem            LDVRGMACPLPVVSVKRALESA−−EGE−−−LRVLLDDGAPRENVKRFVQGRGYQVQEEQ           
fig|429009.3.peg.2078   Ammonifex degensii KC4            VDARGLLCPEPVLMVKREMERLGGKG−−RIKVLVDSGASKENISRLAKSQ                    
fig|635013.3.peg.2594   Thermincola sp. JR          KTLDVRGLACPEPVLTVRRELEEM−−VTG−−TLQVMVNSGAAKDNITFMAKNLGWEIDVTDQE         
fig|485916.5.peg.1635   Desulfotomaculum acetoxidans DSM 771          QQIDARGLLCPEPVLRTKKEIDRIKNG−−IFTVIVDNNPAKENISRLAK                      
fig|370438.3.peg.618   Pelotomaculum thermopropionicum SI         DKTVDARGLLCPEPVLLTKKAIEKEKGG−−TIRVLVDNNAARENVTRLAKS                     
fig|525898.7.peg.29   Sulfurospirillum deleyianum DSM 6946           TIDVRGLSCPSPVLEVKQAMDR−−−GVK−−SLKVLADCGTATENVTRFAR                      
fig|439235.3.peg.1770   Desulfatibacillum alkenivorans AK-01         TIEIDAKGLACPAPVLQTKKAVEDGRPE−−TIKVLVDNGAAKENVTRFLKSQGYE                
fig|485915.5.peg.865   Desulfohalobium retbaense DSM 5692        AEIELDCQGLPCPQPVLQSKKTIESQ−−QPE−−TLLVTVDNEPAQHNVTRFLESQGYQIEAVEQ          
fig|411464.8.peg.1926   Desulfovibrio piger ATCC 29098          KTLDCRGLACPQPVMRTRDALEQG−−RPQ−−ELIVLVDNAAASENVSRFLRRSGFEVSVSQPE         
fig|335543.6.peg.3502   Syntrophobacter fumaroxidans MPOB         EATLDCRGMACPHPVLKAKEVVDRG−−DVA−−RFSVIVDNPAAKENVSRF                        
fig|177439.6.peg.1040   Desulfotalea psychrophila LSv54           TIDACGLPCPGPVLLAKDAIEQP−−GND−−QLTILLDNQASEENVSRFLQSQ                    
fig|177439.1.peg.968   Desulfotalea psychrophila LSv54           TIDACGLPCPGPVLLAKDAIEQP−−GND−−QLTILLDNQASEENVSRFLQSQ                    
fig|264732.11.peg.1552   Moorella thermoacetica ATCC 39073          VEVDVRGLSCPIPVVKTKKAMEQN−−PGQ−−TLAVLTDNETSRENVSRLAE                      
fig|555088.4.peg.444   Dethiobacter alkaliphilus AHT 1       TANVNLDVRGLSCPEPVIRTKNALGTGQPAL−−PLTVVADSFVAAENI                           
fig|335541.7.peg.2266   Syntrophomonas wolfei subsp. wolfei str. Goettingen            VDVRGLSCPMPVIKTKKILDQG−−VKE−−−LLVIGTSSVSKENVSKLARSSGYQV               
fig|643648.3.peg.37   Syntrophothermus lipocalidus DSM 12680           ILDVRGLSCPLPVLKVKKSLDKG−−ATD−−−LRVIGSAQVAFENVTRFARSQ                    
fig|457570.14.peg.2491   Natranaerobius thermophilus JW/NM-WN-LF          KTVDARGFSCPQPVINTKKALSEEFD−−ELQVLVDNNIAKENVSRFVNSK                    
fig|596324.3.peg.153   Treponema vincentii ATCC 35580         DYTVDARGLSCPEPVVRTKKAFDA−−−HQ−−NFTVLVDNETSKENVIRFCDKM                    
fig|243275.1.peg.2447   Treponema denticola ATCC 35405         DIIVDARGLACPEPVVLTKKALAV−−−NS−−AFVVLVDNETSKENIKRFC                       
fig|645512.3.peg.396   Jonquetella anthropi E3_33 E1          MTIDARGLSCPEPVVLTRRAVVS−−−APA−−EFQVIVDNETARGNVIRFATHSGYKLADERQE         
fig|445972.6.peg.470   Anaerotruncus colihominis DSM 17241            IDARGLSCPQPVVMTKNLLAG−−−SPA−−SCEVLVDNPTAKENVTRFAEHAGYHVTAATE          
fig|411471.5.peg.162   Subdoligranulum variabile DSM 15176            IDARGLSCPMPVVMVQKAVQNG−−TPA−−TLEVLLDNPCSVENVTRFA                       
fig|411471.5.peg.5612   Subdoligranulum variabile DSM 15176            IDARGLSCPMPVVMVQKAVQNG−−TPA−−TLEVLLDNPCSVENVTRFA                       
fig|457412.4.peg.2211   Ruminococcus sp. 5_1_39BFAA          KKIDARGLSCPEPVIRAKNAMESGDK−−EYEILVDNVVAKENVSRFATHQGYQVQATEQ          
fig|553184.4.peg.72   Atopobium rimae ATCC 49626           TLDARGLSCPEPVVMISQAMAS−−−KAD−−GYRMIVDAVAARENVTRYAQSQGYTV               
fig|411467.6.peg.3549   Bacteroides capillosus ATCC 29799          KLLDARGLSCPEPVIMTRKAMAT−−−GES−−AYQVVVDNPTAKENVTRYAVHQGYKVSVEE           
fig|526224.5.peg.169   Brachyspira murdochii DSM 12563          KTIDARGVPCPKPLILTKTALNNAALNE−−EIEVLIDDDVAFHNITDFLK                      
fig|565034.3.peg.2413   Brachyspira hyodysenteriae WA1          KTVDARGIPCPKPLILTKTAITNAAINE−−EIEVLIDDEVAFHNITDFLK                      
fig|592015.5.peg.418   Anaerobaculum hydrogeniformans ATCC BAA-1850          KIVDARGTTCPKPVIMTKKAIDSG−−EK−−EVEVLVDNDVSFQNVRRFLDSQGYEIIE             
fig|525903.4.peg.1042   Thermanaerovibrio acidaminovorans DSM 6589            VDARGQSCPKPVMMAKEAVDRG−−AS−−RLEVLVDNPVSGENVTRFLKGQ                    
fig|338963.3.peg.1214   Pelobacter carbinolicus DSM 2380        AKRVIDCRGLSCPRPVVETKKAMEAF−−PDA−−EIEVLLNDEIACENVSRLAAGRHWTVVAVTRE         
fig|338963.6.peg.338   Pelobacter carbinolicus DSM 2380        AKRVIDCRGLSCPRPVVETKKAMEAF−−PDA−−EIEVLLNDEIACENVSRLAAGRHWTVVAVTRE         
fig|350688.5.peg.2058   Alkaliphilus oremlandii OhILAs          RIIDARGRSCPEPVLMTKEAISKYK−−EN−−TIEVLVDAKVAVENIQRFV                       
fig|293826.4.peg.3426   Alkaliphilus metalliredigens QYMF          KIVDARGRSCPEPVVMTKQAVENYS−−GE−−TIQVLVDAIVAVENIKRFASNQ                    
fig|293826.6.peg.3656   Alkaliphilus metalliredigens QYMF          KIVDARGRSCPEPVVMTKQAVENYS−−GE−−TIQVLVDAIVAVENIKRFASNQ                    
fig|500633.7.peg.466   Clostridium hiranonis DSM 13275            IDARGLSCPQPVLMTKKGVAE−−−SPN−−GVEVLVDNMTACNNVKKFLK                      
fig|471871.7.peg.145   Clostridium sporogenes ATCC 15579          VQIDARGVSCPQPVLMTKKALAN−−−NKE−−GINVIVDNMTARGNVERFMKNSGYKVTIEEKE         
fig|469381.4.peg.581   Dethiosulfovibrio peptidovorans DSM 11002           TVDARGLSCPQPVLETKKALNKASSD−−VVSILVDTETARNNVERFGKSK                    
fig|592015.5.peg.625   Anaerobaculum hydrogeniformans ATCC BAA-1850          ITVDARGLSCPQPVVETKKAIERSASS−−EIYVLVDTMTSVMNVSRYAKSQ                    
fig|352165.3.peg.728   Pyramidobacter piscolens W5455          MVVDARGLSCPQPVVEAKKAAATGEK−−EIEVFLDNPTSITNVTRFMTSQGYQL               
fig|525903.4.peg.1039   Thermanaerovibrio acidaminovorans DSM 6589       SSDRIVDARGLSCPQPVLMTRRALEES−−GDL−−PLTVLVSTVTSRENVIRF                        
fig|572547.3.peg.157   Aminobacterium colombiense DSM 12261          IIVDARGLSCPQPVLETRKALKDLSGG−−QVEILVDTVTSRENVARFARSQ                    
fig|643562.6.peg.3303   Desulfovibrio aespoeensis Aspo-2           TIDARGLSCPQPVLDTLNKIAAMGRG−−NLEILVDTEASKENV                           
fig|289376.4.peg.1465   Thermodesulfovibrio yellowstonii DSM 11347           IVDARGLSCPEPVLLTLETIKKLGKG−−EIEILVDTDTSRENVSRAAQSMGWQIVEVQQE         
fig|335543.6.peg.3268   Syntrophobacter fumaroxidans MPOB           IVDARGLSCPQPVLLVMSKIKEKASG−−EIEVIVDNEVSRENVSRAARAKGWEV               
fig|335543.9.peg.3763   Syntrophobacter fumaroxidans MPOB           IVDARGLSCPQPVLLVMSKIKEKASG−−EIEVIVDNEVSRENVSRAARAKGWEV               
fig|522772.6.peg.421   Denitrovibrio acetiphilus DSM 12809          MEIDARGLACPQPVLMIKAELEKI−−EEG−−VVTILVDNKGSSINVKNFCEANGHTV               
fig|289376.4.peg.980   Thermodesulfovibrio yellowstonii DSM 11347          MEIDARGLECPKPIILAENALSKI−−EEG−−VLTIIVDNEGSLENLKKYATRF                    
fig|411465.10.peg.1267   Parvimonas micra ATCC 33270          KEINAKGLACPQPLILTKRAVESSEEKD−−FLVIVDNDTAVKNLEKFAKS                     
fig|447214.4.peg.1323   Clostridium butyricum 5521          KMIDAKGKNCPMPVIMAKKEIDA−−−GTE−−ELIIEVDNSIAVENLKKLAKSQ                    
fig|56780.10.peg.2764   Syntrophus aciditrophicus SB           TIDARGLACPQPVILTKKALEH−−−−CD−−SLTVRVDNIAALENVKRMAKSQ                    
fig|335541.7.peg.2039   Syntrophomonas wolfei subsp. wolfei str. Goettingen          KTIDARGLTCPQPVVLTKKALEEEETSE−−VLTIVDNSNALENVSRLAHTL                    
fig|639282.3.peg.346   Deferribacter desulfuricans SSM1          MVVDARGKACPTPVIMTKKALESI−−KEG−−VITVLVDNFASKENVSKFAASQ                    
fig|309798.3.peg.203   Coprothermobacter proteolyticus DSM 5265         NIIVDARGKACPTPVIMTKKAVESA−−PGK−−TVTVIVDNEVAKENVSKFA                       
fig|273068.3.peg.1750   Thermoanaerobacter tengcongensis MB4         DNIVDARGKNCPIPVIMTKKALENI−−QEG−−KILVIVDNETAKENVSKYAKS                     
fig|273068.5.peg.1892   Thermoanaerobacter tengcongensis MB4         DNIVDARGKNCPIPVIMTKKALENI−−QEG−−KILVIVDNETAKENVSKYAKS                     
fig|451757.5.peg.437   Clostridium perfringens NCTC 8239          KKIDCLGMACPMPVINTKKYFDSIEEG−−IAEVLVDNEVAKNNICKYADG                     
fig|451755.5.peg.1206   Clostridium perfringens E str. JGS1987          KKIDCLGMACPMPVINTKKYFDSIEEG−−IAEVLVDNEVAKNNICKYADG                     
fig|195103.10.peg.2428   Clostridium perfringens ATCC 13124          KKIDCLGMACPMPVINTKKYFDSIEEG−−VAEVLVDNEVAKNNICKYADG                     
fig|289380.15.peg.2171   Clostridium perfringens SM101          KKIDCLGMACPMPVINTKKYFDSIEEG−−VAEVLVDNEVAKNNICKYAEG                     
fig|457396.3.peg.356   Clostridium sp. 7_2_43FAA           IIDCKGLACPMPVIKTKKYFDLE−−DSK−−ETLVIVDNEVAKNNILRLAKG                     
fig|536227.3.peg.2740   Clostridium carboxidivorans P7           IIDCKGLKCPQPVINTKKFFDSIDEG−−QTTVIVDNEVSKNNVSKFAES                     
fig|536227.4.peg.503   Clostridium carboxidivorans P7           IIDCKGLKCPQPVINTKKFFDSIDEG−−QTTVIVDNEVSKNNVSKFAES                     
fig|555088.4.peg.2912   Dethiobacter alkaliphilus AHT 1           TLDCRGLTCPQPVVETKKKLADISAG−−TLTVLVDNETAKNNLLKLAGSMDLEAMARQDDG        
fig|293826.4.peg.27   Alkaliphilus metalliredigens QYMF       KVNKEIDARGMNCPLPVIHTKKALESI−−DQG−−KITTIVDNETARENISKLAKS                     
fig|293826.6.peg.27   Alkaliphilus metalliredigens QYMF         NKEIDARGMNCPLPVIHTKKALESI−−DQG−−KITTIVDNETARENISKLAKS                     
fig|350688.5.peg.22   Alkaliphilus oremlandii OhILAs         NKEVDARGMNCPLPVIHTKKALESI−−DDG−−RITTIVDNEVAKENVAKLAKSM                    
fig|264732.11.peg.129   Moorella thermoacetica ATCC 39073         EKVVDARGLACPQPVIQTKKAMESLGPET−−ELVTIVDNEVARDNVLKLARSMA                  
fig|485916.5.peg.3132   Desulfotomaculum acetoxidans DSM 771           EVNCRGLACPSPVINTKKALDNIESG−−TVTTIVDNAIARDNVAMFARNSGYQVSVDQQ          
fig|349161.6.peg.1376   Desulfotomaculum reducens MI-1          KEINNRGLACPHPVINTKRALEEIEQG−−TVISIVDNEVALENVKRFVENAGYQVKVEE           
fig|370438.3.peg.1707   Pelotomaculum thermopropionicum SI         TQVIDCRGMACPQPVIETKKALEKGQGG−−TVLTIVDNEVAKENISRFAKSAGFHVVVEERD         
fig|401526.3.peg.2272   Thermosinus carboxydivorans Nor1            VDARGLACPQPVIATKKALDSIEQG−−IVTTIVDNAVAKENVIKFATANGYGVRVEEKDGHYYLAITK
fig|699035.5.peg.3689   Clostridium difficile M120            IDARGLACPKPVINTKRELDKLEEG−−VVVTIVDNETAKENVLKLAKS                     
fig|479833.4.peg.3291   Clostridium difficile QCD-97b34            IDARGLACPKPVINTKRELDNLEEG−−VVVTIVDNETAKENILKLAKS                     
fig|596329.3.peg.370   Peptostreptococcus anaerobius 653-L         DIKVDAKGLACPMPVIKTKKALEEI−−ESG−−VVEVTVDDVAPRENVIKFAKS                     
fig|401526.3.peg.711   Thermosinus carboxydivorans Nor1         DKVLDLRGLSCPIPLIKTRDALR−−−−DSK−−VVTVLVDDMPPKENILRFAKSQ                    
fig|525898.7.peg.2077   Sulfurospirillum deleyianum DSM 6946            IDCSGLACPEPVLQTKKALESLPNDS−−ILEVIVDNIAARENVVRFAQ                      
fig|391592.5.peg.446   Caminibacter mediatlanticus TB-2            IDCRGLACPEPVIKTKRALDEI−−NEG−−VIEVIVDNIASKENVKRFAENQ                    
fig|391592.5.peg.448   Caminibacter mediatlanticus TB-2          KKIDCRNLACPEPVLKTKEALEEM−−EEG−−ILEVKLNSFSSIQNVKRFAKNQ                    
fig|598659.3.peg.1245   Nautilia profundicola AmH          KRIDCKDLACPEPVLRTKDALEEM−−EEG−−ILEVEVNSFSSVQNVKRFAQNQ                    
fig|598659.3.peg.1247   Nautilia profundicola AmH         NKKIDCRNMACPQPVLETKKALEEM−−DEG−−ILEVLVNSVSSVQNVKRYA                       
fig|273121.8.peg.946   Wolinella succinogenes DSM 1740            IDVRNLGCPEPVIRTKKALDALGTEG−−ILEVLGNTEASKENILRFAQ                      
fig|360104.9.peg.1765   Campylobacter concisus 13826         TRTIDCRNLECPKPVIMTKNALEGLNEGE−−SLEIIVNALAPKENISRFLKNQ                    
fig|553220.3.peg.238   Campylobacter gracilis RM3268          MQLDCRNLNCPEPLLRTKKALGELKIAE−−SLEILVNDIAPRENIKRF                        
fig|553219.3.peg.1653   Campylobacter showae RM3277          MQIDCRNLACPEPVIRTKNTLESLKVGE−−KLEILVNSIAPKENISRFLKNQ                    
fig|553218.4.peg.731   Campylobacter rectus RM3267          MQIDCRNLACPEPVIRTKNALDGLRVGE−−KLEILVNSIAPKENISRFLKSQ                    
fig|360106.6.peg.334   Campylobacter fetus subsp. fetus 82-40          MQIDCRGLECPKPIIKTRDALNELSIGD−−KLEIVVNSPASLANVQKF                        
fig|360107.7.peg.1696   Campylobacter hominis ATCC BAA-381          MQIDCRNLECPKPVIKTKETLKSLKIGQ−−NLEILVNSKTSLENISRFLNTNS                  
fig|360105.8.peg.1685   Campylobacter curvus 525.92          MQLDCRNLACPEPVIKTKNAIGGLKEGE−−ELEILLNSVASFENVSKFLTSQ                    
fig|306264.1.peg.946   Campylobacter upsaliensis RM3195            IDCRNLDCPAPVIETKNALEKLENGE−−KLEILLNSHIAKNNVIKFLNSLNLTHTCEERGEE       
fig|887287.3.peg.860   Campylobacter coli 84-2            IDCRNLECPKPIVETKKALQNLQNNE−−ILEIVLNSVISKNNVLKF                        
fig|1295400.3.peg.1392   Campylobacter jejuni subsp. jejuni ICDCCJ07004            IDCRNLSCPQPIVETKNALEKLQENE−−ILEIVLNSIISKNNVVKFLNSLNLNPVVD            
fig|360112.4.peg.197   Campylobacter jejuni subsp. jejuni HB93-13            IDCRNLSCPQPIVETKNALEKLQENE−−ILEIVLNSIISKNNVVKFLNSLNLNPVVD            
fig|885273.3.peg.955   Campylobacter jejuni subsp. jejuni P110B            IDCRNLSCPQPIVETKNALEKLQENE−−ILEIVLNSIISKNNVVKFLNSLNLNPVVD            
fig|885274.3.peg.516   Campylobacter jejuni subsp. jejuni H22082            IDCRNLSCPQPIVETKNALEKLQENE−−ILEIVLNSIISKNNVVKFLNSLNLNPVVD            
fig|1293289.3.peg.1444   Campylobacter jejuni str. NCCP No. 15742            IDCRNLSCPQPIVETKNALEKLQENE−−ILEIVLNSIISKNNVVKFLNSLNLNPVVD            
fig|478547.3.peg.1577   Campylobacter jejuni subsp. jejuni CG8421            IDCRNLSCPQPIVETKNALEKLQENE−−ILEIVLNSIISKNNVVKFLNSLNLNPVVD            
fig|360109.10.peg.1840   Campylobacter jejuni subsp. doylei 269.97            IDCRNLSCPQPIVETKNAFEKLQENE−−ILEIVLNSIISKNNVVKFLNSLNLNPVVD            
fig|718271.4.peg.1574   Campylobacter jejuni subsp. jejuni S3            IDCRNLSCPQPIVETKNALEKLQENE−−ILEIVLNSIISKNNVVKFLNSLNLNPIVD            
fig|683083.3.peg.1092   Campylobacter jejuni subsp. jejuni 414            IDCRNLSCPQPIVETKNALEKLQEGE−−TLEIILNSFISKNNVVKFLNSLKLNPIVD            
fig|889213.3.peg.1152   Campylobacter jejuni subsp. jejuni 129-258            IDCRNLSCPQPIVETKNALEKLQENE−−ILEIVLNSIISKNNVVKF                        
fig|683082.3.peg.1150   Campylobacter jejuni subsp. jejuni 1336            IDCRNLSCPQPIVETKNALEKLQENE−−ILEIVLNSIISKNNVVKFLNSLNLNPIID            
fig|407148.6.peg.1418   Campylobacter jejuni subsp. jejuni 81116            IDCRNLSCPQPIVETKNALEKLQENE−−ILEIVLNSIISKNNVVKFLNSLNLNPIID            
fig|471855.4.peg.1470   Slackia heliotrinireducens DSM 20476           TVDAMGEKCPVPVVKAKQAMSTF−−DEG−−TLEVLVDNETSVKNLLSFAKSQ                    
fig|469378.4.peg.813   Cryptobacterium curtum DSM 15641         DLIIDARGDACPLPVVKAKQALSQV−−DEG−−TVTVLVDNETAVENLGNLAKS                     
fig|479437.5.peg.1743   Eggerthella lenta DSM 2243           QIDARGQACPLPVVRAKKALSAM−−GEG−−VLEVLVDNETAVHNLEALAKT                     
fig|592010.4.peg.2761   Abiotrophia defectiva ATCC 49176         EKKLDCKGMACPLPVVTTKKAMEELTEDG−−IVEVTVDNETAVQNL                           
fig|608534.3.peg.1696   Oribacterium sp. oral taxon 078 str. F0262         DKKLDCMGMACPLPVVNAKKAMEAFEEEG−−ILTVCVDNDTAVQNLTRLAK                      
fig|585501.3.peg.212   Oribacterium sinus F0268         DKNLDCKGLACPLPVVEAKKAMEEMQEG−−ILTVLVDNETAVQNLQRLGQKF                    
fig|451640.5.peg.129   Catenibacterium mitsuokai DSM 15897            LDARGLECPLPVVKTKELLKE−−−SSE−−AVEVLVDNETAVENLKKFAKVKGYDAVSSK           
fig|518637.5.peg.1513   Eubacterium biforme DSM 3989          KTLDCRGLECPLPVVKTKEALKE−−−EN−−−VVSTIVDNEIAVENLTKFAKVK                    
fig|1151190.3.peg.1233   Enterococcus faecalis B84847          KLVDALGKPCPIPVIETKKALAELGLAGG−−TIEVLVDNEVAVENLKKLATKK                    
fig|565640.5.peg.1735   Enterococcus faecalis T11          KLVDALGKPCPIPVIETKKALAELGLAGG−−TIEVLVDNEVAVENLKKLATKK                    
fig|1158670.3.peg.2251   Enterococcus faecalis 5952          KLVDALGKPCPIPVIETKKALAELGLAGG−−TIEVLVDNEVAVENLKKLATKK                    
fig|1111677.3.peg.141   Enterococcus faecalis M7          KLVDALGKPCPIPVIETKKALAELGLAGG−−TIEVLVDNEVAVENLKKLATKK                    
fig|1158662.3.peg.2182   Enterococcus faecalis T16          KLVDALGKPCPIPVIETKKALAELGLAGG−−TIEVLVDNEVAIENLKKLATKK                    
fig|1151188.3.peg.375   Enterococcus faecalis B56765          KLVDALGKPCPIPVIETKKALAELGLAGG−−TIEVLVDNEVAIENLKKLATKK                    
fig|1158624.3.peg.2065   Enterococcus faecalis SF28073          KLVDALGKPCPIPVIETKKALAELGLAGG−−TIEVLVDNEVAIENLKKLAAKK                    
fig|565647.5.peg.2553   Enterococcus faecalis E1Sol          KLVDALGKPCPIPVIETKKALAELGLAGG−−TIEVLVDNEVAVENLKKLAAKK                    
fig|565649.5.peg.2544   Enterococcus faecalis Fly1          KLVDALGKPCPIPVIETKKALAELGLAGG−−TIEVLVDNEVAVENLKKLAAKK                    
fig|1169311.3.peg.2104   Enterococcus faecalis ATCC 6055          KLVDALGKPCPIPVIETKKALAELGLAGG−−TIEVLVDNEVAVENLKKLAAKK                    
fig|411490.6.peg.526   Anaerostipes caccae DSM 14662         EKRINAVGKQCPMPVILAKKALEETPEGG−−TVTVIVDNDIAVQNLSKLAVQKQYGFVSRETE         
fig|411486.3.peg.448   Clostridium sp. M62/1          KQLDMRGKACPMPVIETKKILEEVKKAE−−EVRVLVDNEIAVQNLTKLAGHE                    
fig|997896.4.peg.729   Clostridium bolteae 90B7            LDERGKQCPKPVIDTKKALESCNPGE−−TVEVLVDNEIAVQNLSKMAASK                    
fig|622312.4.peg.1099   Roseburia inulinivorans DSM 16841         NIQIDAKGKQCPLPVIEAKNAISGMTEAG−−IVEVTVDNEIAVQNLTKMADHK                    
fig|411470.6.peg.3125   Ruminococcus gnavus ATCC 29149          YMVDARGKQCPIPVVETKKMLAQMAESD−−IVETLVDNAIAVQNLEKMAKQK                    
fig|357809.8.peg.1539   Clostridium phytofermentans ISDg          KTIDARGLQCPLPVIETKKVLKELTDG−−MVEIFVDNEIAVQNLTKMAKQM                    
fig|445973.7.peg.245   Clostridium bartlettii DSM 16795            VDAMGDQCPIPVIKTKKALKEITETT−−LVEVHVDNEIAVQNLSKMAKQK                    
fig|411459.7.peg.3462   Ruminococcus obeum ATCC 29174          YMVNAMGEQCPIPVVKTKKVLDSIQGDA−−EIEVLVDNETAVQNLTRMGKNTGAEVFSEKK          
fig|457412.4.peg.1240   Ruminococcus sp. 5_1_39BFAA          HEVNVMGKQCPIPVVMTKKVIDNAAVGD−−EIEILIDNETAVNNLSRLANKTGCTFVSEK           
fig|665951.3.peg.1508   Lachnospiraceae bacterium 8_1_57FAA          MTVDAMGDHCPIPVVKTKKALGKLQGAG−−QIEVLVDNETAMKNVMKMAKS                     
fig|469617.3.peg.1766   Fusobacterium ulcerans ATCC 49185            VNAVGQTCPIPIIMTKNALKDIEE−−G−−EVEVLVDNKISLENLQKMSKEMGY                 
fig|469618.3.peg.211   Fusobacterium varium ATCC 27725            VNAVGQTCPIPIIMTKNALKDIEE−−G−−EVEVLVDNKISLENLQKMSKEMGY                 
fig|469616.3.peg.1311   Fusobacterium mortiferum ATCC 9817            VDAIGQVCPVPIIMTKNALKDIEE−−G−−QVEVSVDNRISLENLQKMSKEMGY                 
fig|1090321.3.peg.4531   Desulfitobacterium hafniense PCP-1          ITIDALGQVCPIPVIRAKKALEGLGEAGG−−VVAVLVDNDISRQNLQKMAEGMGYQSEYQEKD         
fig|138119.3.peg.4208   Desulfitobacterium sp. Y51          ITIDALGQVCPIPVIRAKKALAELGEAGG−−VVTVLVDNDISRQNLQKMAEGMGYQ                
fig|411483.3.peg.1565   Faecalibacterium prausnitzii A2-165            IDARGDACPLPVVKAKKAIAELHGPG−−EVEVLVDNEIAVQNLTKMAQQK                    
fig|411485.10.peg.2052   Faecalibacterium prausnitzii M21/2            VDALGDACPLPVVKAKKAISELQGAG−−QVEVLVDNEIAVQNLTKMAQQK                    
fig|411469.3.peg.680   Eubacterium hallii DSM 3353            VNAIGDACPIPVVKTKNAIRELQGGG−−TVETLVDNEIAVQNLTKMANQKGYDVHSEK           
fig|515619.6.peg.2742   Eubacterium rectale ATCC 33656          ITVNAIGDTCPIPVVKTKKAIEALTQPD−−TVETLVDNEVAVENLKKMAAQK                    
fig|500632.7.peg.2381   Clostridium nexile DSM 1787            VNAIGDNCPIPVIKTKKAMQEVNGKE−−TIEVLVDNEIAVQNVTKMA                       
fig|470146.3.peg.1782   Coprococcus comes ATCC 27758          VTVNAMGDNCPIPVIKTKKAMQALTGPE−−TIEVLVDNEIAVQNVTKLAKEQGG                 
fig|553973.6.peg.3402   Clostridium hylemonae DSM 15053          ITVNAMGENCPIPVIKTKKAIQALAGPE−−TIEVLVDNEIAVQNVTKMAESEGG                 
fig|411468.9.peg.2400   Clostridium scindens ATCC 35704          ITVNAMGDNCPIPVIKTKKAMQALTGPE−−VIEVLVDNEIAVQNVTKMAASAGG                 
fig|411461.4.peg.1233   Dorea formicigenerans ATCC 27755          ITVNAMGDNCPIPVIKTKKAMDALTGPE−−TIEVLVDNEIAVQNVTKMATSAGG                 
fig|411462.6.peg.1213   Dorea longicatena DSM 13814          ITVNAMGDNCPIPVIKTKKAMAALTGPE−−TIEVLVDNEIAVQNVTKMASSSGG                 
fig|245018.3.peg.1650   butyrate-producing bacterium SSC/2          KQIDERGNACPIPVVHTKKALESMDGET−−KLIVLVDNEPAVQNVTRFAEGK                    
fig|224325.1.peg.163   Archaeoglobus fulgidus DSM 4304          HELDCRNMVCPYPVIITKLAMQKV−−−−D−−RLEVLTNNPPSVRDIEKIAEKE                    
fig|190192.1.peg.257   Methanopyrus kandleri AV19         DEELDVRGKICPMPVLETRKKLEEMSEGE−−VLKVVGDYPPAKDNIRRFAEENGHEVLDVEE          
fig|272569.1.peg.3433   Haloarcula marismortui ATCC 43049            VDVRGEICPRPALIVRQALSDLDTGE−−TLVVRGDYPPAEENLRRMC                       
fig|243232.1.peg.1022   Methanocaldococcus jannaschii DSM 2661          KKLDVTGDICPVPVLKTKKALEELNEGE−−ELEVVGDYKPALENIKRFAENNGYTVVLAEE          
fig|419665.8.peg.892   Methanococcus aeolicus Nankai-3         NMELQVSGTVCPIPVLKTKKALDSMSEGE−−ELIVIGDYKPALENITRFAEEHGHTVVSAEE          
fig|406327.7.peg.1352   Methanococcus vannieli vannielii SB          MEIDVTGTVCPMPVLKTKKSLDSINFGE−−ELTVTGDYKPALQNIRRFVEERGHTVVFAEE          
fig|444158.3.peg.633   Methanococcus maripaludis C6          MELDVTGTVCPMPVLKTKKALYSLNSGD−−ELTVTGDYKPALQNIVRFVEEKGHEVLSTEE          
fig|267377.1.peg.308   Methanococcus maripaludis S2          MELDVTGTVCPMPVLKTKKALDSLTSGD−−ELTVTGDYKPALQNIVRFVEDKGHEVLSTEE          
fig|426368.9.peg.1323   Methanococcus maripaludis C7          MELDVTGTVCPMPVLKTKKALDSLNSGD−−ELTVKGDYKPALQNIVRFVEEKGHEILSSEE          
fig|402880.8.peg.1347   Methanococcus maripaludis C5          MELDVTGTVCPMPVLKTKKALDSLNSGD−−ELTVTGDYKPALQNIVRFVEEKGHEILSSEE          
fig|63737.11.peg.139   Nostoc punctiforme PCC 73102       TPDAQLDLRGTPCPINFVRTKLRLEKMPLGG−−LLEVWLDPG                                  
fig|63737.4.peg.128   Nostoc punctiforme PCC 73102       TPDAQLDLRGTPCPINFVRTKLRLEKMPLGG−−LLEVWLDPG                                  
fig|103690.10.peg.3010   Nostoc sp. PCC 7120       TPDAQLDLRGTPCPINFVRTKLRLEKMPPGA−−LLEVWLDPG                                  
fig|240292.3.peg.1059   Anabaena variabilis ATCC 29413       TPDAQLDLRGTPCPLNFVRTKLRLEKMPPGA−−LLEVWLDPG                                  
fig|118168.3.peg.4659   Microcoleus chthonoplastes PCC 7420       TPDAQLDLRGTPCPINFVRTKLRLEQMTPGS−−LLEVWLDPG                                  
fig|533247.5.peg.2634   Raphidiopsis brookii D9       TPDDQLDLRGTPCPINFVRTKLRLEQMSDGS−−LLEVWLDPG                                  
fig|533240.4.peg.796   Cylindrospermopsis raciborskii CS-505       TPDDQLDLRGTPCPINFVRTKLRLEQMSDGS−−LLEVWLDPG                                  
fig|329726.14.peg.350   Acaryochloris marina MBIC11017         DDQIDLRGTPCPLNFVRTKLHLQKMAPGS−−LLEVWLDPG                                  
fig|91464.3.peg.1686   Synechococcus sp. PCC 7335       HVDHRIDLRGTPCPLNFVRTKLTLEKMEPGS−−LLEVWLDPG                                  
fig|521011.3.peg.1186   Methanosphaerula palustris E1-9c          KRLDLHGVICPINFVKTKLALEELEPGD−−QLEVILDEGDAILNVPRSLKDEGHTIVKVS           
fig|555088.4.peg.1329   Dethiobacter alkaliphilus AHT 1            LDITGEVCPVTFIKVKLKLEDMASGE−−QLEVLLDDGTPIKNVPKTLKGDGHAVLSKEKQ         
fig|555088.4.peg.1334   Dethiobacter alkaliphilus AHT 1       QPDKTLDITGDQCPMTFVKTKLALEGIEAGQ−−FLEVFLNSGEPVKNVPRSLRNEGHKVVALEKQ         
fig|264732.11.peg.2134   Moorella thermoacetica ATCC 39073        ATKRLDITGDCCPITFVKTKLALEEMQPGE−−ILEVLLKDGEPLANVPRSLKSEGHKILQVKK          
fig|635013.3.peg.2423   Thermincola sp. JR       KVDATLDITSDVCPITFVKTKLKLEQMKKGE−−ILEVILNDGEPIQNVPRSVKDEGHKIITVEKV         
fig|1090321.3.peg.1394   Desulfitobacterium hafniense PCP-1       KADRVVDITSVVCPITFVKVKVALEELEPGQ−−LLEILMKDGEPIQNVPRSLKDEGHKLVQVE           
fig|138119.3.peg.3741   Desulfitobacterium sp. Y51       KADRVVDITSVVCPITFVKVKVALEELEPGQ−−LLEILMKDGEPIQNVPRSLKDEGHKLVQVE           
fig|521460.8.peg.1257   Anaerocellum thermophilum DSM 6725       KADVFLDITNLVCPMTFVKAKATMEDMEAGQ−−IIEIRMNEGEPIQNVPRSLKEEGHEILKV            
fig|351627.8.peg.1805   Caldicellulosiruptor saccharolyticus DSM 8903       KADVFLDITNLVCPMTFVKAKATMEDMEVGQ−−IIEIRMNEGEPIQNVPRSLKEEGHEILKV            
fig|404380.3.peg.1950   Geobacter bemidjiensis Bem           TIDLRGVSCPTNFVKAKLELEDIEAGT−−TVEFLLDDGEPVKNVPRSLKDEGHKLLGLKEV         
fig|443144.3.peg.2190   Geobacter sp. M21           TIDLRGVSCPTNFVKAKLELEDIEAGT−−TVEFLLDDGEPVKNVPRSLKDEGHKLLGLKEV         
fig|443143.4.peg.2237   Geobacter sp. M18          QTIDLRGVTCPTNFVMAKLELEEIEAGT−−CVEFLLDDGEPVKNVPRSLKDEGHKLLGLQER         
fig|269799.3.peg.1410   Geobacter metallireducens GS-15           TIDLRGVTCPTNFVKAKLALEMVDTGE−−VVEFLLDDGEPVKNVPRSLKGEGHKLVGLKEV         
fig|243231.1.peg.1343   Geobacter sulfurreducens PCA           TVDLRGVTCPTNFVKAKLALETVDTGA−−VVEFLLDDGEPVKNVPRSLKGEGHKLLGLKEA         
fig|316067.3.peg.814   Geobacter sp. FRC-32          QTVDLRGVSCPTNFVKAKLALEMLDEGE−−TVEFLLDDGEPVKNVPRSLKGEGHKLLGLKQV         
fig|351605.6.peg.4205   Geobacter uraniireducens Rf4          HTVDLRGVSCPTNFVKAKLALEMLDEGE−−VVEFLLDDGEPVKNVPRSLKGEGHKLIGLKEA         
fig|314345.3.peg.957   Mariprofundus ferrooxydans PV-1          VELDLSGVACPMNFVKTKIKLSTMPVGA−−QLAVILDDGAPINNVP                          
fig|293826.4.peg.55   Alkaliphilus metalliredigens QYMF           IVDLKGVKCPMNFVKAKVALGKIASGE−−EIGFYLDDDAPINNVPKSVEGEGHQIVNIDRE         
fig|293826.6.peg.57   Alkaliphilus metalliredigens QYMF           IVDLKGVKCPMNFVKAKVALGKIASGE−−EIGFYLDDDAPINNVPKSVEGEGHQIVNIDRE         
fig|589865.4.peg.881   Desulfurivibrio alkaliphilus AHT2       SVAATKNLRGVNCPMNLVYTKVAMKDIQPGE−−ILEIILDEGPPINNVPGSVKKEGHEVLSQ            
fig|273121.8.peg.949   Wolinella succinogenes DSM 1740             DYQGVACPMNFVKTKMDLAQMQSGE−−ILEILLDEGAPIENVPKSVANEGHLILGQTKE         
fig|123214.3.peg.561   Persephonella marina EX-H1            LDLRGVECPFNYVKAKMKLKEMDTGS−−ILVLTIDGEESIRSVPQSIRDDGHEIIDIQEE         
fig|224325.1.peg.549   Archaeoglobus fulgidus DSM 4304        ANEVLDIRGEVCPFTFIETKLKLEEMKSGE−−ILRVIIDHEPAVRDVPRSVEQEGHEVLSVEKV         
fig|292459.1.peg.1419   Symbiobacterium thermophilum IAM 14863       QPDRAIDLRGDVCPVTFAKTKIALEEMQIGQ−−VLLVRLDYEPATRNVPRSAELYGDEVLAVRQV         
fig|292459.5.peg.1475   Symbiobacterium thermophilum IAM 14863       QPDRAIDLRGDVCPVTFAKTKIALEEMQIGQ−−VLLVRLDYEPATRNVPRSAELYGDEVLAVRQV         
fig|123214.3.peg.186   Persephonella marina EX-H1       KVDRELDLRGEVCPFTFVKSKLIIEQMEPGQ−−VLKVILDYKPSVENVPKSMREEGQEVLEVKQ          
fig|436114.4.peg.990   Sulfurihydrogenibium sp. YO3AOP1       QIDRELDLKGEVCPFTFVKSKLIIEQMDKGQ−−VLRVILDYKPSVENVPKSMEMEGQEVLAVNQ          
fig|204536.4.peg.1064   Sulfurihydrogenibium azorense Az-Fu1       QVDRELDLKGEVCPFTFVKSKLIIEQMEKGQ−−ILRVILDYEPSVENVPKSMEMEGQKVLAVNK          
fig|608538.3.peg.1049   Hydrogenobacter thermophilus TK-6       KYDRELDIRGDVCPFTFVKSKLVLEQMEKGE−−ILRVIVDYRPSAENVPKSMREEGQEVLAVNQ          
fig|547143.3.peg.1292   Hydrogenobaculum sp. 3684        INKELDITGEVCPFTFVKSKLVLETMEKGE−−VLRVIVDYEPSAVSVPKSMRDEGQEVLATNK          
fig|547146.4.peg.1291   Hydrogenobaculum sp. SN        INKELDITGEVCPFTFVKSKLVLETMEKGE−−VLRVIVDYEPSAVSVPKSMRDEGQEVLATNK          
fig|380749.4.peg.1294   Hydrogenobaculum sp. Y04AAS1        INKELDITGEVCPFTFVKSKLVLETMGKGQ−−ILRVIVDYEPSAVSVPKSMRDEGQEVLATNK          
fig|638303.3.peg.106   Thermocrinis albus DSM 14484       KVDKELDIRGEVCPFTFVKSKLALEDMEVGQ−−VLRVLVDYKPSAESVPKSLREEGQEVLEVNQ          
fig|224324.8.peg.1331   Aquifex aeolicus VF5       KVDKELDIRGEVCPFTFVKSKLALEEMETGQ−−ILRVLVDYPPSAESVPKSMREEGQEVIAVNQ          
fig|391165.8.peg.396   Granulibacter bethesdensis CGDNIH1            LDVTADICPMTFVRTRIALDKLPSGA−−LLSVLTAGDEASRNVPQSAAALGHEIIAIE           
fig|502025.5.peg.1876   Haliangium ochraceum DSM 14365        ADEVLDLRGEVCPFTFVRTRLRLEELSLGA−−CLDILLDHEPAARNVPRSAREWGQEVEAVVRE         
fig|431947.7.peg.1788   Porphyromonas gingivalis ATCC 33277          KVVDTRGKLCPLPLILLKKAVDGTPVGE−−EISVMTDNETAKCNLRDYIGELGAVAIESEE          
fig|1125722.3.peg.794   Porphyromonas gingivalis W50          KVVDTRGKLCPLPLILLKKAVDGTPVGE−−EISVMTDNETAKCNLRDYIGELGAVAIESEE          
fig|242619.1.peg.1614   Porphyromonas gingivalis W83          KVVDTRGKLCPLPLILLKKAVDGTPVGE−−EISVMTDNETAKCNLRDYIGELGAVAIESEE          
fig|242619.8.peg.1744   Porphyromonas gingivalis W83          KVVDTRGKLCPLPLILLKKAVDGTPVGE−−EISVMTDNETAKCNLRDYIGELGAVAIESEE          
fig|456442.10.peg.327   Methanoregula boonei 6A8          RTLDIRGKVCPHCLIAVKKETDTMKPGD−−DLVVTCDHPPAATKNIPLYAKE                     
fig|471855.4.peg.2191   Slackia heliotrinireducens DSM 20476                     MPLMTLKKALAEAQDGQ−−EIEVVFTCPEATVVLPEYCENNGIEIVGFDKE         
fig|352165.3.peg.2251   Pyramidobacter piscolens W5455            LDTMGKDCPLPLIELKKAVAASQKGE−−EIEIAFTCPEAVTNLPRYCKEDGHEVLSFEK          
fig|645512.3.peg.317   Jonquetella anthropi E3_33 E1         NIKLDTMGKDCPIPLIELKKAIAGSSKGD−−VIEITFTCPEAVTNLPRYCKEENHEVISFE           
fig|887287.3.peg.1008   Campylobacter coli 84-2          VTLDTRGKVCPFPLVEAKNLVQTLKSGE−−ELEILFDCTQATETIPQWAAEEGHEIVDFE           
fig|360109.10.peg.2074   Campylobacter jejuni subsp. doylei 269.97          VTLDTRGKVCPFPLVEAKNLVQTLKSGE−−ELEILFDCTQATETIPQWAAEEGHEIVNFE           
fig|537970.9.peg.1460   Helicobacter canadensis MIT 98-5491 (Prj:30719)          AILDTRGKVCPFPLVDAKNFIQTLQSGE−−ELEILFDCTQATETIPQWAAEEGHEVINFE           
fig|596312.3.peg.846   Micrococcus luteus SK58        AKHLLETDGQVCPFPLVEANQAMQQIPSGD−−ELVIDFDCTQATDSLPRWAAENGHEV               
fig|465515.4.peg.2212   Micrococcus luteus NCTC 2665        AKHLLETDGQVCPFPLVEANQAMEQIPTGD−−ELVIDFDCTQATDSLPRWAAENGHEV               
fig|446465.4.peg.1431   Brachybacterium faecium DSM 4810         TYTLETNGAVCPFPLIDAKNAMQQLTTGD−−DLVIGFDCTQATDSLPQWAAEDGHEVVAFDRV         
fig|478801.4.peg.1901   Kytococcus sedentarius DSM 20547         TYTLDTAGDVCPFPLVDARAAMEQLAPGD−−ELRIDFDCTQATESLPQWAAEDGHEV               
fig|306537.10.peg.169   Corynebacterium jeikeium K411            LDTLGAVCPFPLIDAKAAMADLSVGD−−SLQIDFDCTQATDAIPRWAATDGHEVTNFEQ          
fig|525262.3.peg.2033   Corynebacterium jeikeium ATCC 43734            LDTLGAVCPFPLIDAKAAMADLSVGD−−SLQIDFDCTQATDAIPRWAATDGHEVTNFEQ          
fig|306537.3.peg.229   Corynebacterium jeikeium K411            LDTLGAVCPFPLIDAKAAMADLSVGD−−SLQIDFDCTQATDAIPRWAATDGHEVTNFEQ          
fig|504474.3.peg.174   Corynebacterium urealyticum DSM 7109            LDSLGAVCPFPLIDAKAAIAQLEVGD−−SLQIDFDCTQATDAIPRWAATDGHEVTNFEQ          
fig|645127.4.peg.171   Corynebacterium kroppenstedtii DSM 44385           VLDTLGAVCPFPLIEAKAAMQQLSSGD−−ELVIDFDCTQATDAIPRWAATDGHEVTNFE           
fig|553204.6.peg.964   Corynebacterium amycolatum SK46          YELDTVGAVCPFPLIEAKDAIGKIEIGE−−ELVIPFDCTQATDAIPRWAAKDGHEVTNFEQ          
fig|378753.5.peg.2322   Kocuria rhizophila DC2201            LDSLGAVCPFPLIEAKDVMQTLQTGD−−HLVIDFDCTQATEAIPQWAATDGHEVTDFVE          
fig|196164.6.peg.2697   Corynebacterium efficiens YS-314            LDSLGAVCPFPLIEAKDVMKTLQSGD−−HLVIDFDCTQATDAIPQWCATDGHEVTDFKE          
fig|548477.4.peg.900   Corynebacterium glucuronolyticum ATCC 51867            LDTLGSVCPFPLIDAKQAMNELEPGE−−CLRIDFDCTQATESIPRWAADEGYEVTDSHEV         
fig|548478.3.peg.1754   Corynebacterium glucuronolyticum ATCC 51866            LDTLGSVCPFPLIDAKQAMNELEPGE−−CLRIDFDCTQATESIPRWAADEGYEVTDFHEV         
fig|553206.4.peg.14   Corynebacterium tuberculostearicum SK141          YVLDTLGAVCPFPLIEAKQVMAELEPGE−−ALVIDFDCTQATESIPQWAADEGHEI               
fig|525263.3.peg.1930   Corynebacterium lipophiloflavum DSM 44291            LDTLGAVCPFPLIEAKDAIAELDDGE−−KLVIDFDCTQATESIPQWAADNGH                 
fig|585529.3.peg.2122   Corynebacterium genitalium ATCC 33030            LDTLGAVCPFPLIEAKDAIAELDSGE−−ALVIDFDCTQATESIPQWAADNGHSV               
fig|754093.3.peg.4760   Shigella dysenteriae 1617          KKLDVVTQVCPFPLIEAKAALAEMASGD−−ELVIEFDCTQATEAIPQWAAEEGHAITDYQQ          
fig|300267.13.peg.2695   Shigella dysenteriae Sd197          KKLDVVTQVCPFPLIEAKAALAEMASGD−−ELVIEFDCTQATEAIPQWAAEEGHAITDYQQ          
fig|1116036.3.peg.2733   Escherichia coli 2875150          KKLDVVTQVCPFPLIEAKAALAEMASGD−−ELVIEFDCTQATEAIPQWAAEEGHAITDYQQ          
fig|1181748.3.peg.2852   Escherichia coli KTE202          KKLDVVTQVCPFPLIEAKAALAEMASGD−−ELVIEFDCTQATEAIPQWAAEEGHAITDYQQ          
fig|439855.10.peg.1203   Escherichia coli SMS-3-5          KKLDVVTQVCPFPLIEAKAALAEMASGD−−ELVIEFDCTQATEAIPQWAAEEGHAITDYQQ          
fig|444454.5.peg.1679   Escherichia coli O157:H7 str. EC4024          KKLDVVTQVCPFPLIEAKAALAEMASGD−−ELVIEFDCTQATEAIPQWAAEEGHAITDYQQ          
fig|550677.3.peg.1550   Escherichia coli B354          KKLDVVTQVCPFPLIEAKAALAEMASGD−−ELVIEFDCTQATEAIPQWAAEEGHAITDYQQ          
fig|585054.5.peg.2013   Escherichia fergusonii ATCC 35469          KKLDVVTQVCPFPLIEAKAALAEMASGD−−ELVIEFDCTQATEAIPQWAAEEGHAITDYQQ          
fig|591020.3.peg.2503   Shigella flexneri 2002017          KKLDVVTQVCPFPLIEAKAALAEMASGD−−ELVIEFDCTQATEAIPQWAAEEGHAITDYQQ          
fig|621.8.peg.5079   Shigella boydii ATCC 9905          KKLDVVTQVCPFPLIEAKAALAEMASGD−−ELVIEFDCTQATEAIPQWAAEEGHAITDYQQ          
fig|656435.3.peg.1738   Escherichia coli TA124          KKLDVVTQVCPFPLIEAKAALAEMASGD−−ELVIEFDCTQATEAIPQWAAEEGHAITDYQQ          
fig|754091.3.peg.2361   Shigella flexneri CCH060          KKLDVVTQVCPFPLIEAKAALAEMASGD−−ELVIEFDCTQATEAIPQWAAEEGHAITDYQQ          
fig|766155.3.peg.2372   Shigella flexneri 1485-80          KKLDVVTQVCPFPLIEAKAALAEMASGD−−ELVIEFDCTQATEAIPQWAAEEGHAITDYQQ          
fig|868171.3.peg.2760   Escherichia coli DEC8B          KKLDVVTQVCPFPLIEAKAALAEMASGD−−ELVIEFDCTQATEAIPQWAAEEGHAITDYQQ          
fig|868184.3.peg.2357   Escherichia coli DEC10E          KKLDVVTQVCPFPLIEAKAALAEMASGD−−ELVIEFDCTQATEAIPQWAAEEGHAITDYQQ          
fig|868210.3.peg.2645   Escherichia coli DEC15E          KKLDVVTQVCPFPLIEAKAALAEMASGD−−ELVIEFDCTQATEAIPQWAAEEGHAITDYQQ          
fig|869690.3.peg.3817   Escherichia coli 2.4168          KKLDVVTQVCPFPLIEAKAALAEMASGD−−ELVIEFDCTQATEAIPQWAAEEGHAITDYQQ          
fig|754089.3.peg.2152   Escherichia coli STEC_MHI813          KKLDVVTQVCPFPLIEAKAALAEMASGD−−KLVIEFDCTQATEAIPQWAAEEGHAITDYQQ          
fig|1068608.3.peg.3747   Escherichia coli XH140A          KKLDVVTQVCPFPLIEAKAALAEMVSGD−−ELVIEFDCTQATEAIPQWAAEEGHAITDYQQ          
fig|481805.3.peg.1745   Escherichia coli ATCC 8739          KKLDVVTQVCPFPLIEAKAALAEMTSGD−−ELVIEFDCTQATEAIPQWAAEEGHAITDYQQ          
fig|670905.4.peg.2243   Escherichia coli OK1357          KKLDVVTQVCPFPLIEAKAALAGMASGD−−ELVIEFDCTQATEAIPQWAAEEGHAITDYQQ          
fig|637910.3.peg.2082   Citrobacter rodentium ICC168          KKLDVVTQVCPFPLIEAKAALAEMASGD−−QLVIEFDCTQATEAIPQWAAEEGHTITDYQQV         
fig|343509.6.peg.3702   Sodalis glossinidius str. 'morsitans'          KKLDVISQVCPFPLIEAQSAMAALQVGD−−ELVIDFDCTQATESLPQWAAEQGHVVTDYQQV         
fig|1245026.4.peg.2998   Bacillus coagulans XZL9         EKVLEVMGQVCPFPLIEAKKAIEEIQPGD−−DLVIHFDCTQATESIPRWAAEAGHTVTNFEQ          
fig|345219.8.peg.1712   Bacillus coagulans 36D1         EKVLEVMGQVCPFPLIEAKKAIEEIQPGD−−DLVIHFDCTQATESIPRWAAEAGHTVTNFEQ          
fig|562970.4.peg.3385   Bacillus tusciae DSM 2912         THHLQVLGYVCPFPVVEAEKAMANLAPGD−−ELVIDFDCTQATESLPRWAMQHGHRVTAFEQ          
fig|292459.5.peg.1385   Symbiobacterium thermophilum IAM 14863        AELHLDVLGEACPYPLIMAKQKINEVAPGG−−RLIIDFDCTQATETLPRWATESGHAVEEFRK          
fig|292459.1.peg.1333   Symbiobacterium thermophilum IAM 14863        AELHLDVLGEACPYPLIMAKQKINEVAPGG−−RLIIDFDCTQATETLPRWATESGHAVEEFRK          
fig|649743.3.peg.617   Actinomyces sp. oral taxon 848 str. F0332          YVLDTIGQVCPFPLVEAKRAIGGLRSGD−−ELQIDFDCTQATDSIPAWASAAGHAVTDFRQ          
fig|321955.4.peg.338   Brevibacterium linens BL2          QVLETNGLVCPFPLVEAKDAIGGMDNGD−−ELVINFDCTQATEAIPQWAAENGYPV               
fig|272629.3.peg.718   Mannheimia haemolytica PHL213         NVRLPASGLVCPFPLVEAKAAMAKLNKGD−−SLTIEFDCTQATEAIPNWAEEEGYEVTDYQQ          
fig|669261.3.peg.2289   Mannheimia haemolytica serotype A2 str. OVINE         NVRLPASGLVCPFPLVEAKAAMAKLNKGD−−SLTIEFDCTQATEAIPNWAEEEGYEVTDYQQ          
fig|634176.4.peg.1062   Aggregatibacter aphrophilus NJ8700         NVILDTVGHLCPFPLIEGKKAMAKLNRGD−−SLTINFDCAQATENLPNWAAEEGYQVSHFEQ          
fig|981539.3.peg.109   Streptococcus gallolyticus subsp. gallolyticus ATCC 43143          VELETGGLVCPFPLIDAKNKMKELSIGD−−ELLIKFDCTQATESIPNWA                       
fig|471872.6.peg.714   Streptococcus infantarius subsp. infantarius ATCC BAA-102          VELETGGLVCPFPLIDAKNKMKELSIGD−−ELLIKFDCTQATESIPNW                        
fig|1187956.3.peg.1826   Streptococcus thermophilus MN-ZLW-002            LETGGLVCPFPLIDAKKKMAELAVGD−−ELLIAFDCTQATESIPNWA                       
fig|264199.4.peg.1826   Streptococcus thermophilus LMG 18311            LETGGLVCPFPLIDAKKKMAELAVGD−−ELLIAFDCTQATESIPNWA                       
fig|347254.3.peg.1821   Streptococcus salivarius JIM8780            LETGGLVCPFPLIDAKKKMAELATGD−−ELLIAFDCTQATESIPNWA                       
fig|176279.9.peg.1466   Staphylococcus epidermidis RP62A          YELGTVGMVCPFPLIEAQKKMNELNQGD−−ELKIDFDCTQATEALPNWAAENGYPVTNYEQ          
fig|176280.1.peg.1645   Staphylococcus epidermidis ATCC 12228          YELGTVGMVCPFPLIEAQKKMNELNQGD−−ELKIDFDCTQATEALPNWAAENGYPVTNYEQ          
fig|176280.10.peg.1609   Staphylococcus epidermidis ATCC 12228          YELGTVGMVCPFPLIEAQKKMNELNQGD−−ELKIDFDCTQATEALPNWAAENGYPVTNYEQ          
fig|596317.3.peg.32   Staphylococcus epidermidis SK135          YELGTVGMVCPFPLIEAQKKMNELNQGD−−ELKIDFDCTQATEALPNWAAENGYPVTNYEQ          
fig|979220.3.peg.1667   Staphylococcus epidermidis NIH05005          YELGTVGMVCPFPLIEAQKKMNELNQGD−−ELKIDFDCTQATEALPNWAAENGYPVTNYEQ          
fig|525376.3.peg.2007   Staphylococcus epidermidis W23144          YELGTVGMVCPFPLIEAQKKMNDLNQGD−−ELKIDFDCTQATEALPNWAAENGYPVTNYEQ          
fig|979204.3.peg.119   Staphylococcus epidermidis NIHLM061          YELGTVGMVCPFPLIEAQKKMNDLNQGD−−ELKIDFDCTQATEALPNWAAENGYPVTNYEQ          
fig|553212.3.peg.2282   Staphylococcus capitis SK14          HELGTVGMVCPFPLIEAQKKMEELEQGD−−ELKIDFDCTQATEALPNWAAENGYPVTNYEQ          
fig|904334.3.peg.27   Staphylococcus epidermidis VCU116          HELGTVGMVCPFPLIEAQKKMEELEQGD−−ELKIDFDCTQATEALPNWAAENGYPVTNYEQ          
fig|525378.3.peg.2245   Staphylococcus epidermidis M23864:W1          HELGTVGMVCPFPLIEAQKKMQELNQGD−−ELKIDFDCTQATEALPNWAAENGYPVTNYEQ          
fig|596319.3.peg.1911   Staphylococcus warneri L37603          YELGTVGMVCPFPLIEAQKKMTELDSGD−−ELKIDFDCTQATEAIPNWAAENGYPVTNYEQ          
fig|1123523.3.peg.1997   Staphylococcus aureus subsp. aureus 11819-97          HELGTVGMVCPFPLIEAQKKMATLQSGD−−ELKIDFDCTQATEAIPNWAAENGYPVTNYEQ          
fig|1158485.3.peg.1168   Staphylococcus aureus M1311          HELGTVGMVCPFPLIEAQKKMATLQSGD−−ELKIDFDCTQATEAIPNWAAENGYPVTNYEQ          
fig|1158495.3.peg.1986   Staphylococcus aureus M1462          HELGTVGMVCPFPLIEAQKKMATLQSGD−−ELKIDFDCTQATEAIPNWAAENGYPVTNYEQ          
fig|450394.6.peg.2550   Staphylococcus aureus subsp. aureus USA300_TCH959          HELGTVGMVCPFPLIEAQKKMATLQSGD−−ELKIDFDCTQATEAIPNWAAENGYPVTNYEQ          
fig|644279.4.peg.2188   Staphylococcus aureus subsp. aureus 132          HELGTVGMVCPFPLIEAQKKMATLQSGD−−ELKIDFDCTQATEAIPNWAAENGYPVTNYEQ          
fig|1169255.3.peg.1172   Staphylococcus aureus M0946          HELGTVGMVCPFPLIEAQKKMATLQSGD−−ELKIDFDCTQATEAIPNWAAENGYPVTNYEQ          
fig|1075079.3.peg.1871   Staphylococcus aureus ST228/16035          HELGTVGMVCPFPLIEAQKKMATLQSGD−−ELKIDFDCTQATEAIPNWAAENGYPITNYEQ          
fig|1158486.3.peg.1539   Staphylococcus aureus M1320          HELGTVGMVCPFPLIEAQKKMATLQSGD−−ELKIDFDCTQATEAIPNWAAENGYPITNYEQ          
fig|1169273.3.peg.1929   Staphylococcus aureus M1286          HELGTVGMVCPFPLIEAQKKMATLQSGD−−ELKIDFDCTQATEAIPNWAAENGYPITNYEQ          
fig|418127.4.peg.1882   Staphylococcus aureus subsp. aureus Mu3          HELGTVGMVCPFPLIEAQKKMATLQSGD−−ELKIDFDCTQATEAIPNWAAENGYPITNYEQ          
fig|505321.3.peg.541   Staphylococcus aureus subsp. aureus str. CF-Marseille          HELGTVGMVCPFPLIEAQKKMATLQSGD−−ELKIDFDCTQATEAIPNWAAENGYPITNYEQ          
fig|553571.3.peg.429   Staphylococcus aureus A6300          HELGTVGMVCPFPLIEAQKKMATLQSGD−−ELKIDFDCTQATEAIPNWAAENGYPITNYEQ          
fig|273036.6.peg.2034   Staphylococcus aureus RF122          HELGTVGMVCPFPLIEAQKKMATLKSGD−−ELKIDFDCTQATEAIPNWAAENGYPVTNYELID        
fig|396513.4.peg.1548   Staphylococcus carnosus subsp. carnosus TM300          YELGTVGMVCPFPLIEAQKKMETLNIGD−−ELKIDFDCTQATEAIPNWAAEK                    
fig|458233.11.peg.465   Macrococcus caseolyticus JCSC5402          YELGTVGMVCPFPLIEAQKKIEALSSGD−−ELKIDFDCTQATEAIPNWAAEQGYPVTNYEQ          
fig|435837.3.peg.885   Staphylococcus hominis subsp. hominis C80          YELGTVGMVCPFPLIEAQKKMETLKNGD−−ELKIDFDCTQATEAIPNWAAEQGYPVTNYEQ          
fig|904339.3.peg.293   Staphylococcus hominis VCU122          YELGTVGMVCPFPLIEAQKKMETLKNGD−−ELKIDFDCTQATEAIPNWAAEQGYPVTNYEQ          
fig|1131257.3.peg.848   Staphylococcus saprophyticus subsp. saprophyticus KACC 16562          HELGTVGMVCPFPLIEAQKKMNTLDNGE−−ELKIDFDCTQATEALPNWAAEQGYPVTNYEQ          
fig|342451.4.peg.1296   Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305          HELGTVGMVCPFPLIEAQKKMNTLDNGE−−ELKIDFDCTQATEALPNWAAEQGYPVTNYEQ          
fig|1034809.4.peg.1004   Staphylococcus lugdunensis N920143          YELGTVGMVCPFPLIEAQKKMQTLDAGD−−ELKIDFDCTQATEAIPNWAAEQGYPVTNYEQ          
fig|883164.3.peg.20   Staphylococcus lugdunensis ACS-027-V-Sch2          YELGTVGMVCPFPLIEAQKKMQTLDAGD−−ELKIDFDCTQATEAIPNWAAEQGYPVTNYEQ          
fig|904346.3.peg.866   Staphylococcus lugdunensis VCU139          YELGTVGMVCPFPLIEAQKKMQTLDAGD−−ELKIDFDCTQATEAIPNWAAEQGYPVTNYEQ          
fig|279808.3.peg.1572   Staphylococcus haemolyticus JCSC1435          YELGTVGMVCPFPLIEAQKKMQTLDNGD−−ELKIDFDCTQATEAIPNWAAEQGYPVTNYEQ          
fig|580331.4.peg.76   Thermoanaerobacter italicus Ab9          HELITFGEICPLPLLKAIEKYKKMEKGD−−MLKIVVDHSCSLKNIQ                          
fig|583358.4.peg.135   Thermoanaerobacter mathranii subsp. mathranii str. A3          HELMTFGEICPLPLLKAIEKYKKMEKGD−−MLKIVVDHSCSLKNIQ                          
fig|273068.5.peg.75   Thermoanaerobacter tengcongensis MB4                GEICPLPLLKAKKKYEEMKEGE−−ILKVVVDHRCTLDNLETY                        
fig|273068.3.peg.254   Thermoanaerobacter tengcongensis MB4          HEIMCMGEICPLPLLKAKKKYEEMKEGE−−ILKVVVDHRCTLDNLETY                        
fig|635013.3.peg.542   Thermincola sp. JR        AQKKLDLLGEVCPFPLFKTQAELEQMNSGD−−VLLIEVDFNQSVRNIIKWCEDQGH                 
fig|246194.6.peg.2448   Carboxydothermus hydrogenoformans Z-2901            IDLTGEVCPVPLWRVQEELKKLQPGD−−KITVITDFSRSVRNI                           
fig|401526.3.peg.1322   Thermosinus carboxydivorans Nor1          HYLDMLGEICPHPLHMAQAKMEKLKSGD−−VLVVESDFSRSVRNLLAWADKQ                    
fig|292459.1.peg.102   Symbiobacterium thermophilum IAM 14863        ATYTLNVYGEMCPAPLLKAEAKLRSMQPGD−−LLIMESDHSCTVR                              
fig|292459.5.peg.105   Symbiobacterium thermophilum IAM 14863        ATYTLNVYGEMCPAPLLKAEAKLRSMQPGD−−LLIMESDHSCTVR                              
fig|264732.11.peg.482   Moorella thermoacetica ATCC 39073            MDTCGEMCPIPIVRARVKLKQMAPGD−−ILVVTSDHSCTSQSLAETMAKMGHRV               
fig|573062.3.peg.1568   Thermoanaerobacter sp. X513        AEYRLDCLGEACPVPLLKTQKEMEKLKVGD−−VLIVEIDHSCAMKNVPEWARNMGYNVEIEEV          
fig|580331.4.peg.79   Thermoanaerobacter italicus Ab9        AEYRLDCLGEACPVPLLKTQKEMEKLKVGD−−VLIVEIDHSCAMKNVPEWARNMGYNVEIEEV          
fig|583358.4.peg.138   Thermoanaerobacter mathranii subsp. mathranii str. A3        AEYRLDCLGEACPVPLLKTQKEMEKLKVGD−−VLIVEIDHSCAMKNVPEWARNMGYNVEIEEV          
fig|519441.4.peg.145   Streptobacillus moniliformis DSM 12112           TLDCLGEACPVPLIRTQGKMEELEIGD−−VLVVSIDHSCAMKNIPEWARKVGHNVEIEE           
fig|469381.4.peg.2073   Dethiosulfovibrio peptidovorans DSM 11002         EYTLDCLGEACPIPLIKAQKKMAEMSVGD−−TITIEIDHSCAVKNVPEWANKE                    
fig|350688.5.peg.1070   Alkaliphilus oremlandii OhILAs        AEYELDCMYEACPIPLLKALKKLNTMKIGD−−VLVMRTDHNCSITNVVEWTKKQGH                 
fig|212717.8.peg.366   Clostridium tetani E88            LNCLSEVCPIPILRAIKEFKTMEAGD−−ILILHSDHSCVGVDIKKWA                       
fig|386415.6.peg.1844   Clostridium novyi NT          KELDCLYEACPVPLIKAVKELKTMDAGD−−ILILHSDHSCVGISVEEW                        
fig|212717.8.peg.1188   Clostridium tetani E88          KEVDCLYEACPIPIIKAIKELKKMKSGD−−ILILHSDHSCVGISMEEW                        
fig|445337.5.peg.1868   Clostridium botulinum C str. Eklund          KELDCLYEACPVPLIKAVKELKNMNSGD−−ILILHSDHSCVGISVEEWGEKNHYPVRVIEIED        
fig|126740.6.peg.1857   Thermotoga sp. RQ2         TKLLDMRGQICPVPEITTRKELEKLQPGE−−TLIVMCDYPLSGERITSFSLREGYEV               
fig|590168.4.peg.1805   Thermotoga naphthophila RKU-10         TKLLDMRGQICPVPEITTRKELEKLQPGE−−TLIVMCDYPLSGERITSFSLREGYEV               
fig|309803.4.peg.1592   Thermotoga neapolitana DSM 4359            LDMRGQICPVPEITTRKELEKLQPGE−−TLIVMCDYPLSGERITSFSLREGYEV               
fig|443254.3.peg.485   Marinitoga piezophila KA3         TKLLDMRGQICPVPEITTRKELEKLQPGE−−TLIIVCDYPLSGERITSFSLREGYEV               
fig|390874.10.peg.1777   Thermotoga petrophila RKU-1         TKLLDMRGQICPVPEITTRKELEKLQPGE−−TLIIVCDYPLSGERITSFSLREGYEV               
fig|416591.5.peg.1381   Thermotoga lettingae TMO       KPKRVLDFRGETCPIPELTTRRELKELTNGE−−TLLVIVDYPLSKERIISFCRKMGYKVIVVDD          
fig|126740.6.peg.1851   Thermotoga sp. RQ2       QVTKTLDVRGEVCPVPDVETKRALQNMKPGE−−ILEVWIDYPMSKERIPETVKKLGHEVLEIEEV         
fig|309803.4.peg.1587   Thermotoga neapolitana DSM 4359       QVTKTLDVRGEVCPVPDVETKRALQNMKPGE−−ILEVWIDYPMSKERIPETVKKLGHEVLEIEEV         
fig|390874.10.peg.1772   Thermotoga petrophila RKU-1       QVTKTLDVRGEVCPVPDVETKRALQNMKPGE−−ILEVWIDYPMSKERIPETVKKLGHEVLEIEEV         
fig|443254.3.peg.490   Marinitoga piezophila KA3       QVTKTLDVRGEVCPVPDVETKRALQNMKPGE−−ILEVWIDYPMSKERIPETVKKLGHEVLEIEEV         
fig|590168.4.peg.1799   Thermotoga naphthophila RKU-10       QVTKTLDVRGEVCPVPDVETKRALQNMKPGE−−ILEVWIDYPMSKERIPETVKKLGHEVLEIEEV         
fig|416591.5.peg.1376   Thermotoga lettingae TMO       QVAKSLDVRGEVCPVP