(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00002893

fig|502801.6.peg.3463   Yersinia pseudotuberculosis PB1/+            FKYVAISR−−−−−−−−−−−−−−−−−−−SGTKITGDI−−−DAENIRIARYLLYKKNMHV−−LSI−−−−KKRILLFNKY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VVK−−−−−−−−−−−−−−−−−−−−−−KN−−−−−SNKTDL−−VLITRQIATLVNASMPLDEVLDIVG−−−K−−−−QNSKSK−−−MI−−−E−−−−−−−−−−IIQRIRVNIQEGHSFADA−−−−−LSPFPAVF−−SPLYKTMVTAGEVSGHL−−−−−−−−−−−GLVLVRLADHIEQTQKIQRKIIQALIYPCVLV−−−LISLSVIII−−LLTAVVPNIVEQFSFSET−−ALPLST−−−KVLMILSYSIKENV−−−−−−−−IF−−−−−−−IMA−−IG−−−−VSAVIF−−−−−−−LNRL−−LK−−INKIN−−−V−−−−FFHRH−−Y−−−−−L−−SL−−−PMLGNMFVRINTSRYLRTLTTL−−−HSNGVTIVQAMSISNAVLT−−−−−−−−−NVYIKNKLN−−−−−−−−−−−−ISVKLVSEGCSLSSSL−−−VDS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−G−−−−−−VFPPIIL−−−−−−−−HMIISGERSGKLDHMLETVAGVQEEELMNQISIVMSLLEPTIIIVMAAFISFVILSILQPILEINSLV
fig|229193.1.peg.2744   Yersinia pestis biovar Medievalis str. 91001            FKYVAISR−−−−−−−−−−−−−−−−−−−SGTKITGDI−−−DAENIRIARYLLYKKNMHV−−LSI−−−−KKRILLFNKY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VVK−−−−−−−−−−−−−−−−−−−−−−KN−−−−−SNKTDL−−VLITRQIATLVNASMPLDEVLDIVG−−−K−−−−QNSKSK−−−MI−−−E−−−−−−−−−−IIQRIRVNIQEGHSFADA−−−−−LSPFPAVF−−SPLYKTMVTAGEVSGHL−−−−−−−−−−−GLVLVRLADHIEQTQKIQRKIIQALIYPCVLV−−−LISLSVIII−−LLTAVVPNIVEQFSFSET−−ALPLST−−−KVLMILSYSIKENV−−−−−−−−IF−−−−−−−IMA−−IG−−−−VSAVIF−−−−−−−LNRL−−LK−−INKIN−−−V−−−−FFHRH−−Y−−−−−L−−SL−−−PMLGNMFVRINTSRYLRTLTTL−−−HSNGVTIVQAMSISNAVLT−−−−−−−−−NVYIKNKLN−−−−−−−−−−−−ISVKLVSEGCSLSSSL−−−VDS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−G−−−−−−VFPPIIL−−−−−−−−HMIISGERSGKLDHMLETVAGVQEEELMNQISIVMSLLEPTIIIVMAAFISFVILSILQPILEINSLV
fig|273123.1.peg.3150   Yersinia pseudotuberculosis IP 32953            FKYVAISR−−−−−−−−−−−−−−−−−−−SGTKITGDI−−−DAENIRIARYLLYKKNMHV−−LSI−−−−KKRILLFNKY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VVK−−−−−−−−−−−−−−−−−−−−−−KN−−−−−SNKTDL−−VLITRQIATLVNASMPLDEVLDIFG−−−K−−−−QNSKSK−−−MI−−−E−−−−−−−−−−IIQRIRVNIQEGHSFADA−−−−−LSPFPAVF−−SPLYKTMVTAGEVSGHL−−−−−−−−−−−GLVLVRLADHIEQTQKIQRKIIQALIYPCVLV−−−LISLSVIII−−LLTAVVPNIVEQFSFSET−−ALPLST−−−KVLMILSYSIKENV−−−−−−−−IF−−−−−−−IMA−−IG−−−−VSAVIF−−−−−−−LNRL−−LK−−INKIN−−−V−−−−FFHRH−−Y−−−−−L−−SL−−−PMLGNMFVRINTSRYLRTLTTL−−−HSNGVTIVQAMSISNAVLT−−−−−−−−−NVYIKNKLN−−−−−−−−−−−−ISVKLVSEGCSLSSSL−−−VDS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−G−−−−−−VFPPIIL−−−−−−−−HMIISGERSGKLDHMLETVAGVQEEELMNQISIVMSLLEPTIIIVMAAFISFVILSILQPILEINSLV
fig|273123.10.peg.3704   Yersinia pseudotuberculosis IP 32953            FKYVAISR−−−−−−−−−−−−−−−−−−−SGTKITGDI−−−DAENIRIARYLLYKKNMHV−−LSI−−−−KKRILLFNKY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VVK−−−−−−−−−−−−−−−−−−−−−−KN−−−−−SNKTDL−−VLITRQIATLVNASMPLDEVLDIFG−−−K−−−−QNSKSK−−−MI−−−E−−−−−−−−−−IIQRIRVNIQEGHSFADA−−−−−LSPFPAVF−−SPLYKTMVTAGEVSGHL−−−−−−−−−−−GLVLVRLADHIEQTQKIQRKIIQALIYPCVLV−−−LISLSVIII−−LLTAVVPNIVEQFSFSET−−ALPLST−−−KVLMILSYSIKENV−−−−−−−−IF−−−−−−−IMA−−IG−−−−VSAVIF−−−−−−−LNRL−−LK−−INKIN−−−V−−−−FFHRH−−Y−−−−−L−−SL−−−PMLGNMFVRINTSRYLRTLTTL−−−HSNGVTIVQAMSISNAVLT−−−−−−−−−NVYIKNKLN−−−−−−−−−−−−ISVKLVSEGCSLSSSL−−−VDS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−G−−−−−−VFPPIIL−−−−−−−−HMIISGERSGKLDHMLETVAGVQEEELMNQISIVMSLLEPTIIIVMAAFISFVILSILQPILEINSLV
fig|502800.3.peg.993   Yersinia pseudotuberculosis YPIII            FKYVAISR−−−−−−−−−−−−−−−−−−−SGTKITGDI−−−DAENIRIARYLLYKKNMHV−−LSI−−−−KKRILLFNKY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VVK−−−−−−−−−−−−−−−−−−−−−−KN−−−−−SNKTDL−−VLITRQIATLVNASMPLDEVLDIVG−−−K−−−−QNSKSK−−−MI−−−E−−−−−−−−−−IIQRIRVNIQEGHSFADA−−−−−LSPFSAVF−−SPLYKTMVTAGEVSGHL−−−−−−−−−−−GLVLVRLADHIEQTQKIQRKIIQALIYPCVLV−−−LISLSVIII−−LLTAVVPNIVEQFSFSET−−ALPLST−−−KVLMILSYSIKENV−−−−−−−−IF−−−−−−−IMA−−IG−−−−VSAVIF−−−−−−−LNRL−−LK−−INKIN−−−V−−−−FFHRH−−Y−−−−−L−−SL−−−PMLGNMFVRINTSRYLRTLTTL−−−HSNGVTIVQAMSISNAVLT−−−−−−−−−NVYIKNKLN−−−−−−−−−−−−ISVKLVSEGCSLSSSL−−−VDS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−G−−−−−−VFPPIIL−−−−−−−−HMIISGERSGELDHMLETVAGVQEEELMNQISIVMSLLEPTIIIVMAAFISFVILSILQPILEINSLV
fig|349746.3.peg.3993   Yersinia pestis Angola            FKYVAISR−−−−−−−−−−−−−−−−−−−SGTKITGDI−−−DAENIRIARYLLYKKNMHV−−LSI−−−−KKRILLFNKY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VVK−−−−−−−−−−−−−−−−−−−−−−KN−−−−−SNKTDL−−VLITRQIATLVNASMPLDEVLDIVG−−−K−−−−QNSKSK−−−MI−−−E−−−−−−−−−−IIQRIRVNIQEGHSFADA−−−−−LSPFPAVF−−SPLYKTMVTAGEVSGHL−−−−−−−−−−−GLVLVRLADHIEQTQKIQRKIIQALIYPCVLV−−−LISLSVIII−−LLTAVVPNIVEQFSFSET−−ALPLST−−−KVLMILSYSIKENV−−−−−−−−IF−−−−−−−IMA−−IG−−−−VSAVIF−−−−−−−LNRL−−LK−−INKIN−−−V−−−−FFHRH−−Y−−−−−L−−SL−−−PMLGNMFVRINTSRYLRTLTTL−−−HSNGVTIVQAMSISNAVLT−−−−−−−−−NVYIKNKLN−−−−−−−−−−−−ISVKLVSEGCSLSSSL−−−VDS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−G−−−−−−VFPPIIL−−−−−−−−HMIISGERSGKLDHMLETVAGVXEEELMNQISIVMSLLEPTIIIVMAAFISFIILSILQPILEINSLV
fig|349746.9.peg.3825   Yersinia pestis Angola            FKYVAISR−−−−−−−−−−−−−−−−−−−SGTKITGDI−−−DAENIRIARYLLYKKNMHV−−LSI−−−−KKRILLFNKY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VVK−−−−−−−−−−−−−−−−−−−−−−KN−−−−−SNKTDL−−VLITRQIATLVNASMPLDEVLDIVG−−−K−−−−QNSKSK−−−MI−−−E−−−−−−−−−−IIQRIRVNIQEGHSFADA−−−−−LSPFPAVF−−SPLYKTMVTAGEVSGHL−−−−−−−−−−−GLVLVRLADHIEQTQKIQRKIIQALIYPCVLV−−−LISLSVIII−−LLTAVVPNIVEQFSFSET−−ALPLST−−−KVLMILSYSIKENV−−−−−−−−IF−−−−−−−IMA−−IG−−−−VSAVIF−−−−−−−LNRL−−LK−−INKIN−−−V−−−−FFHRH−−Y−−−−−L−−SL−−−PMLGNMFVRINTSRYLRTLTTL−−−HSNGVTIVQAMSISNAVLT−−−−−−−−−NVYIKNKLN−−−−−−−−−−−−ISVKLVSEGCSLSSSL−−−VDS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−G−−−−−−VFPPIIL−−−−−−−−HMIISGERSGKLDHMLETVAGVQEEELMNQISIVMSLLEPTIIIVMAAFISFIILSILQPILEINSLV
fig|349747.9.peg.1249   Yersinia pseudotuberculosis IP 31758            FKYVAISR−−−−−−−−−−−−−−−−−−−SGTKITGDI−−−DAENIRIARYLLYKKNMHV−−LSI−−−−KKRILLFNKY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VVK−−−−−−−−−−−−−−−−−−−−−−KN−−−−−SNKTDL−−VLITRQIATLVNASMPLDEVLDIVG−−−K−−−−QNSKSK−−−MI−−−E−−−−−−−−−−IIQRIRVNIQEGHSFADA−−−−−LSPFPAVF−−SPLYKTMVTAGEVSGHL−−−−−−−−−−−GLVLVRLAEHIEQTQKIQRKIIQALIYPCVLV−−−LISLSVIVI−−LLTAVVPNIVEQFSFSET−−ALPLST−−−KVLMILSYSIKENV−−−−−−−−IF−−−−−−−IIA−−IG−−−−VSAVIF−−−−−−−LNRL−−LK−−INKIN−−−I−−−−FFHRH−−Y−−−−−L−−SL−−−PMLGNMFVRINTSRYLRTLTTL−−−HSNGVTIVQAMSISNAVLT−−−−−−−−−NVYIKNKLN−−−−−−−−−−−−ISVKLVSEGCSLSSSL−−−VDS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−G−−−−−−VFPPIIL−−−−−−−−HMIISGERSGKLDHMLETVAGVQEEELMNQISIVMSLLEPTIIIVMAAFISFVILSILQPILEINSLV
fig|373665.6.peg.1838   Yersinia pestis biovar Orientalis str. IP275                                                                                                                                                                   DL−−VLITRQIATLVNASMPLDEVLDIVG−−−K−−−−QNSKSK−−−MI−−−E−−−−−−−−−−IIQRIRVNIQEGHSFADA−−−−−LSPFPAVF−−SPLYKTMVTAGEVSGHL−−−−−−−−−−−GLVLVRLADHIEQTQKIQRKIIQALIYPCVLV−−−LISLSVIII−−LLTAVVPNIVEQFSFSET−−ALPLST−−−KVLMILSYSIKENV−−−−−−−−IF−−−−−−−IMA−−IG−−−−VSAVIF−−−−−−−LNRL−−LK−−INKIN−−−V−−−−FFHRH−−Y−−−−−L−−SL−−−PMLGNMFVRINTSRYLRTLTTL−−−HSNGVTIVQAMSISNAVLT−−−−−−−−−NVYIKNKLN−−−−−−−−−−−−ISVKLVSEGCSLSSSL−−−VDS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−G−−−−−−VFPPIIL−−−−−−−−HMIISGERSGKLDHMLETVAGVQEEELMNQISIVMSLLEPTIIIVMAAFISFVILSILQPILEINSLV
fig|214092.1.peg.4291   Yersinia pestis CO92                                                                                                                                                                    M−−VLITRQIATLVNASMPLDEVLDIVG−−−K−−−−QNSKSK−−−MI−−−E−−−−−−−−−−IIQRIRVNIQEGHSFADA−−−−−LSPFPAVF−−SPLYKTMVTAGEVSGHL−−−−−−−−−−−GLVLVRLADHIEQTQKIQRKIIQALIYPCVLV−−−LISLSVIII−−LLTAVVPNIVEQFSFSET−−ALPLST−−−KVLMILSYSIKENV−−−−−−−−IF−−−−−−−IMA−−IG−−−−VSAVIF−−−−−−−LNRL−−LK−−INKIN−−−V−−−−FFHRH−−Y−−−−−L−−SL−−−PMLGNMFVRINTSRYLRTLTTL−−−HSNGVTIVQAMSISNAVLT−−−−−−−−−NVYIKNKLN−−−−−−−−−−−−ISVKLVSEGCSLSSSL−−−VDS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−G−−−−−−VFPPIIL−−−−−−−−HMIISGERSGKLDHMLETVAGVQEEELMNQISIVMSLLEPTIIIVMAAFISFVILSILQPILEINSLV
fig|527002.3.peg.2151   Yersinia aldovae ATCC 35236            FKYIAIDN−−−−−−−−−−−−−−−−−−−KGMEVNGNV−−−EAENIRIARCLLYKKKLCI−−IKI−−−−KLYSDN−−−S−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ILKFN−−−−−−−−−−−−−−−−−−−−KS−−−−−VNKEGL−−VLITRQMATLVSASMPLDEVMDVIV−−−K−−−−QNPNSK−−−LT−−−K−−−−−−−−−−VVCEVRKKIIEGYAFSDA−−−−−LSQFPAIF−−SPIYKSLITAGELSGHL−−−−−−−−−−−GIALSQLADYIEQKQQLQRKVTQALIYPVILI−−−LMSIIVSIT−−LLAFVVPNIIEQFVSSEE−−ELPLST−−−RVLILISYTVKENL−−−−−−−−LA−−−−−−−ASI−−TF−−−−FSFGVG−−−−−−−INRA−−FR−−VSEVS−−−Y−−−−LWHRY−−Y−−−−−L−−KL−−−PILGRLSLALNMSRYLRTLSIL−−−ISNGVPLVKSMNVSSALIS−−−−−−−−−NYYLKEKLL−−−−−−−−−−−−ISTRLVCEGCSLSFSL−−−ERC−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−R−−−−−−VLSPMIV−−−−−−−−HMITSGERSGKLNSMLERVSLIQEDELTVRINFFIALLEPVIILFMA                     
fig|349965.6.peg.1734   Yersinia intermedia ATCC 29909            FKYIAINN−−−−−−−−−−−−−−−−−−−NGVRIKGNI−−−EADNILIARGIIYQREWCL−−LKI−−−−KIRKVGHFPN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VIRYF−−−−−−−−−−−−−−−−−−−−KS−−−−−INNDDL−−VLITRQMSTLVNAAIPLDEVLEVIE−−−K−−−−QNKKNI−−−MN−−−G−−−−−−−−−−IIRDIRKKVVEGYSLSDS−−−−−LSHHSNVF−−NPLYRSMITAGEISGHL−−−−−−−−−−−GMILSRLADHIEQTQKVKRKLGQTLIYPAILI−−−IVSLGVVII−−LLSVVVPSIIEQFSFENN−−ELPFST−−−QTLMAVSNGVKNNI−−−−−−−−SS−−−−−−−ILA−−LT−−−−IIVVIS−−−−−−−INRA−−LK−−VRRLS−−−E−−−−LFEYY−−C−−−−−L−−KI−−−PLVGGYIIRLNISRYLRTLTIL−−−NSNSVNLMQAIKISNSVLT−−−−−−−−−NGYIKKQLL−−−−−−−−−−−−NSAKLVSEGASLSSSL−−−AVS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−R−−−−−−VFSPMII−−−−−−−−HMIASGERTGELDLMLEKVTDVQENELMDKINIFVTLLEPAIMIFMAAFILFIVLSIFQPILQINNLI
fig|349968.3.peg.945   Yersinia bercovieri ATCC 43970            FKYIAISH−−−−−−−−−−−−−−−−−−−NGMKIRGNV−−−EAENIREARHILYQRKISI−−LSI−−−−KVRRATDNSM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VMSFF−−−−−−−−−−−−−−−−−−−−KT−−−−−VNSADL−−VLLTRQMSILVSSDIPLDETLKIIE−−−K−−−−QSKKRY−−−VS−−−T−−−−−−−−−−VIHDVRKKVVEGYSLSDS−−−−−LSYFPRVF−−NVLYRSMIAAGELSGHL−−−−−−−−−−−GLVLSQLAEHIEQTQRLQRKIVQALIYPAILI−−−FISAGVIII−−LLSVVIPNIIESFSFDNQ−−ELPLST−−−RAIMNISYYLKNNM−−−−−−−−LL−−−−−−−IVI−−IA−−−−VALWIG−−−−−−−LRRA−−LK−−IKAVS−−−Y−−−−LFECY−−Y−−−−−L−−KI−−−PVLGKAISRVNISRYLKTLTVL−−−TSNGISLIPAMKISNQVIT−−−−−−−−−NYFIKEKLV−−−−−−−−−−−−NSTKLVGEGNSLSSSL−−−SLS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−R−−−−−−VFSPMIL−−−−−−−−HIISSGECSGKLDVMLKKVTSIQEEELVTQINIFITLLEPIVMIIMAVFIFIIVLAVFEPILQISSL 
fig|349966.3.peg.1824   Yersinia frederiksenii ATCC 33641            FNYAAINN−−−−−−−−−−−−−−−−−−−QGVKIKGSV−−−DAENMLAARHTLYQQNLCI−−LNV−−−−RVKRVSLTTR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VTKYF−−−−−−−−−−−−−−−−−−−−NR−−−−−VSRVDL−−VLMTRQMSILVNAAIPLVEVLEIVE−−−K−−−−QSVKGN−−−VK−−−N−−−−−−−−−−MIHEIRNKVIEGHSFSDS−−−−−LLLYSNVF−−NTLYRAMITAGEVSGHL−−−−−−−−−−−DIVLSKLAEHIEQTYRVQKKIIQSLIYPGFLI−−−LISIGVIVV−−LLSVVIPSLIEQFSFYEQ−−ALPLST−−−RVLMVSSYWVKDNA−−−−−−−−LF−−−−−−−YIF−−IS−−−−FLFFVL−−−−−−−FNLS−−LR−−INKVN−−−F−−−−FIDGC−−C−−−−−L−−KI−−−PVIGKVISQLNISRYLRMMAIL−−−SSNGISLIKAMKISNTALT−−−−−−−−−NQYIKKQLL−−−−−−−−−−−−NSIKLVSEGDSLSSSL−−−ASC−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−R−−−−−−GFSPMIL−−−−−−−−HLISSGERSGKLDTILERITFIQEQDLIGQIDIFITLLEPIIMILMAGFIFFIVLAIFQPILEMNNLI
fig|349966.5.peg.711   Yersinia frederiksenii ATCC 33641            FNYAAINN−−−−−−−−−−−−−−−−−−−QGVKIKGSV−−−DAENMLAARHTLYQQNLCI−−LNV−−−−RVKRVSLTTR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VTKYF−−−−−−−−−−−−−−−−−−−−NR−−−−−VSRVDL−−VLMTRQMSILVNAAIPLVEVLEIVE−−−K−−−−QSVKGN−−−VK−−−N−−−−−−−−−−MIHEIRNKVIEGHSFSDS−−−−−LLLYSNVF−−NTLYRAMITAGEVSGHL−−−−−−−−−−−DIVLSKLAEHIEQTYRVQKKIIQSLIYPGFLI−−−LISIGVIVV−−LLSVVIPSLIEQFSFYEQ−−ALPLST−−−RVLMVSSYWVKDNA−−−−−−−−LF−−−−−−−YIF−−IS−−−−FLFFVL−−−−−−−FNLS−−LR−−INKVN−−−F−−−−FIDGC−−C−−−−−L−−KI−−−PVIGKVISQLNISRYLRMMAIL−−−SSNGISLIKAMKISNTALT−−−−−−−−−NQYIKKQLL−−−−−−−−−−−−NSIKLVSEGDSLSSSL−−−ASC−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−R−−−−−−GFSPMIL−−−−−−−−HLISSGERSGKLDTILERITFIQEQDLIGQIDIFITLLEPIIMILMAGFIFLL               
fig|527004.3.peg.3293   Yersinia rohdei ATCC 43380            YKYTFLNP−−−−−−−−−−−−−−−−−−−KGQKIKGTV−−−EADNILAARHILYQKDLFL−−LDV−−−−TVKRINKISI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ISKFS−−−−−−−−−−−−−−−−−−−−TG−−−−−IKKLEL−−VLITRQMSILVNAAIPLDEVLEIVE−−−K−−−−QHIKSN−−−IH−−−N−−−−−−−−−−IIHEIRSKVIEGYSLSDS−−−−−LSLFPAVF−−NELYRSMIAAGEVSGHL−−−−−−−−−−−DLVLSKLAEHIEKTYMIRNKIIQTLIYPCFLV−−−FVSISVIII−−LLSFVIPNIIEQFSFHEK−−ALPLST−−−RTLMTVSYWLKDNL−−−−−−−−LL−−−−−−−ILI−−TL−−−−IMLFIV−−−−−−−ANLM−−SK−−IKMIK−−−I−−−−FIERN−−Y−−−−−L−−KI−−−PVLGQVITKINISRYLRMMAIL−−−NSNGVEIIQSMKVSSTVLT−−−−−−−−−NGYIKKQLT−−−−−−−−−−−−DSIRLVSEGGSFSSSL−−−SDS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−R−−−−−−VFSPMIL−−−−−−−−HMISSGERSGQLDVFLEKITDIQEQELIGYMDIFITLLEPVIMIFMAGFVFFIVLSIFQPILEMNNLI
fig|527012.3.peg.3892   Yersinia kristensenii ATCC 33638            FNYSAINN−−−−−−−−−−−−−−−−−−−KGIKIKGSI−−−VAENILSARHVIYQRKLVL−−LSI−−−−KLKHENLFLR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WANSI−−−−−−−−−−−−−−−−−−−−KK−−−−−INNMDL−−VLITRQMSILVNASIPLDETLEIIE−−−K−−−−QGAKNN−−−VN−−−S−−−−−−−−−−VIHEIRKKILEGHSFSDS−−−−−LSQFPVVF−−NSLYRSMIAAGELSGHL−−−−−−−−−−−GLVLSKLADHIEQAYKVRNKIIQALVYPVILI−−−LISIGVIII−−LLSVIIPNIIEQFISYDK−−VLPLST−−−RVLMVTSHWVEDNI−−−−−−−−LF−−−−−−−IAM−−IL−−−−IVVFVG−−−−−−−GYGL−−LK−−IIKIK−−−I−−−−IFEYY−−Y−−−−−L−−RI−−−PILGRAIFILNISRYLRMMTIL−−−NSNGVSLIKTMEISSSVVT−−−−−−−−−NLYIKQGLE−−−−−−−−−−−−HAAKLVREGGSLSSSL−−−AHS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−N−−−−−−GFSPMIL−−−−−−−−HMIVSGERSGTLDIILEKITDIQEQELIDKINIFVILIEPIIMIFMATFIFFIVLAIFQPILEMNSLI
fig|393305.7.peg.3557   Yersinia enterocolitica subsp. enterocolitica 8081            YEYTAKNN−−−−−−−−−−−−−−−−−−−KGIKIKGSV−−−EADNILAARQVIYQRKLYL−−LNI−−−−KIKRISRFTQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WMTFL−−−−−−−−−−−−−−−−−−−−NT−−−−−INNRDL−−ILITRQMSILVNAAIPLDEALALIE−−−N−−−−QSTKSK−−−VD−−−S−−−−−−−−−−VIHKIRKRVLEGHSLSDS−−−−−LSQFPAIF−−NSLYRSMIAAGELSGHL−−−−−−−−−−−GLVLSNLADHIEQARKVKSKIIQTLIYPAILV−−−SVSIGIIAI−−LLTLIIPNIIEQFVSYDK−−VLPLST−−−RVLMVTSHWIEDNI−−−−−−−−VS−−−−−−−III−−IL−−−−VIFSFS−−−−−−−IYGI−−SK−−IRKIN−−−I−−−−FIESC−−Y−−−−−L−−KL−−−PIFGRLIFKLNVSRYMRMMEIL−−−SSNGVNLVRTMDISTGVVT−−−−−−−−−NLYIKQRLD−−−−−−−−−−−−DAVTLVSEGGSLTSSL−−−SNS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−G−−−−−−MFSPMTI−−−−−−−−HMIASGERSGKLDDVLKRITDIQEQEIIEEINVFVILLEPVIMISMALFIFFIVLAIFQPILEMNNLI
fig|630.2.peg.3275   Yersinia enterocolitica 8081            YEYTAKNN−−−−−−−−−−−−−−−−−−−KGIKIKGSV−−−EADNILAARQVIYQRKLYL−−LNI−−−−KIKRISRFTQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WMTFL−−−−−−−−−−−−−−−−−−−−NT−−−−−INNRDL−−ILITRQMSILVNAAIPLDEALALIE−−−N−−−−QSTKSK−−−VD−−−S−−−−−−−−−−VIHKIRKRVLEGHSLSDS−−−−−LSQFPAIF−−NSLYRSMIAAGELSGHL−−−−−−−−−−−GLVLSNLADHIEQARKVKSKIIQTLIYPAILV−−−SVSIGIIAI−−LLTLIIPNIIEQFVSYDK−−VLPLST−−−RVLMVTSHWIEDNI−−−−−−−−VS−−−−−−−III−−IL−−−−VIFSFS−−−−−−−IYGI−−SK−−IRKIN−−−I−−−−FIESC−−Y−−−−−L−−KL−−−PIFGRLIFKLNVSRYMRMMEIL−−−SSNGVNLVRTMDISTGVVT−−−−−−−−−NLYIKQRLD−−−−−−−−−−−−DAVTLVSEGGSLTSSL−−−SNS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−G−−−−−−MFSPMTI−−−−−−−−HMIASGERSGKLDDVLKRITDIQEQEIIEEINVFVILLEPVIMISMALFIFFIVLAIFQPILEMNNLI
fig|527005.3.peg.1257   Yersinia ruckeri ATCC 29473            FRYRALTK−−−−−−−−−−−−−−−−−−−EGKKYNGMI−−−KAENIVNARREIRVMNLIL−−LKI−−−−HMVKKN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KNN−−−−−−−−−−−−−−−−−−−−KR−−−−−ISKSEL−−ITFTRQLATLISSSIAIDEALDTIA−−−N−−−−QTDNKS−−−VL−−−N−−−−−−−−−−IIFKIKEKITSGHSLSES−−−−−IMLFPRAF−−NILYHSMITAGETSGHL−−−−−−−−−−−GVTLHRLADNIEETQRVKNKLVQSLIYPCALL−−−LVSIGVISI−−LLSVVVPKVLEQFIYMGQ−−ELPFST−−−KLLLSISDFIKNYG−−−−−−−−LL−−−−−−−LLF−−SI−−−−LLTFIF−−−−−−−SVFC−−FK−−NKEVK−−−I−−−−KMHKL−−I−−−−−L−−SL−−−PIIGGVISGVNSARYARTLSTL−−−NSSGVPLLQSMIISLSVLT−−−−−−−−−NNHLKYKVE−−−−−−−−−−−−CATELVSEGRSLSFAL−−−AQV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−D−−−−−−IFSPLTR−−−−−−−−HMISAGEKSGELNAMLEKTAEIQEEELIQLISVVINIIEPTVIVIMASFVFFIVLSILQPIFLLNNSI
fig|1224148.3.peg.3414   Dickeya chrysanthemi NCPPB 3533            FRYIAVNK−−−−−−−−−−−−−−−−−−−EGEVVTGRR−−−RAFSQESLREQLFARQLIM−−VSC−−−−RISLL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QQWLLFLSRYER−−−−−LSTLEL−−ALLTRQLASLLDAGIPLEEALTTLA−−−G−−−−QADKPA−−−VG−−−V−−−−−−−−−−VLNAVREQLIAGVSFAQA−−−−−LQTLPHSF−−NRLYCAMVAAGEATGGL−−−−−−−−−−−ALVLIRLADYLDQRQKTKNALIQALLYPALLA−−−VMSVIVVSV−−LLSSVVPQVVMQLQQMHT−−PLPLTT−−−RTLLAISDLLNQYG−−−−−−−−WV−−−−−−−LLV−−AL−−−−AALVIG−−−−−−−LHQI−−TR−−IPARK−−−L−−−−WLDRH−−L−−−−−L−−RL−−−HVIGPLLRDISSARYIRTMEIL−−−IASAIPLLESMSVAENVLN−−−−−−−−−NSFARFQLA−−−−−−−−−−−−VASQKVNEGKSLTESL−−−SNN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−D−−−−−−IFSGMVK−−−−−−−−HMIASGEQSGRLEQMLKYIADIQEESLKRRMSLVLLLSENGLLIIISSLILFIVMSILQPIMQLSNTI
fig|1224148.3.peg.7619   Dickeya chrysanthemi NCPPB 3533            FRYIAVNK−−−−−−−−−−−−−−−−−−−EGEVVTGRR−−−RAFSQESLREQLFARQLIM−−VSC−−−−RISLL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QQWLLFLSRYER−−−−−LSTLEL−−ALLTRQLASLLDAGIPLEEALTTLA−−−G−−−−QADKPA−−−VG−−−V−−−−−−−−−−VLNAVREQLIAGVSFAQA−−−−−LQTLPHSF−−NRLYCAMVAAGEATGGL−−−−−−−−−−−ALVLIRLADYLDQRQKTKNALIQALLYPALLA−−−VMSVIVVSV−−LLSSVVPQVVMQLQQMHT−−PLPLTT−−−RTLLAISDLLNQYG−−−−−−−−WV−−−−−−−LLV−−AL−−−−AALVIG−−−−−−−LHQI−−TR−−IPARK−−−L−−−−WLDRH−−L−−−−−L−−RL−−−HVIGPLLRDISSARYIRTMEIL−−−IASAIPLLESMSVAENVLN−−−−−−−−−NSFARFQLA−−−−−−−−−−−−VASQKVNEGKSLTESL−−−SNN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−D−−−−−−IFSGMVK−−−−−−−−HMIASGEQSGRLEQMLKYIADIQEESLKRRMSLVLLLSENGLLIIISSLILFIVMSILQPIMQLSNTI
fig|399741.7.peg.4298   Serratia proteamaculans 568            FNYHAYDA−−−−−−−−−−−−−−−−−−−AGKGVRGVL−−−ETDSLRSARQRLREQNLTP−−SHI−−−−APQGN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SVAA−−−−−−−−−−−−TLLAARRRHR−−−−−LSSGEL−−ALVTRQLATLIAAALPLEEALLTVA−−−C−−−−QSEKKT−−−VI−−−Q−−−−−−−−−−LITRIRSHVLEGLSLSQA−−−−−LMQFPSVF−−DRLFCAMVAAGESSGQL−−−−−−−−−−−PLIFTELADYVEQRQKIKNKMTQAMTYPVILT−−−LVAIAVIGV−−LLVAVVPKVIEQFVHMKQ−−TLPLTT−−−QILLLCSEGVGRWG−−−−−−−−PS−−−−−−−GLA−−VV−−−−VLTLLG−−−−−−−FRWQ−−LK−−KQRFR−−−L−−−−AWHRY−−L−−−−−L−−RM−−−PYLGSLFLNLDTARYAHTLSIL−−−TLSAVPLLDSMNISAAVLN−−−−−−−−−NEEARRRLL−−−−−−−−−−−−EAMTQVQEGGSLHQAL−−−ADS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−D−−−−−−LFSPMMR−−−−−−−−HMIAAGERSSELGSMLKRAAAMQQDALNQRIALVLSLFEPALVISMAGIVLFIILAILQPILQLNNMM
fig|399741.3.peg.4224   Serratia proteamaculans 568            FNYHAYDA−−−−−−−−−−−−−−−−−−−AGKGVRGVL−−−ETDSLRSARQRLREQNLTP−−SHI−−−−APQGN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SVAA−−−−−−−−−−−−TLLAARRRHR−−−−−LSSGEL−−ALVTRQLATLIAAALPLEEALLTVA−−−C−−−−QSEKKT−−−VI−−−Q−−−−−−−−−−LITRIRSHVLEGLSLSQA−−−−−LMQFPSVF−−DRLFCAMVAAGESSGQL−−−−−−−−−−−PLIFTELADYVEQRQKIKNKMTQAMTYPVILT−−−LVAIAVIGV−−LLVAVVPKVIEQFVHMKQ−−TLPLTT−−−QILLLCSEGVGRWG−−−−−−−−PS−−−−−−−GLA−−VV−−−−VLTLLG−−−−−−−FRWQ−−LK−−KQRFR−−−L−−−−AWHRY−−L−−−−−L−−RM−−−PYLGSLFLNLDTARYAHTLSIL−−−TLSAVPLLDSMNISAAVLN−−−−−−−−−NEEARRRLL−−−−−−−−−−−−EAMTQVQEGGSLHQAL−−−ADS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−D−−−−−−LFSPMMR−−−−−−−−HMIAAGERSSELGSMLKRAAAMQQDALNQRIALVLSLFEPALVISMAGIVLFIILAILQPILQLNNMM
fig|716541.4.peg.2974   Enterobacter cloacae subsp. cloacae ATCC 13047            YAWTATDA−−−−−−−−−−−−−−−−−−−AGKTQRGTL−−−QAEGPKQVRQSLREQKLMP−−LTI−−−−TETRE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NAAS−−−−−−−−−−−−−−AKAKTGAR−−−−−LSVPVL−−SMFTRQLSTLVNASLPLESALKAIS−−−K−−−−QTEDKK−−−LA−−−A−−−−−−−−−−MVTEIREKVVEGHTLFDA−−−−−FSQFPRTF−−DKLYCTLVMAGEKTGHL−−−−−−−−−−−GDVLEKLAEYNEQRQKMKSKLTQAMVYPITLT−−−VVAVAVISI−−LLVAVVPQVIEQFVHMKQ−−QLPITT−−−RTLIAVSDFLQAYG−−−−−−−−IY−−−−−−−IAG−−GL−−−−FGAIVG−−−−−−−FKTW−−VK−−KTTNR−−−F−−−−RWHSW−−L−−−−−V−−NG−−−SPIKKLVCAINSARYIRTLSIL−−−QASSVPLLEGMYIAMDGIE−−−−−−−−−NLYARKVLE−−−−−−−−−−−−QAADTVRQGASLYNAL−−−DQA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−K−−−−−−LFPPTML−−−−−−−−YMIASGEESGELGSLMDRAAENQESALQHRITLTLSVFEPALVVTMATVVLFIVLSILQPLLQLNNMV
fig|500639.8.peg.708   Enterobacter cancerogenus ATCC 35316            YAWTATDA−−−−−−−−−−−−−−−−−−−AGKSQRGTL−−−QAEGQKQVRQWLREQKLMP−−VSI−−−−SETRE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AAVA−−−−−−−−−−−−−−GKAKTGTK−−−−−LSTPVL−−SMFTRQLSTLVNAALPLESALKAIS−−−K−−−−QTEDKK−−−LA−−−A−−−−−−−−−−MVVEIREKVVEGHTLFDA−−−−−FSQFPRTF−−DKLYCTLVMAGEKTGHL−−−−−−−−−−−GDVLEKLAEYNEQRQKMKSKLTQAMVYPITLT−−−VVAIAVISI−−LLVAVVPQVIEQFTHMKQ−−QLPITT−−−RTLIAVSDFLQAYG−−−−−−−−IY−−−−−−−IAG−−GI−−−−GGGIVG−−−−−−−FKAW−−VR−−NVKNR−−−F−−−−RWHSW−−L−−−−−V−−NG−−−SPIKKLVCAINSARYIRTLSIL−−−QASSVPLLEGMYIAMDGIE−−−−−−−−−NLYARQVLE−−−−−−−−−−−−QAADTVRQGASLYAAL−−−EQA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−K−−−−−−LFPPTML−−−−−−−−YMIASGEESGELGNLMDRAAENQESALQHRITLTLSVFEPALVVSMATIVLFIVLSILQPLLQLNNMV
fig|290338.6.peg.1860   Citrobacter koseri ATCC BAA-895            FAWTATDA−−−−−−−−−−−−−−−−−−−AGKTRRGAL−−−QAEGPKQVRQTLREQKLMP−−ISI−−−−TLTRE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RAAG−−−−−−−−−−−−−−KGAQKGAK−−−−−LSTPVL−−SMFTRQLSTLVNAALPLESALKAIS−−−K−−−−QTEDKK−−−LA−−−V−−−−−−−−−−MVGEIRDKVVEGHTLFDA−−−−−FSQFPRTF−−DKLYCTLVMAGEKTGHL−−−−−−−−−−−GGVLEKLAEYNEQRQKMKSKLSQAMVYPITLT−−−VVAIAVISI−−LLVAVVPQVIEQFVHMKQ−−QLPVTT−−−RTLIAVSDFLQAYG−−−−−−−−MV−−−−−−−IGG−−GL−−−−VGSFIA−−−−−−−FNAW−−LK−−KERYR−−−F−−−−AYHRW−−L−−−−−V−−NR−−−SPLKKLVCAINSARYIRTLSIL−−−QASSVPLLEGMYIAMDGIE−−−−−−−−−NLYARQVLE−−−−−−−−−−−−QAADTVRQGASLYNAL−−−EQA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−R−−−−−−LFPPTML−−−−−−−−YMIASGEESGELGSLMDRAAENQESALQHRITLTLSVFEPALVVTMATVVLFIVLSILQPLLQLNNMV
fig|290338.8.peg.1856   Citrobacter koseri ATCC BAA-895            FAWTATDA−−−−−−−−−−−−−−−−−−−AGKTRRGAL−−−QAEGPKQVRQTLREQKLMP−−ISI−−−−TLTRE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RAAG−−−−−−−−−−−−−−KGAQKGAK−−−−−LSTPVL−−SMFTRQLSTLVNAALPLESALKAIS−−−K−−−−QTEDKK−−−LA−−−V−−−−−−−−−−MVGEIRDKVVEGHTLFDA−−−−−FSQFPRTF−−DKLYCTLVMAGEKTGHL−−−−−−−−−−−GGVLEKLAEYNEQRQKMKSKLSQAMVYPITLT−−−VVAIAVISI−−LLVAVVPQVIEQFVHMKQ−−QLPVTT−−−RTLIAVSDFLQAYG−−−−−−−−MV−−−−−−−IGG−−GL−−−−VGSFIA−−−−−−−FNAW−−LK−−KERYR−−−F−−−−AYHRW−−L−−−−−V−−NR−−−SPLKKLVCAINSARYIRTLSIL−−−QASSVPLLEGMYIAMDGIE−−−−−−−−−NLYARQVLE−−−−−−−−−−−−QAADTVRQGASLYNAL−−−EQA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−R−−−−−−LFPPTML−−−−−−−−YMIASGEESGELGSLMDRAAENQESALQHRITLTLSVFEPALVVTMATVVLFIVLSILQPLLQLNNMV
fig|637910.3.peg.4275   Citrobacter rodentium ICC168            FSWHATDM−−−−−−−−−−−−−−−−−−−QGETVRGVT−−−EANSERDVVAFLRAQGLLP−−LSI−−−−KA−−Q−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RHAL−−−−−−−−−−−−−−SLSLPGQR−−−−−ISHGDL−−TLFTRQLATLIAAALPLDEALAIIQ−−−Q−−−−QKENKK−−−LS−−−S−−−−−−−−−−VINGLRLAVLEGQSLSRA−−−−−MQNHPRLF−−DDVFCTLVKAGETVGQL−−−−−−−−−−−GGVLERLADFNETRQRMRSKLTQALIYPVLLT−−−TVAILVVAI−−LLTTVVPKVAAQFLHLKH−−ELPLTT−−−RILLAISDFLSAWG−−−−−−−−PG−−−−−−−LLL−−FF−−−−AALAAL−−−−−−−FSFW−−LR−−RNGNR−−−L−−−−RFHRF−−L−−−−−I−−AF−−−RLTAPLVCAVNSARYLRALSIL−−−NNSGVPLLQGMELSAEGVG−−−−−−−−−NLAIRHRLS−−−−−−−−−−−−EAAESVRQGNSIHRSL−−−AQT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−E−−−−−−IFPTMML−−−−−−−−YMIASGEKSGELGALMQRATENQETHLQNRIALALAIFEPALIVIMAMIVLFIVVSVMQPILQLNTLM
fig|550677.3.peg.3875   Escherichia coli B354            YRYRAMTQ−−−−−−−−−−−−−−−−−−−DGQKLQGII−−−DANDERQARLRLREEGLFL−−LDI−−−−RP−−Q−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KSS−−−−−−−−−−−−−−−GVKTRRPR−−−−−ISHSEL−−TLFTRQLATLSAAALPLEESLAVIG−−−Q−−−−QSSNKR−−−LA−−−D−−−−−−−−−−VLNQVRSAILEGHPLSDA−−−−−LQHFPTLF−−DSLYRTLVKAGEKSGLL−−−−−−−−−−−APVLEKLADYNENRQKIRSKLIQSLIYPCMLT−−−AVAIVVVII−−LLTAVVPKITKQFVHMKQ−−QLPLST−−−RILLGLSDTLQHTG−−−−−−−−PT−−−−−−−LLA−−TV−−−−FIVAVG−−−−−−−FWLW−−LK−−RGNNR−−−H−−−−RFHAM−−L−−−−−L−−RV−−−ALIGPLICAINSARYLRTLSIL−−−QSSGVPLLDGMNLSTESLN−−−−−−−−−NLEIRQRLA−−−−−−−−−−−−NAAENVRQGNSIHLSL−−−EQT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−A−−−−−−IFPPMML−−−−−−−−YMVASGEKSGQLGTLMVRAADNQETLQQNRIALTLSIFEPALIITMALIVLFIVVSVLQPLLQLNSMI
fig|431946.3.peg.3287   Escherichia coli SE15            YRYRAMTQ−−−−−−−−−−−−−−−−−−−DGQKLQGII−−−DANDERQARLRLREEGLFL−−LDI−−−−RP−−Q−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KSS−−−−−−−−−−−−−−−GVKTRRPR−−−−−ISHSEL−−TLFTRQLATLSAAALPLEESLAVIG−−−Q−−−−QSSNKR−−−LA−−−D−−−−−−−−−−VLNQVRSAILEGHPLSDA−−−−−LQHFPTLF−−DSLYRTLVKAGEKSGLL−−−−−−−−−−−APVLEKLADYNENRQKIRSKLIQSLIYPCMLT−−−TVAIVVVII−−LLTAVVPKITEQFVHMKQ−−QLPLST−−−RILLGLSDTLQRTG−−−−−−−−PT−−−−−−−LLA−−TV−−−−FIVAVG−−−−−−−FWLW−−LK−−RGNNR−−−H−−−−RFHAM−−L−−−−−L−−RV−−−ALIGPLICAINSARYLRTLSIL−−−QSSGVPLLDGMNLSTESLN−−−−−−−−−NLEIRQRLA−−−−−−−−−−−−NAAENVRQGNSIHLSL−−−EQT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−A−−−−−−IFPPMML−−−−−−−−YMVASGEKSGQLGTLMVRAADNQETLQQNRIALTLSIFEPALIITMALIVLFIVVSVLQPLLQLNSMI
fig|1169326.3.peg.3717   Escherichia coli KTE5            YRYRAMTQ−−−−−−−−−−−−−−−−−−−DGQKLQGII−−−DANDERQARLRLREEGLFL−−LDI−−−−RP−−Q−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KSS−−−−−−−−−−−−−−−GVKTRRPR−−−−−ISHSEL−−TLFTRQLATLSAAALPLEESLAVIG−−−Q−−−−QSSNNR−−−LA−−−D−−−−−−−−−−VLNQVRSAILEGHPLSDA−−−−−LQHFPTLF−−DSLYRTLVKAGEKSGLL−−−−−−−−−−−APVLEKLADYNENRQKIRSKLIQSLIYPCMLT−−−TVAIVVVII−−LLTAVVPKITEQFVHMKQ−−QLPLST−−−RILLGLSDTLQRTG−−−−−−−−PT−−−−−−−LLA−−TV−−−−FIVAVG−−−−−−−FWLW−−LK−−RGNNR−−−H−−−−RFHAM−−L−−−−−L−−RV−−−ALIGPLICAINSARYLRTLSIL−−−QSSGVPLLDGMNLSTESLN−−−−−−−−−NLEIRQRLA−−−−−−−−−−−−NAAENVRQGNSIHLSL−−−EQT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−A−−−−−−IFPPMML−−−−−−−−YMVASGEKSGQLGTLMVRAADNQETLQQNRIALTLSIFEPALIITMALIVLFIVVSVLQPLLQLNSMI
fig|1169328.3.peg.3716   Escherichia coli KTE8            YRYRAMTQ−−−−−−−−−−−−−−−−−−−DGQKLQGII−−−DANDERQARLRLREEGLFL−−LDI−−−−RP−−Q−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KSS−−−−−−−−−−−−−−−GVKTRRPR−−−−−ISHSEL−−TLFTRQLATLSAAALPLEESLAVIG−−−Q−−−−QSSNNR−−−LA−−−D−−−−−−−−−−VLNQVRSAILEGHPLSDA−−−−−LQHFPTLF−−DSLYRTLVKAGEKSGLL−−−−−−−−−−−APVLEKLADYNENRQKIRSKLIQSLIYPCMLT−−−TVAIVVVII−−LLTAVVPKITEQFVHMKQ−−QLPLST−−−RILLGLSDTLQRTG−−−−−−−−PT−−−−−−−LLA−−TV−−−−FIVAVG−−−−−−−FWLW−−LK−−RGNNR−−−H−−−−RFHAM−−L−−−−−L−−RV−−−ALIGPLICAINSARYLRTLSIL−−−QSSGVPLLDGMNLSTESLN−−−−−−−−−NLEIRQRLA−−−−−−−−−−−−NAAENVRQGNSIHLSL−−−EQT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−A−−−−−−IFPPMML−−−−−−−−YMVASGEKSGQLGTLMVRAADNQETLQQNRIALTLSIFEPALIITMALIVLFIVVSVLQPLLQLNSMI
fig|1182712.3.peg.921   Escherichia coli KTE123            YRYRAMTQ−−−−−−−−−−−−−−−−−−−DGQKLQGII−−−DANDERQARLRLREEGLFL−−LDI−−−−RP−−Q−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KSS−−−−−−−−−−−−−−−GVKTRRPR−−−−−ISHSEL−−TLFTRQLATLSAAALPLEESLAVIG−−−Q−−−−QSSNNR−−−LA−−−D−−−−−−−−−−VLNQVRSAILEGHPLSDA−−−−−LQHFPTLF−−DSLYRTLVKAGEKSGLL−−−−−−−−−−−APVLEKLADYNENRQKIRSKLIQSLIYPCMLT−−−TVAIVVVII−−LLTAVVPKITEQFVHMKQ−−QLPLST−−−RILLGLSDTLQRTG−−−−−−−−PT−−−−−−−LLA−−TV−−−−FIVAVG−−−−−−−FWLW−−LK−−RGNNR−−−H−−−−RFHAM−−L−−−−−L−−RV−−−ALIGPLICAINSARYLRTLSIL−−−QSSGVPLLDGMNLSTESLN−−−−−−−−−NLEIRQRLA−−−−−−−−−−−−NAAENVRQGNSIHLSL−−−EQT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−A−−−−−−IFPPMML−−−−−−−−YMVASGEKSGQLGTLMVRAADNQETLQQNRIALTLSIFEPALIITMALIVLFIVVSVLQPLLQLNSMI
fig|1182721.3.peg.3934   Escherichia coli KTE141            YRYRAMTQ−−−−−−−−−−−−−−−−−−−DGQKLQGII−−−DANDERQARLRLREEGLFL−−LDI−−−−RP−−Q−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KSS−−−−−−−−−−−−−−−GVKTRRPR−−−−−ISHSEL−−TLFTRQLATLSAAALPLEESLAVIG−−−Q−−−−QSSNNR−−−LA−−−D−−−−−−−−−−VLNQVRSAILEGHPLSDA−−−−−LQHFPTLF−−DSLYRTLVKAGEKSGLL−−−−−−−−−−−APVLEKLADYNENRQKIRSKLIQSLIYPCMLT−−−TVAIVVVII−−LLTAVVPKITEQFVHMKQ−−QLPLST−−−RILLGLSDTLQRTG−−−−−−−−PT−−−−−−−LLA−−TV−−−−FIVAVG−−−−−−−FWLW−−LK−−RGNNR−−−H−−−−RFHAM−−L−−−−−L−−RV−−−ALIGPLICAINSARYLRTLSIL−−−QSSGVPLLDGMNLSTESLN−−−−−−−−−NLEIRQRLA−−−−−−−−−−−−NAAENVRQGNSIHLSL−−−EQT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−A−−−−−−IFPPMML−−−−−−−−YMVASGEKSGQLGTLMVRAADNQETLQQNRIALTLSIFEPALIITMALIVLFIVVSVLQPLLQLNSMI
fig|362663.8.peg.3442   Escherichia coli 536            YRYRAMTQ−−−−−−−−−−−−−−−−−−−DGQKLQGII−−−DANDERQARLRLREEGLFL−−LDI−−−−RP−−Q−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KSS−−−−−−−−−−−−−−−GVKTRRPR−−−−−ISHSEL−−TLFTRQLATLSAAALPLEESLAVIG−−−Q−−−−QSSNNR−−−LA−−−D−−−−−−−−−−VLNQVRSAILEGHPLSDA−−−−−LQHFPTLF−−DSLYRTLVKAGEKSGLL−−−−−−−−−−−APVLEKLADYNENRQKIRSKLIQSLIYPCMLT−−−TVAIVVVII−−LLTAVVPKITEQFVHMKQ−−QLPLST−−−RILLGLSDTLQRTG−−−−−−−−PT−−−−−−−LLA−−TV−−−−FIVAVG−−−−−−−FWLW−−LK−−RGNNR−−−H−−−−RFHAM−−L−−−−−L−−RV−−−ALIGPLICAINSARYLRTLSIL−−−QSSGVPLLDGMNLSTESLN−−−−−−−−−NLEIRQRLA−−−−−−−−−−−−NAAENVRQGNSIHLSL−−−EQT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−A−−−−−−IFPPMML−−−−−−−−YMVASGEKSGQLGTLMVRAADNQETLQQNRIALTLSIFEPALIITMALIVLFIVVSVLQPLLQLNSMI
fig|585397.7.peg.3984   Escherichia coli ED1a            YRYRAMTQ−−−−−−−−−−−−−−−−−−−DGQKLQGII−−−DANDERQARLRLREEGLFL−−LDI−−−−RP−−Q−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KSS−−−−−−−−−−−−−−−GVKTRRPR−−−−−ISHSEL−−TLFTRQLATLSAAALPLEESLAVIG−−−Q−−−−QSSNNR−−−LA−−−D−−−−−−−−−−VLNQVRSAILEGHPLSDA−−−−−LQHFPTLF−−DSLYRTLVKAGEKSGLL−−−−−−−−−−−APVLEKLADYNENRQKIRSKLIQSLIYPCMLT−−−TVAIVVVII−−LLTAVVPKITEQFVHMKQ−−QLPLST−−−RILLGLSDTLQRTG−−−−−−−−PT−−−−−−−LLA−−TV−−−−FIVAVG−−−−−−−FWLW−−LK−−RGNNR−−−H−−−−RFHAM−−L−−−−−L−−RV−−−ALIGPLICAINSARYLRTLSIL−−−QSSGVPLLDGMNLSTESLN−−−−−−−−−NLEIRQRLA−−−−−−−−−−−−NAAENVRQGNSIHLSL−−−EQT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−A−−−−−−IFPPMML−−−−−−−−YMVASGEKSGQLGTLMVRAADNQETLQQNRIALTLSIFEPALIITMALIVLFIVVSVLQPLLQLNSMI
fig|885276.3.peg.3623   Escherichia coli str. 'clone D i2'            YRYRAMTQ−−−−−−−−−−−−−−−−−−−DGQKLQGII−−−DANDERQARLRLREEGLFL−−LDI−−−−RP−−Q−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KSS−−−−−−−−−−−−−−−GVKTRRPR−−−−−ISHSEL−−TLFTRQLATLSAAALPLEESLAVIG−−−Q−−−−QSSNNR−−−LA−−−D−−−−−−−−−−VLNQVRSAILEGHPLSDA−−−−−LQHFPTLF−−DSLYRTLVKAGEKSGLL−−−−−−−−−−−APVLEKLADYNENRQKIRSKLIQSLIYPCMLT−−−TVAIVVVII−−LLTAVVPKITEQFVHMKQ−−QLPLST−−−RILLGLSDTLQRTG−−−−−−−−PT−−−−−−−LLA−−TV−−−−FIVAVG−−−−−−−FWLW−−LK−−RGNNR−−−H−−−−RFHAM−−L−−−−−L−−RV−−−ALIGPLICAINSARYLRTLSIL−−−QSSGVPLLDGMNLSTESLN−−−−−−−−−NLEIRQRLA−−−−−−−−−−−−NAAENVRQGNSIHLSL−−−EQT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−A−−−−−−IFPPMML−−−−−−−−YMVASGEKSGQLGTLMVRAADNQETLQQNRIALTLSIFEPALIITMALIVLFIVVSVLQPLLQLNSMI
fig|1116136.3.peg.4111   Escherichia coli MP021561.2            YRYRAMTQ−−−−−−−−−−−−−−−−−−−DGQKLQGII−−−DANDERQARLRLREEGLFL−−LDI−−−−RP−−Q−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KSS−−−−−−−−−−−−−−−GVKTRRPR−−−−−ISHSEL−−TLFTRQLATLSAAALPLEESLAVIG−−−Q−−−−QSSNKR−−−LG−−−D−−−−−−−−−−VLNQVRSAILEGHPLSDA−−−−−LQHFPTLF−−DSLYRTLVKAGEKSGLL−−−−−−−−−−−APVLEKLADYNENRQKIRSKLIQSLIYPCMLT−−−TVAIGVVII−−LLTAVVPKITEQFVHMKQ−−QLPLST−−−RILLGLSDTLQRTG−−−−−−−−PT−−−−−−−LLA−−TV−−−−FIVAVG−−−−−−−FWLW−−LK−−RGNNR−−−H−−−−RFHAM−−L−−−−−L−−RV−−−ALIGPLICAINSARYLRTLSIL−−−QSSGVPLLDGMNLSTESLN−−−−−−−−−NLEIRQRLA−−−−−−−−−−−−NAAENVRQGNSIHLSL−−−EQT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−A−−−−−−IFPPMML−−−−−−−−YMVASGEKSGQLGTLMVRAADNQETLQQNRIALTLSIFEPALIITMALIVLFIVVSVLQPLLQLNSMI
fig|344610.7.peg.2914   Escherichia coli 53638            YRYRAMTQ−−−−−−−−−−−−−−−−−−−DGQKLQGII−−−DANDERQARLRLREEGLFL−−LDI−−−−RP−−Q−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KSS−−−−−−−−−−−−−−−GVKTRRPR−−−−−ISHSEL−−TLFTRQLATLSAAALPLEESLAVIG−−−Q−−−−QSSNKR−−−LG−−−D−−−−−−−−−−VLNQVRSAILEGHPLSDA−−−−−LQHFPTLF−−DSLYRTLVKAGEKSGLL−−−−−−−−−−−APVLEKLADYNENRQKIRSKLIQSLIYPCMLT−−−TVAIGVVII−−LLTAVVPKITEQFVHMKQ−−QLPLST−−−RILLGLSDTLQRTG−−−−−−−−PT−−−−−−−LLA−−TV−−−−FIVAVG−−−−−−−FWLW−−LK−−RGNNR−−−H−−−−RFHAM−−L−−−−−L−−RV−−−ALIGPLICAINSARYLRTLSIL−−−QSSGVPLLDGMNLSTESLN−−−−−−−−−NLEIRQRLA−−−−−−−−−−−−NAAENVRQGNSIHLSL−−−EQT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−A−−−−−−IFPPMML−−−−−−−−YMVASGEKSGQLGTLMVRAADNQETLQQNRIALTLSIFEPALIITMALIVLFIVVSVLQPLLQLNSMI
fig|413997.3.peg.3326   Escherichia coli B str. REL606            YRYRAMTQ−−−−−−−−−−−−−−−−−−−DGQKLQGII−−−DANDERQARLRLREEGLFL−−LDI−−−−RP−−Q−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KSS−−−−−−−−−−−−−−−GVKTRRPR−−−−−ISHSEL−−TLFTRQLATLSAAALPLEESLAVIG−−−Q−−−−QSSNKR−−−LG−−−D−−−−−−−−−−VLNQVRSAILEGHPLSDA−−−−−LQHFPTLF−−DSLYRTLVKAGEKSGLL−−−−−−−−−−−APVLEKLADYNENRQKIRSKLIQSLIYPCMLT−−−TVAIGVVII−−LLTAVVPKITEQFVHMKQ−−QLPLST−−−RILLGLSDTLQRTG−−−−−−−−PT−−−−−−−LLA−−TV−−−−FIVAVG−−−−−−−FWLW−−LK−−RGNNR−−−H−−−−RFHAM−−L−−−−−L−−RV−−−ALIGPLICAINSARYLRTLSIL−−−QSSGVPLLDGMNLSTESLN−−−−−−−−−NLEIRQRLA−−−−−−−−−−−−NAAENVRQGNSIHLSL−−−EQT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−A−−−−−−IFPPMML−−−−−−−−YMVASGEKSGQLGTLMVRAADNQETLQQNRIALTLSIFEPALIITMALIVLFIVVSVLQPLLQLNSMI
fig|457400.3.peg.1369   Escherichia sp. 1_1_43            YRYRAMTQ−−−−−−−−−−−−−−−−−−−DGQKLQGII−−−DANDERQARLRLREEGLFL−−LDI−−−−RP−−Q−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KSS−−−−−−−−−−−−−−−GVKTRRPR−−−−−ISHSEL−−TLFTRQLATLSAAALPLEESLAVIG−−−Q−−−−QSSNKR−−−LG−−−D−−−−−−−−−−VLNQVRSAILEGHPLSDA−−−−−LQHFPTLF−−DSLYRTLVKAGEKSGLL−−−−−−−−−−−APVLEKLADYNENRQKIRSKLIQSLIYPCMLT−−−TVAIGVVII−−LLTAVVPKITEQFVHMKQ−−QLPLST−−−RILLGLSDTLQRTG−−−−−−−−PT−−−−−−−LLA−−TV−−−−FIVAVG−−−−−−−FWLW−−LK−−RGNNR−−−H−−−−RFHAM−−L−−−−−L−−RV−−−ALIGPLICAINSARYLRTLSIL−−−QSSGVPLLDGMNLSTESLN−−−−−−−−−NLEIRQRLA−−−−−−−−−−−−NAAENVRQGNSIHLSL−−−EQT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−A−−−−−−IFPPMML−−−−−−−−YMVASGEKSGQLGTLMVRAADNQETLQQNRIALTLSIFEPALIITMALIVLFIVVSVLQPLLQLNSMI
fig|457401.3.peg.4378   Escherichia sp. 4_1_40B            YRYRAMTQ−−−−−−−−−−−−−−−−−−−DGQKLQGII−−−DANDERQARLRLREEGLFL−−LDI−−−−RP−−Q−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KSS−−−−−−−−−−−−−−−GVKTRRPR−−−−−ISHSEL−−TLFTRQLATLSAAALPLEESLAVIG−−−Q−−−−QSSNKR−−−LG−−−D−−−−−−−−−−VLNQVRSAILEGHPLSDA−−−−−LQHFPTLF−−DSLYRTLVKAGEKSGLL−−−−−−−−−−−APVLEKLADYNENRQKIRSKLIQSLIYPCMLT−−−TVAIGVVII−−LLTAVVPKITEQFVHMKQ−−QLPLST−−−RILLGLSDTLQRTG−−−−−−−−PT−−−−−−−LLA−−TV−−−−FIVAVG−−−−−−−FWLW−−LK−−RGNNR−−−H−−−−RFHAM−−L−−−−−L−−RV−−−ALIGPLICAINSARYLRTLSIL−−−QSSGVPLLDGMNLSTESLN−−−−−−−−−NLEIRQRLA−−−−−−−−−−−−NAAENVRQGNSIHLSL−−−EQT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−A−−−−−−IFPPMML−−−−−−−−YMVASGEKSGQLGTLMVRAADNQETLQQNRIALTLSIFEPALIITMALIVLFIVVSVLQPLLQLNSMI
fig|527005.3.peg.2965   Yersinia ruckeri ATCC 29473            YRYLAVTD−−−−−−−−−−−−−−−−−−−KGKKCRGTL−−−SAESSRAARAQLREQQLTL−−ISL−−−−TQES−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−STSR−−−−−−−−−−TLSHPWRGSQDN−−−−−ISGSEL−−VLLTRQLSTLVAAALPLEEALQALA−−−Q−−−−QSEKPR−−−HR−−−A−−−−−−−−−−LLEQVRNKILEGLPLADA−−−−−LASFPKTF−−TPLFRTMIAAGEASGHL−−−−−−−−−−−DKVLLRLADNAEQSQKLKSKMLQALIYPLVLT−−−LVAIAVVAI−−LLTAVVPKVVEQFIHMQQ−−VLPLST−−−RILISLSDGLRDVG−−−−−−−−LW−−−−−−−ILL−−AG−−−−LLTALA−−−−−−−VRQW−−LK−−SAKNL−−−L−−−−WWHKK−−M−−−−−L−−SL−−−PSIGRVVLDLNLARYARTLSIL−−−NASAVPLLDAMHISASVLV−−−−−−−−−NNYARQRLI−−−−−−−−−−−−EASERVREGSSLALAL−−−DYT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−G−−−−−−LLSPMMR−−−−−−−−HMITSGENSGELDSMLERAADIQESAFVSRMTIALTLFEPLLVVSMASVVLFIILAILQPILQLNSMM
fig|349967.3.peg.1245   Yersinia mollaretii ATCC 43969            FRYLAISA−−−−−−−−−−−−−−−−−−−EGKKCRGTL−−−SAESSRAARAQLHEQQLTL−−ISM−−−−TAET−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RAPR−−−−−−−−−−AFSLSWRPAQES−−−−−IRGSDL−−VLLTRQLSTLVAAALPLEEALLALA−−−Q−−−−QSEKPR−−−HR−−−A−−−−−−−−−−LLQQVRNKILEGQPLAEA−−−−−LACFPKTF−−SSLFRTMIAAGEASGHL−−−−−−−−−−−DQVLLRLADNAEQSQKLKSKMLQALIYPLVLT−−−GVAITVVAI−−LLTAVVPKVVEQFIHMQQ−−ALPLST−−−RLLISLSNSLRDFG−−−−−−−−LW−−−−−−−GLL−−AG−−−−LMVGLG−−−−−−−TQQW−−LK−−SAKNR−−−L−−−−WWHQK−−M−−−−−L−−SL−−−PSVGRVVLDLNLARYARTLSIL−−−NASAVPLLDAMHISASVLV−−−−−−−−−NNYARQQLI−−−−−−−−−−−−EASERVREGSRLALAL−−−EST−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−G−−−−−−LLSPMMR−−−−−−−−HMITSGENSGELDSMLARAADIQESAFVNRMTIALALFEPLLVVSMATVVLFIILAILQPILQLNSMM
fig|393305.7.peg.3789   Yersinia enterocolitica subsp. enterocolitica 8081            YRYLAVTD−−−−−−−−−−−−−−−−−−−KGKKCRGTL−−−SAESPRAARAQLLGQQLTP−−ISL−−−−TPEN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DAPR−−−−−−−−−−GFSLSLGRSQDN−−−−−IRGNDL−−VLLTRQLSTLVAAALPLEEALLALA−−−Q−−−−QSEKPR−−−HR−−−A−−−−−−−−−−LLEQVRNKILEGQPLADA−−−−−LASFPKTF−−TLLFRTMVAAGEASGHL−−−−−−−−−−−DNVLLRLADNAEQSQKLKSKMLQAMIYPLVLT−−−VVAIAVVAI−−LLTAVVPKVIEQFIHMQQ−−ALPLST−−−RALISLSDALRDFG−−−−−−−−LW−−−−−−−ALL−−AF−−−−LLTALG−−−−−−−VRQW−−LK−−PADNL−−−M−−−−WWHKK−−M−−−−−L−−HL−−−PSIGRVVLDLNLARYARTLSIL−−−NASAVPLLEAMHISASVLA−−−−−−−−−NNYARQQLV−−−−−−−−−−−−EASEKVREGSRLASAL−−−EHT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−G−−−−−−LLSPMMR−−−−−−−−HMITSGENSGELDSMLERAADIQENAFVSRMTIALALFEPLLVVSMATVVLFIILAILQPILQLNSMM
fig|630.2.peg.3497   Yersinia enterocolitica 8081            YRYLAVTD−−−−−−−−−−−−−−−−−−−KGKKCRGTL−−−SAESPRAARAQLLGQQLTP−−ISL−−−−TPEN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DAPR−−−−−−−−−−GFSLSLGRSQDN−−−−−IRGNDL−−VLLTRQLSTLVAAALPLEEALLALA−−−Q−−−−QSEKPR−−−HR−−−A−−−−−−−−−−LLEQVRNKILEGQPLADA−−−−−LASFPKTF−−TLLFRTMVAAGEASGHL−−−−−−−−−−−DNVLLRLADNAEQSQKLKSKMLQAMIYPLVLT−−−VVAIAVVAI−−LLTAVVPKVIEQFIHMQQ−−ALPLST−−−RALISLSDALRDFG−−−−−−−−LW−−−−−−−ALL−−AF−−−−LLTALG−−−−−−−VRQW−−LK−−PADNL−−−M−−−−WWHKK−−M−−−−−L−−HL−−−PSIGRVVLDLNLARYARTLSIL−−−NASAVPLLEAMHISASVLA−−−−−−−−−NNYARQQLV−−−−−−−−−−−−EASEKVREGSRLASAL−−−EHT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−G−−−−−−LLSPMMR−−−−−−−−HMITSGENSGELDSMLERAADIQENAFVSRMTIALALFEPLLVVSMATVVLFIILAILQPILQLNSMM
fig|465817.9.peg.843   Erwinia tasmaniensis Et1/99            FRYQALNQ−−−−−−−−−−−−−−−−−−−RGVKVQGET−−−EADTPQQARQRLREQQLQP−−LRL−−−−RPVKS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GSLR−−−−−−−−−−AAS−−−−SSRRS−−−−−LSAGER−−VLMTRQLATLVGAALPLEQALLALE−−−K−−−−QTTRPA−−−GR−−−T−−−−−−−−−−MLHAIRQKVLEGASLADA−−−−−VSLYPATF−−PPLYQAMIAAGEASGKL−−−−−−−−−−−DNVLEQLADYSEKTQQIKSKLTQAMIYPLLLT−−−LVAISVITI−−LLTAVVPSVVEQFVHMKQ−−ALPLST−−−RLLMAISEMTRAVG−−−−−−−−LP−−−−−−−VLL−−VM−−−−LLAGFC−−−−−−−ARIL−−LR−−RPTQR−−−M−−−−RWHRA−−K−−−−−L−−RL−−−PLIGRIALNLNLARYARTLSIL−−−TNSAVPLLEGMHISATVLT−−−−−−−−−NLFIRQQLQ−−−−−−−−−−−−LAAERVREGTTLTLAL−−−EQT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−LLSPMMG−−−−−−−−HMIASGESSGELDSMLTKAADIQDSAFLGQMTLAVSLFEPLLVVVMAGVVLFIVLAILQPILQLNSLI
fig|1255308.3.peg.2889   Erwinia amylovora UPN527            FRYQALNQ−−−−−−−−−−−−−−−−−−−RGVKVQGET−−−EADTPQQARQLLREQQLQP−−LRL−−−−QPVKP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GVLR−−−−−−−−−−SGS−−−−SSRRS−−−−−LSASER−−VLMTRQLATLVGAALPLEQALLALE−−−K−−−−QTTKPA−−−GR−−−T−−−−−−−−−−MLHAIRQKVLEGASLADA−−−−−VGLYPATF−−PPLYQAMIAAGEASGKL−−−−−−−−−−−DNVLEQLADYSEKTQQIKGKLTQSMIYPLLLT−−−LVAISVITI−−LLTAVVPSVVEQFVHMKQ−−ALPLST−−−RLLMSISEITRAIG−−−−−−−−LP−−−−−−−VLL−−VI−−−−LLAGFC−−−−−−−ARII−−LR−−RPAQQ−−−L−−−−RWHQA−−K−−−−−L−−RL−−−PLIGRIVLNLNLARYARTLSIL−−−TNSAVPLLEGMHISATVLT−−−−−−−−−NLFIRQQLQ−−−−−−−−−−−−LAAERVREGTTLTLAL−−−EQT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−R−−−−−−LLSPMMG−−−−−−−−HMIASGESSGELDSMLTKAADIQDSAFLSQMTLAVSLFEPLLVVVMAGVVLFIVLAILQPILQLNSLI
fig|634499.3.peg.777   Erwinia pyrifoliae Ep1/96            FRYQALNQ−−−−−−−−−−−−−−−−−−−RGVKVQGET−−−EADTPQQARQLLREQQLQP−−LRL−−−−QPVKS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GSLH−−−−−−−−−−GGA−−−−SSRRS−−−−−LSAGER−−VLMTRQLATLVGAALPLEQALLALE−−−R−−−−QTTKPA−−−GR−−−T−−−−−−−−−−MLHAIRQKVLEGASLADA−−−−−VGLYPATF−−PPLYQAMIAAGEASGKL−−−−−−−−−−−DNVLEQLADYSEKTQQIKSKLTQAMIYPLLLT−−−LVAISVITI−−LLTAVVPSVVEQFVHMKQ−−ALPLST−−−RLLMSISEITRAIG−−−−−−−−LP−−−−−−−VLL−−VM−−−−LLAGFI−−−−−−−ARVM−−LR−−RPAQQ−−−L−−−−RWHQA−−K−−−−−L−−RL−−−PLIGRIVLNLNLARYARTLSIL−−−TNSAVPLLEGMHISATVLT−−−−−−−−−NLFIRQQLQ−−−−−−−−−−−−LAAERVREGTTLTLAL−−−EQT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−R−−−−−−LLSPMMG−−−−−−−−HMVASGESSGELDSMLTKAADIQDSAFLSQMTLAVSLFEPLLVVVMAGVVLFIVLAILQPILQLNSLI
fig|702431.3.peg.1344   Escherichia coli O157:H7 str. EC4192            FHYQASDI−−−−−−−−−−−−−−−−−−−HGRKRSGIL−−−EADSARHARQLLREQALIP−−VRL−−−−DEKQV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−HHKH−−−−SLRS−−IL−−−RFRPRG−−−−−GSSAEL−−ALLTRQLATLVAASLPLEEALDALL−−−R−−−−QSEKPR−−−QR−−−N−−−−−−−−−−LIAAVRTKVLEGHSLAAA−−−−−MGMFPGTF−−ERLYCAMVAAGETSGRL−−−−−−−−−−−DVVLSRLADYTEQRQIMRNRLLQALLYPCVLT−−−LVAVGVIAI−−LLTAVVPKVVEQFIHMKQ−−TLPLST−−−RVLMGAAEVSQTWG−−−−−−−−PW−−−−−−−LLL−−AA−−−−ALGGIA−−−−−−−GRMI−−LH−−QPSQR−−−L−−−−AFHHL−−L−−−−−L−−RL−−−PVVGRISRGLNTARYARTLSIL−−−NASAVPLLQAMHISGDVLS−−−−−−−−−NDWARHQLA−−−−−−−−−−−−TAAELVREGVSLHQAL−−−EQT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−S−−−−−−LFPPMMR−−−−−−−−HMIASGENSGELDSMLERAADNQDREFSTQMQLALGLFEPLLVVGMAGVVLFIVLAILQPLLQLNNMM
fig|502346.5.peg.5685   Escherichia coli O157:H7 str. TW14588            FHYQASDI−−−−−−−−−−−−−−−−−−−HGRKRSGIL−−−EADSARHARQLLREQALIP−−VRL−−−−DEKQV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−HHKH−−−−SLRS−−IL−−−RFRPRG−−−−−GSSAEL−−ALLTRQLATLVAASLPLEEALDALL−−−R−−−−QSEKPR−−−QR−−−N−−−−−−−−−−LIAAVRTKVLEGHSLAAA−−−−−MGMFPGTF−−ERLYCAMVAAGETSGRL−−−−−−−−−−−DVVLSRLADYTEQRQIMRNRLLQALLYPCVLT−−−LVAVGVIAI−−LLTAVVPKVVEQFIHMKQ−−TLPLST−−−RVLMGAAEVSQTWG−−−−−−−−PW−−−−−−−LLL−−AA−−−−ALGGIA−−−−−−−GRMI−−LH−−QPSQR−−−L−−−−AFHHL−−L−−−−−L−−RL−−−PVVGRISRGLNTARYARTLSIL−−−NASAVPLLQAMHISGDVLS−−−−−−−−−NDWARHQLA−−−−−−−−−−−−TAAELVREGVSXHQAL−−−EQT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−S−−−−−−LFPPMMR−−−−−−−−HMIASGENSGELDSMLERAADNQDREFSTQMQLALGLFEPLLVVGMAGVVLFIVLAIL