(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00002316

fig|70447.3.peg.2419   Ostreococcus sp. RCC809      GRGFVIVDIRSPDEWAE−−GSKST−−−−−WKK−−−−−−−−−−−−−−−IC−−−−−−−−−−LAVMD−−−−−−−−−−−−−−−−−−−−−−−−−−−−EETGEVEMNPYFLAQIKEEFPNTLSRILLLCDDGTER−−−SEIAWRGISKQGY−−−−−TQCKIVEG−−−−−−GS−−−−EAF−−−−−−−−−−FEAF−−−−−PL−−−−−−−−−TDADKRV−−−−−WKLQDQ                                                               
fig|398527.4.peg.4275   Burkholderia phytofirmans PsJN       RNAAVIDLRPSADYAK−−GHLPA−−−−−ARH−−−−−−−−−−−−−−−LE−−−−−−−−−−FA−−E−−−−−−−−−−−−−−LQAKVA−−−−−−−−QLVKNK−−−−−−−−−−SNP−−−−−−−VLLVCQTGQQ−−−−SNKAARIVQDAG−−Y−−−AEVHVLEG−−−−−−GV−−−−DAW−−−−−−−−QKAGM−−−−−PV−−−−−−−−−VKQGAA                                                                           
fig|640511.6.peg.251   Burkholderia sp. CCGE1002       RNAAVIDLRPSADYAK−−GHLPS−−−−−ARH−−−−−−−−−−−−−−−FE−−−−−−−−−−FA−−E−−−−−−−−−−−−−−LQAKVT−−−−−−−−QLAKNK−−−−−−−−−−SNP−−−−−−−VLLVCQTGQQ−−−−SNKAARIVQEAG−−Y−−−AEVHVLEG−−−−−−GV−−−−DAW−−−−−−−−QKAGM−−−−−PV−−−−−−−−−VKQGAA                                                                           
fig|516466.4.peg.4712   Burkholderia sp. H160       RNAAVIDLRPSADFAK−−GHLPS−−−−−ARH−−−−−−−−−−−−−−−FE−−−−−−−−−−LA−−E−−−−−−−−−−−−−−LQAKVA−−−−−−−−QLAKNK−−−−−−−−−−TNP−−−−−−−VLLVCQTGQQ−−−−SNKAARIVQEAG−−Y−−−AEVHVLEG−−−−−−GL−−−−DAW−−−−−−−−QKAGM−−−−−PV−−−−−−−−−VKQGAA                                                                           
fig|411902.9.peg.5241   Clostridium bolteae ATCC BAA-613      DKSAHVLDVREWDNYVK−−GRVAD−−−−−SMWCPI−−−−−−−−−−−−FP−−−−−−−−−−LE−−DDSLAEAMGTYAKENLSDGQK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IYIICNSGKRG−−−AEKATGVLKEAGIDG−−−SLIYTVEG−−−−−−GA−−−−KAL−−−−−−−−ESEKGA−−−−−−−−−−−−−−−−LTTNRA                                                                           
fig|411461.4.peg.2333   Dorea formicigenerans ATCC 27755      ADGVHVLDVREWDNYVT−−GRVKN−−−−−SEWCPI−−−−−−−−−−−−FP−−−−−−−−−−LE−−DDSLVDAMTDYAKENLNDGKD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IYIICNSGKRG−−−AEKATGVLRDAGIES−−−TSIYTVEG−−−−−−GA−−−−KAL−−−−−−−−ADVSGA−−−−−−−−−−−−−−−−LTTDRT                                                                           
fig|404589.4.peg.2472   Anaeromyxobacter sp. Fw109-5       SRYLVVDVRPADEYAK−−GHVPG−−−−−AIS−−−−−−−−−−−−−−−IP−−−−−−−−−−VDVLF−−−−−−−−−−−−−−LEGSLA−−−−−−−−KLPSGR−−−−−−−−−TPM−−−−−−−−ILLVCQSGHV−−−−ESMALGGLAALG−−−−−−YEPYVMRF−−−−−−GM−−−−IGWNAET−−−−RVKAGA−−−−−PG−−−−−−−−−QEPDTVRGVGGPIE                                                                   
fig|404589.10.peg.2987   Anaeromyxobacter sp. Fw109-5       SRYLVVDVRPADEYAK−−GHVPG−−−−−AIS−−−−−−−−−−−−−−−IP−−−−−−−−−−VDVLF−−−−−−−−−−−−−−LEGSLA−−−−−−−−KLPSGR−−−−−−−−−TPM−−−−−−−−ILLVCQSGHV−−−−ESMALGGLAALG−−−−−−YEPYVMRF−−−−−−GM−−−−IGWNAET−−−−RVKAGA−−−−−PG−−−−−−−−−QEPDTVRGVGGPIE                                                                   
fig|316058.11.peg.1098   Rhodopseudomonas palustris HaA2      DAGAVLVDVRERHEIER−−ERIDG−−−−−AIE−−−−−−−−−−−−−−−LP−−−−−−−−−−LTGFR−−−−−−−−−−−−−−−−−−−−−−−−−−−−HGDLRD−−−−−−−−−AHG−−−−−−RKAIFFCHSGGRTRMYAGQIAAKANGVCEP−−−−−−−YVLGG−−−−−−GI−−−−LAW−−−−−−−−RKAGF−−−−−DT−−−−−−−−−VKGPQPP                                                                          
fig|316058.9.peg.1049   Rhodopseudomonas palustris HaA2      DAGAVLVDVRERHEIER−−ERIDG−−−−−AIE−−−−−−−−−−−−−−−LP−−−−−−−−−−LTGFR−−−−−−−−−−−−−−−−−−−−−−−−−−−−HGDLRD−−−−−−−−−AHG−−−−−−RKAIFFCHSGGRTRMYAGQIAAKANGVCEP−−−−−−−YVLGG−−−−−−GI−−−−LAW−−−−−−−−RKAGF−−−−−DT−−−−−−−−−VKGPQPP                                                                          
fig|316057.3.peg.1181   Rhodopseudomonas palustris BisB5      GDGAVLVDIREQGEIAR−−EQIDG−−−−−AIA−−−−−−−−−−−−−−−MP−−−−−−−−−−LSSFK−−−−−−−−−−−−−−−−−−−−−−−−−−−−QGDLSN−−−−−−−−−ARG−−−−−−RKAIFFCHSGGRTRMYAGQIAAKANGVCEP−−−−−−−YVLGG−−−−−−GI−−−−LAW−−−−−−−−RKAGF−−−−−DT−−−−−−−−−VKGPQPPSL                                                                        
fig|316057.6.peg.1227   Rhodopseudomonas palustris BisB5      GDGAVLVDIREQGEIAR−−EQIDG−−−−−AIA−−−−−−−−−−−−−−−MP−−−−−−−−−−LSSFK−−−−−−−−−−−−−−−−−−−−−−−−−−−−QGDLSN−−−−−−−−−ARG−−−−−−RKAIFFCHSGGRTRMYAGQIAAKANGVCEP−−−−−−−YVLGG−−−−−−GI−−−−LAW−−−−−−−−RKAGF−−−−−DT−−−−−−−−−VKGPQPPSL                                                                        
fig|652103.6.peg.1184   Rhodopseudomonas palustris DX-1      HDGAVLVDVRERHEIER−−EHIAG−−−−−AIE−−−−−−−−−−−−−−−LP−−−−−−−−−−LTGLR−−−−−−−−−−−−−−−−−−−−−−−−−−−−HGDLSA−−−−−−−−−ARG−−−−−−RKAIFFCHSGGRTRMYGGQIEAKANGVCEP−−−−−−−YVLGG−−−−−−GI−−−−LAW−−−−−−−−RKAGF−−−−−PT−−−−−−−−−VQGPKPP                                                                          
fig|258594.8.peg.1047   Rhodopseudomonas palustris CGA009      GGRAVLVDVRERHEIAR−−EHIDG−−−−−AIE−−−−−−−−−−−−−−−LP−−−−−−−−−−LTGFK−−−−−−−−−−−−−−−−−−−−−−−−−−−−HGDLGA−−−−−−−−−AHG−−−−−−RKAIFFCHSGGRTRMYAGQIDAKARGVCEP−−−−−−−YVLGG−−−−−−GI−−−−LAW−−−−−−−−RRAGF−−−−−PT−−−−−−−−−VQGPKPP                                                                          
fig|395960.3.peg.1211   Rhodopseudomonas palustris TIE-1      GGRAVLVDVRERHEIAR−−EHIDG−−−−−AIE−−−−−−−−−−−−−−−LP−−−−−−−−−−LTGFK−−−−−−−−−−−−−−−−−−−−−−−−−−−−HGDLGA−−−−−−−−−ARG−−−−−−RKAIFFCHSGGRTRMYAGQIEAKASGVCEP−−−−−−−YVLGG−−−−−−GI−−−−LAW−−−−−−−−RKAGF−−−−−PT−−−−−−−−−VQGPKPP                                                                          
fig|316055.16.peg.1214   Rhodopseudomonas palustris BisA53      AAGAVLIDIRQPHEIER−−EQIDG−−−−−AIA−−−−−−−−−−−−−−−MP−−−−−−−−−−LTAFR−−−−−−−−−−−−−−−−−−−−−−−−−−−−DADLTP−−−−−−−−−ARD−−−−−−RKAIFFCHSGGRTMMYSGQIAAKSAGICDP−−−−−−−YVMSG−−−−−−GI−−−−LAW−−−−−−−−RRSGL−−−−−PT−−−−−−−−−VVGPRPP                                                                          
fig|316055.14.peg.1197   Rhodopseudomonas palustris BisA53      AAGAVLIDIRQPHEIER−−EQIDG−−−−−AIA−−−−−−−−−−−−−−−MP−−−−−−−−−−LTAFR−−−−−−−−−−−−−−−−−−−−−−−−−−−−DADLTP−−−−−−−−−ARD−−−−−−RKAIFFCHSGGRTMMYSGQIAAKSAGICDP−−−−−−−YVMSG−−−−−−GI−−−−LAW−−−−−−−−RRSGL−−−−−PT−−−−−−−−−VVGPRPP                                                                          
fig|316056.14.peg.1915   Rhodopseudomonas palustris BisB18      AGGAALLDVRERHEIDR−−EQIEG−−−−−AVA−−−−−−−−−−−−−−−VP−−−−−−−−−−LSRFA−−−−−−−−−−−−−−−−−−−−−−−−−−−−EADLEP−−−−−−−−−FRG−−−−−−RKVIFFCHSGGRTRLYAAKLAARLQGIGEG−−−−−−−YVLSG−−−−−−GI−−−−VAW−−−−−−−−RKAGL−−−−−KT−−−−−−−−−SLGPRPP                                                                          
fig|648757.3.peg.1029   Rhodomicrobium vannielii ATCC 17100      SGDAVLVDVREPQEYAA−−EHVAG−−−−−ATL−−−−−−−−−−−−−−−VP−−−−−−−−−−LGTVC−−−−−−−−−−−−−−−−−−−−−−−−−−−−CAKLPD−−−−−−−−−YTG−−−−−−KKLVIMCKLGGR−−−−GGKACEKLAGELPPR−−−AVVYNLDG−−−−−−GI−−−−EAW−−−−−−−−KKAGL−−−−−PV−−−−−−−−−ERAPRR                                                                           
fig|329726.14.peg.7118   Acaryochloris marina MBIC11017        EVLLIDVSKPQEFEK−−SHIPG−−−−−AKL−−−−−−−−−−−−−−−IP−−−−−−−−−−ID−−K−−−−−−−−−−−−−−FDPA−−−−−−−−−−TVPRLQ−−−−−−−−−GQR−−−−−−−−IVLQCQSGDR−−−−STQAAHQMLQAGF−−−−−SHVHHLQG−−−−−−GL−−−−AAW−−−−−−−−KAAGY−−−−−PT−−−−−−−−−QGKRSI−−−NILRLAQILTGSC−−−VLLGTSLGSTLSPWFVLFSIVVGGSLVLIGVSN                      
fig|394221.8.peg.1658   Maricaulis maris MCS10      AGRYRLIDVREPGEHAS−−ERIPE−−−−−ALL−−−−−−−−−−−−−−−VP−−−−−−−−−−LS−−R−−−−−−−−−−−−−−FRPG−−−−−−−−−−EIPEGE−−−−−−−−−GCA−−−−−−−−VVLHCRSGVR−−−−SARALDMCRSQGI−−−−−ELAGHMRG−−−−−−GI−−−−LKW−−−−−−−−KAAGL−−−−−PT−−−−−−−−−ERADRGA−−−SGLTVPQAVAASATVLVVISVGLAASVSPWWL−−−ILAAGVAVLLFQARLTGF−−CPFSRFFAGL      
fig|394221.5.peg.1581   Maricaulis maris MCS10      AGRYRLIDVREPGEHAS−−ERIPE−−−−−ALL−−−−−−−−−−−−−−−VP−−−−−−−−−−LS−−R−−−−−−−−−−−−−−FRPG−−−−−−−−−−EIPEGE−−−−−−−−−GCA−−−−−−−−VVLHCRSGVR−−−−SARALDMCRSQGI−−−−−ELAGHMRG−−−−−−GI−−−−LKW−−−−−−−−KAAGL−−−−−PT−−−−−−−−−ERADRGA−−−SGLTVPQAVAASATVLVVISVGLAASVSPWWL−−−ILAAGVAVLLFQARLTGF−−CPFSRFFAGL      
fig|290315.4.peg.520   Chlorobium limicola DSM 245       KGALFVDVREPREIARKAFDVPD−−−−−IML−−−−−−−−−−−−−−−IP−−−−−−−−−−LS−−T−−−−−−−−−−−−−−FEQRFQ−−−−−−−−EIPV−−−−−−−−−−−−NRN−−−−−−−LIIVCNSGNR−−−−SLTAGRLLLNRG−−Y−−−RKVVNMQY−−−−−−GI−−−−VGW−−−−−−−−DKEGL−−−−−PI−−−−−−−−−KRKPQRN−−−−LWSLLLQ                                                               
fig|319795.16.peg.1866   Deinococcus geothermalis DSM 11300      QEGALLVDVREPNEYQEV−−HAEG−−−−−ALL−−−−−−−−−−−−−−−LP−−−−−−−−−−LS−−E−−−−−−−−−−−−−−FEARYA−−−−−−−−ELPR−−−−−−−−−−−−DRE−−−−−−−LVMICRSGAR−−−−SARAGQYLLDNG−−Y−−−TKVVNLEG−−−−−−GT−−−−LAW−−−−−−−−KEAGL−−−−−PT−−−−−−−−−EE−−−−−−−−−−−−−GGA                                                               
fig|526227.6.peg.83   Meiothermus silvanus DSM 9946      DGNARLIDIREPQEWHQT−−GVARG−−−−−ATL−−−−−−−−−−−−−−−LP−−−−−−−−−−QT−−Q−−−−−−−−−−−−−−LDRCLG−−−−−−−−ELERRP−−−−−−−−−−−−−−−−−−−−SILVCRSGNR−−−−SEQVRRELEARG−−−−−−IRVWEVEG−−−−−−GL−−−−LAW−−−−−−−−IEAGL−−−−−PL−−−−−−−−−−−−−−−−−−SHPIAAER                                                                
fig|246197.24.peg.183   Myxococcus xanthus DK 1622       SELTLVDVREAAELDGILGHVAG−−−−−IRH−−−−−−−−−−−−−−−VP−−−−−−−−−−LA−−T−−−−−−−−−−−−−−VPDVVD−−−−−−−−AWPR−−−−−−−−−−−−DTD−−−−−−−VVMICRSGAR−−−−SARAATSLVALG−−F−−−TRVMNLRG−−−−−−GM−−−−LAW−−−−−−−−NTARL−−−−−PV−−−−−−−−−VRPIPHT−−−−LPTLGTVR                                                              
fig|763407.3.peg.2494   Phycomyces blakesleeanus NRRL 1555(-)       RDMILVDVREPSEIENG−−GKIQG−−−−−AVN−−−−−−−−−−−−−−−IP−−−−−−−−−−YG−−−−−−−−−−−−−−−−−LSKTNPALFRAVLNDLDKERW−−−−−−−−−−−−−−−−−−−TIFQCRSGRR−−−−SDFTALEALNLGF−−−−−TRVSDLKG−−−−−−GA−−−−LEW−−−−−−−−EALGF−−−−−PL−−−−−−−−−QKFNNNH−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SPW    
fig|522306.3.peg.1794   Accumulibacter phosphatis clade IIA str. UW-1       ENAQLIDVREPNEYVN−−GHVAD−−−−−SRN−−−−−−−−−−−−−−−IP−−−−−−−−−−VG−−S−−−−−−−−−−−−−−LAERAG−−−−−−−−ELEPLK−−−−−−−−−−DKP−−−−−−−VILVCQSGAR−−−−SSEACATLGKLG−−F−−−SRVHTLEG−−−−−−GV−−−−VGW−−−−−−−−AEAGL−−−−−PL−−−−−−−−−KKGARR                                                                           
fig|553217.3.peg.82   Enhydrobacter aerosaccus SK60      NQNAQLIDIRPRKDFEK−−GYIKG−−−−−SRN−−−−−−−−−−−−−−−IP−−−−−−−−−−FT−−E−−−−−−−−−−−−−−LKDHVD−−−−−−−−−−−−−−−−−−−−−−−ALRS−−−ADHPIIIVCQMGMT−−−−AGTAVAMI−−−GN−−−−−DNVYRLDG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GITNWQAAGLPLVVEKT      
fig|572477.4.peg.2980   Allochromatium vinosum DSM 180      HREAVIIDVRPAADYAR−−GHIIN−−−−−ALN−−−−−−−−−−−−−−−IP−−−−−−−−−−MN−−G−−−−−−−−−−−−−−FNNQLA−−−−−−−−TLNKYK−−−−−−−−−−GRP−−−−−−−IIVNCRSGAQ−−−−SSVACAHLRKAG−−F−−−EEVYNLQG−−−−−−GI−−−−MAW−−−−−−−−ESANL−−−−−PL−−−−−−−−−TRKKR                                                                            
fig|243233.4.peg.2472   Methylococcus capsulatus str. Bath       EDTLVVDVREPAEFAE−−GHIEG−−−−−AYH−−−−−−−−−−−−−−−IP−−−−−−−−−−LG−−K−−−−−−−−−−−−−−LEERAS−−−−−−−−EIAQYK−−−−−−−−−−EKP−−−−−−−VIVTCQQGTR−−−−SPSACKTLTKQG−−F−−−SRIYEMRG−−−−−−GM−−−−LAW−−−−−−−−RDAHY−−−−−PV−−−−−−−−−TRKRKK                                                                           
fig|243233.7.peg.2569   Methylococcus capsulatus str. Bath       EDTLVVDVREPAEFAE−−GHIEG−−−−−AYH−−−−−−−−−−−−−−−IP−−−−−−−−−−LG−−K−−−−−−−−−−−−−−LEERAS−−−−−−−−EIAQYK−−−−−−−−−−EKP−−−−−−−VIVTCQQGTR−−−−SPSACKTLTKQG−−F−−−SRIYEMRG−−−−−−GM−−−−LAW−−−−−−−−RDAHY−−−−−PV−−−−−−−−−TRKRKK                                                                           
fig|326423.3.peg.508   Bacillus amyloliquefaciens FZB42      DESLHILDVREIEEYEE−−AHIPG−−−−−VVH−−−−−−−−−−−−−−−IP−−−−−−−−−−LG−−E−−−−−−−−−−−−−−VEKRSN−−−−−−−−ELN−−K−−−−−−−−−−NDE−−−−−−−IYIICHSGRR−−−−SEMAAHTMKKQG−−F−−−KKVINVIP−−−−−−GM−−−−RDW−−−−−−−−TGQTE−−−−−KG−−−−−−−−−GR                                                                               
fig|485915.5.peg.1394   Desulfohalobium retbaense DSM 5692       REYTLVDVRQPEEYRE−−EHIPG−−−−−ALH−−−−−−−−−−−−−−−LP−−−−−−−−−−LP−−E−−−−−−−−−−−−−−LEDRLD−−−−−−−−QLPR−−−−−−−−−−−−DRE−−−−−−−LLFYCRSGRR−−−−SATAAALTAQSGQSF−−−KALYNIQG−−−−−−GI−−−−AAW−−−−−−−−Q−−−−G−−−−−GI−−−−−−−−−VEQVPRV−−−−DRFDMSR                                                               
fig|269797.3.peg.2140   Methanosarcina barkeri str. fusaro      DKGVFLLDVRTPAEYSY−−SHIEG−−−−−ATL−−−−−−−−−−−−−−−IP−−−−−−−−−−LK−−NVPSHDPVNLSDDQLLPNRMN−−−−−−−−ELPKNK−−−−−−−−−−NTK−−−−−−−IVVYCYTGKR−−−−GSAASQMIADAG−−Y−−−KRVYNIQG−−−−−−GL−−−−TAW−−−−−−−−VNAGC−−−−−PV−−−−−−−−−VVVTDSA−−−−TWS                                                                   
fig|443144.3.peg.3846   Geobacter sp. M21      NQKMVVLDVRTPEEYRQ−−AHLKG−−−−−SLL−−−−−−−−−−−−−−−IP−−−−−−−−−−LG−−D−−−−−−−−−−−−−−LGRRVQ−−−−−−−−EIP−−R−−−−−−−−−−NRP−−−−−−−VLVYCAVGAR−−−−SQTAASFLASKG−−Y−−−RDVYNMTD−−−−−−GL−−−−VGW−−−−−−−−YKNGL−−−−−PL−−−−−−−−−QIGSSR                                                                           
fig|443143.3.peg.860   Geobacter sp. M18      NSKIVLLDVRTPDEYRQ−−AHLKG−−−−−SLL−−−−−−−−−−−−−−−IP−−−−−−−−−−LG−−E−−−−−−−−−−−−−−LNRRAQ−−−−−−−−EIP−−R−−−−−−−−−−DRP−−−−−−−VLVYCAVGAR−−−−SSSAASFLSSRG−−Y−−−REVYNMTD−−−−−−GI−−−−VGW−−−−−−−−YNNGL−−−−−PL−−−−−−−−−QMGGR                                                                            
fig|96561.5.peg.2324   Desulfococcus oleovorans Hxd3           IIDVRQPGEYEK−−GHIPG−−−−−ARL−−−−−−−−−−−−−−−IP−−−−−−−−−−MG−−E−−−−−−−−−−−−−−LDTRLS−−−−−−−−EID−−R−−−−−−−−−−NKP−−−−−−−ALVYCAVGGR−−−−SRVAAQMMAGKG−−F−−−FNVINMAG−−−−−−GF−−−−KAWNGEAAVGPQSLGL−−−−−EL−−−−−−−−−FSGSEPI−−−−DQVLAVAYSI                                                            
fig|990288.8.peg.325   Acidithiobacillus caldus SM-1      GDDVLVVDVRQREDYEA−−GRLPG−−−−−AVH−−−−−−−−−−−−−−−AP−−−−−−−−−−RD−−H−−−−−−−−−−−−−−LEALADPNYLRCHPELARAH−−−−−−−−−−NRR−−−−−−−VLLYCDSGTR−−−−SLLAARTLKDMG−−F−−−VEVYNLSG−−−−−−GY−−−−HVW−−−−−−−−EAEDL−−−−−PT−−−−−−−−−HAGPPAA−−−−PS                                                                    
fig|262543.4.peg.2830   Exiguobacterium sibiricum 255-15       DGGLLLDVREPSENEL−−GSIPG−−−−−SVN−−−−−−−−−−−−−−−IS−−−−−−−−−−LP−−T−−−−−−−−−−−−−−LRQSLD−−−−−−−−ELP−−−−−−−−−−−−KDQP−−−−−−−IYVTCQVGLR−−−−GYVASQLLKQNG−−−−−−FDVKNLSG−−−−−−GY−−−−KTW−−−−−−−−−−−−−−−−−−−AT−−−−−−−−−VNRDREAR−−−−SQVR                                                                 
fig|262543.8.peg.2869   Exiguobacterium sibiricum 255-15       DGGLLLDVREPSENEL−−GSIPG−−−−−SVN−−−−−−−−−−−−−−−IS−−−−−−−−−−LP−−T−−−−−−−−−−−−−−LRQSLD−−−−−−−−ELP−−−−−−−−−−−−KDQP−−−−−−−IYVTCQVGLR−−−−GYVASQLLKQNG−−−−−−FDVKNLSG−−−−−−GY−−−−KTW−−−−−−−−−−−−−−−−−−−AT−−−−−−−−−VNRDREAR−−−−SQVR                                                                 
fig|458233.11.peg.472   Macrococcus caseolyticus JCSC5402          QLIDVREPIEYDM−−GTIGS−−−−−AKN−−−−−−−−−−−−−−−IP−−−−−−−−−−LG−−T−−−−−−−−−−−−−−LRDRLA−−−−−−−−ELD−−−−−−−−−−−−INEP−−−−−−−VAIFCQVGQR−−−−GYNAARILQNNG−−−−−−FDVVNLDG−−−−−−GY−−−−KHY−−−−−−−−−−KAMH−−−−−ET−−−−−−−−−VNRPEVRAVEQTQIEEGT                                                              
fig|103690.10.peg.1993   Nostoc sp. PCC 7120       SQPMLVDVREASEYRA−−GHIPN−−−−−AIN−−−−−−−−−−−−−−−IP−−−−−−−−−−LR−−T−−−−−−−−−−−−−−LSQNLN−−−−−−−−QIP−−−−−−−−−−−−RTRP−−−−−−−VVLYCSSGYR−−−−SAMGVMTLHLLG−−−−−−YE−−NVQGFPPSFAGW−−−−KNA−−−−−−−−−−KEA−−−−−−MT−−−−−−−−−YGRSKTIA                                                                         
fig|103690.1.peg.1816   Nostoc sp. PCC 7120       SQPMLVDVREASEYRA−−GHIPN−−−−−AIN−−−−−−−−−−−−−−−IP−−−−−−−−−−LR−−T−−−−−−−−−−−−−−LSQNLN−−−−−−−−QIP−−−−−−−−−−−−RTRP−−−−−−−VVLYCSSGYR−−−−SAMGVMTLHLLG−−−−−−YE−−NVQGFPPSFAGW−−−−KNA−−−−−−−−−−KEA−−−−−−MT−−−−−−−−−YGRSKTIA                                                                         
fig|439292.5.peg.701   Bacillus selenitireducens MLS10      SGELTILDIRERYEYEA−−EHVEG−−−−−ARH−−−−−−−−−−−−−−−LV−−−−−−−−−−IN−−D−−−−−−−−−−−−−−IPGTDP−−−−−−−−DQL−−P−−−−−−−−−−NGP−−−−−−−VAVYCGSGQR−−−−SAIAAGLLKEKG−−V−−−−DVRNIKG−−−−−−GF−−−−MRW−−−−−−−−KQEQR−−−−−PT−−−−−−−−−EQHAKTA                                                                          
fig|485918.5.peg.2637   Chitinophaga pinensis DSM 2588      DENLVIVDVRKPAEYAD−−GHIEG−−−−−AMN−−−−−−−−−−−−−−−LT−−−−−−−−−−LSDMT−−−−−−−DPGNLADFDDNHN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LYVHCQGGYR−−−−SIIACSIMKREGI−−−−−HNLRNVQG−−−−−−GY−−−−NAM−−−−−−−−KTQEGL−−−−−KV−−−−−−−−−VQEKN                                                                            
fig|485918.6.peg.937   Chitinophaga pinensis DSM 2588      DENLVIVDVRKPAEYAD−−GHIEG−−−−−AMN−−−−−−−−−−−−−−−LT−−−−−−−−−−LSDMT−−−−−−−DPGNLADFDDNHN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LYVHCQGGYR−−−−SIIACSIMKREGI−−−−−HNLRNVQG−−−−−−GY−−−−NAM−−−−−−−−KTQEGL−−−−−KV−−−−−−−−−VQEKN                                                                            
fig|269798.16.peg.1349   Cytophaga hutchinsonii ATCC 33406      DENINILDVRKADEYEK−−GHLNA−−−−−AQH−−−−−−−−−−−−−−−LP−−−−−−−−−−LD−−Y−−−−−−−−−−−−−−INDWIT−−−−−−−−TLD−−K−−−−−−−−−−NKT−−−−−−−YYVHCAGGYR−−−−SVITESILKSRN−−I−−−SNVIDVSG−−−−−−GY−−−−GAI−−−−−−−−KAAME−−−−−PT−−−−−−−−−KKRW                                                                             
fig|344747.3.peg.5788   Planctomyces maris DSM 8797      QDQLTVLDVRTDQEWNQ−−GHIEG−−−−−ALH−−−−−−−−−−−−−−−IH−−−−−−−−−−GG−−T−−−−−−−−−−−−−−LQERVG−−−−−−−−ELE−−S−−−−−−−−−−DKP−−−−−−−VAVICGSGYR−−−−ASIASSFLKRKG−−V−−−EDVTNIIG−−−−−−GM−−−−SAW−−−−−−−−QAAEL−−−−−PV−−−−−−−−−TKKSN                                                                            
fig|101510.15.peg.8208   Rhodococcus jostii RHA1      DGRITLLDVRNQGERDS−−GYIAG−−−−−SLH−−−−−−−−−−−−−−−IP−−−−−−−−−−LP−−E−−−−−−−−−−−−−−LA−−−−−−−−KRHNTLP−−−−−−−−−−−−QGRP−−−−−−−LVVHCRSGWR−−−−SSVAASLLRANGYEG−−−−−TTDLLG−−−−−−GY−−−−NAW−−−−−−−−QETET−−−−−PV−−−−−−−−−CDGAR                                                                            
fig|525904.4.peg.2933   Thermobaculum terrenum ATCC BAA-798     GDGVCVVDVRWDSEREK−−GYVPG−−−−−SIH−−−−−−−−−−−−−−−LP−−−−−−−−−−LG−−Y−−−−−−−−−−−−−−LE−−−−−−−−EHLEEIP−−−−−−−−−−−−TDKP−−−−−−−LLVYCASGTR−−−−SAIASSILAGRTRAP−−−−−VMDIKG−−−−−−GF−−−−DAW−−−−−−−−KATGN−−−−−PV−−−−−−−−−EEPKSTT                                                                          
fig|680198.5.peg.1028   Streptomyces scabiei 87.22      GDGVVVLDVRRDAERAG−−GCIDG−−−−−SLH−−−−−−−−−−−−−−−LP−−−−−−−−−−VH−−E−−−−−−−−−−−−−−LHGRLG−−−−−−−−EVPDGV−−−−−−−−−−−−−−−−−−−−VWVHCAGGMR−−−−AAIAASLLDAAG−−−−−−RDVVAVDD−−−−−−GF−−−−DAA−−−−−−−−AEAGL−−−−−TI−−−−−−−−−MRPGRT                                                                           
fig|100226.1.peg.589   Streptomyces coelicolor A3(2)      ADDMVVVDVRRAAERAH−−GWVRG−−−−−SVH−−−−−−−−−−−−−−−LP−−−−−−−−−−VH−−E−−−−−−−−−−−−−−IHRRLD−−−−−−−−EVPPGT−−−−−−−−−−−−−−−−−−−−VWVHCAGGMR−−−−AAVAASVLDAAG−−−−−−REVVAIDD−−−−−−GF−−−−AAA−−−−−−−−AGAGL−−−−−PL−−−−−−−−−VTPSDAT                                                                          
fig|457428.4.peg.5550   Streptomyces lividans TK24      ADDMVVVDVRRAAERAH−−GWVRG−−−−−SVH−−−−−−−−−−−−−−−LP−−−−−−−−−−VH−−E−−−−−−−−−−−−−−IHRRLD−−−−−−−−EVPPGT−−−−−−−−−−−−−−−−−−−−VWVHCAGGMR−−−−AAVAASVLDAAG−−−−−−REVVAIDD−−−−−−GF−−−−AAA−−−−−−−−AGAGL−−−−−PL−−−−−−−−−VTPSDAT                                                                          
fig|272623.1.peg.804   Lactococcus lactis subsp. lactis Il1403      SENPVIVDVREDFEYNS−−GHVPN−−−−−AKN−−−−−−−−−−−−−−−IP−−−−−−−−−−LS−−Q−−−−−−−−−−−−−−LEERYA−−−−−−−−EIT−−−−−−−−−−−−−−DG−−−−−−−TYLICQSGAR−−−−SARACQYLSTKG−−I−−−DTINISG−−−−−−GT−−−−IAW−−−−−−−−NG−−−−−−−−PL−−−−−−−−−EFTDR                                                                            
fig|929102.3.peg.770   Lactococcus lactis subsp. lactis CV56      SENPVIVDVREDFEYNS−−GHVPN−−−−−AKN−−−−−−−−−−−−−−−IP−−−−−−−−−−LS−−Q−−−−−−−−−−−−−−LEERYA−−−−−−−−EIT−−−−−−−−−−−−−−DG−−−−−−−TYLICQSGAR−−−−SARACQYLSTKG−−I−−−DTINISG−−−−−−GT−−−−IAW−−−−−−−−NG−−−−−−−−PL−−−−−−−−−EFTDR                                                                            
fig|416870.9.peg.1819   Lactococcus lactis subsp. cremoris MG1363      SENPVIVDVREDFEYNS−−GHVPN−−−−−AKN−−−−−−−−−−−−−−−IP−−−−−−−−−−LS−−Q−−−−−−−−−−−−−−LEERYA−−−−−−−−EIT−−−−−−−−−−−−−−DG−−−−−−−TYIICQSGAR−−−−SARACQYLSTKG−−I−−−DTINISG−−−−−−GT−−−−IAW−−−−−−−−NG−−−−−−−−PL−−−−−−−−−VFTDR                                                                            
fig|416870.7.peg.1774   Lactococcus lactis subsp. cremoris MG1363      SENPVIVDVREDFEYNS−−GHVPN−−−−−AKN−−−−−−−−−−−−−−−IP−−−−−−−−−−LS−−Q−−−−−−−−−−−−−−LEERYA−−−−−−−−EIT−−−−−−−−−−−−−−DG−−−−−−−TYIICQSGAR−−−−SARACQYLSTKG−−I−−−DTINISG−−−−−−GT−−−−IAW−−−−−−−−NG−−−−−−−−PL−−−−−−−−−VFTDR                                                                            
fig|644283.4.peg.3670   Micromonospora aurantiaca ATCC 27029      ADGATVIDVRETAEYLG−−GHVPG−−−−−ARC−−−−−−−−−−−−−−−VP−−−−−−−−−−LG−−H−−−−−−−−−−−−−−LATQMA−−−−−−−−QVP−−R−−−−−−−−−−TGP−−−−−−−VYVICEAGGR−−−−SRVGAELLERAG−−−−−−ITALSVAG−−−−−−GT−−−−SAW−−−−−−−−VRSGR−−−−−PV−−−−−−−−−TAGSRP                                                                           
fig|648999.3.peg.440   Micromonospora sp. L5      ADGATVIDVRETAEYLG−−GHVPG−−−−−ARC−−−−−−−−−−−−−−−VP−−−−−−−−−−LG−−H−−−−−−−−−−−−−−LATQMA−−−−−−−−QVP−−R−−−−−−−−−−TGP−−−−−−−VYVICEAGGR−−−−SRVGAELLERAG−−−−−−ITALSVAG−−−−−−GT−−−−SAW−−−−−−−−VRSGR−−−−−PV−−−−−−−−−TAGSRP                                                                           
fig|648999.4.peg.4766   Micromonospora sp. L5      ADGATVIDVRETAEYLG−−GHVPG−−−−−ARC−−−−−−−−−−−−−−−VP−−−−−−−−−−LG−−H−−−−−−−−−−−−−−LATQMA−−−−−−−−QVP−−R−−−−−−−−−−TGP−−−−−−−VYVICEAGGR−−−−SRVGAELLERAG−−−−−−ITALSVAG−−−−−−GT−−−−SAW−−−−−−−−VRSGR−−−−−PV−−−−−−−−−TAGSRP                                                                           
fig|525909.11.peg.169   Acidimicrobium ferrooxidans DSM 10331      QDGAFVVDVRDPWEYES−−GHVPG−−−−−AKN−−−−−−−−−−−−−−−IP−−−−−−−−−−LS−−H−−−−−−−−−−−−−−LPRRIH−−−−−−−−ELP−−R−−−−−−−−−−DKD−−−−−−−VHVICASGSR−−−−SYAAAQLLAGSG−−−−−−LRAVSVRG−−−−−−GT−−−−NAW−−−−−−−−IRAGK−−−−−PT−−−−−−−−−LNGSR                                                                            
fig|319795.16.peg.334   Deinococcus geothermalis DSM 11300       EGAHLIDVRERDEYVQ−−GHIPG−−−−−AVN−−−−−−−−−−−−−−−VP−−−−−−−−−−LS−−E−−−−−−−−−−−−−−LQGRED−−−−−−−−EIP−−−−−−−−−−−−−−DG−−−−−−−AVLICASGNR−−−−SSQAAAYLAAQG−−K−−−TGLMNLSG−−−−−−GT−−−−AAW−−−−−−−−LREGR−−−−−AV−−−−−−−−−SQGERP                                                                           
fig|675810.3.peg.3038   Vibrio sp. RC341       EGALLVDVRTVEEYAQ−−GHLDN−−−−−ALN−−−−−−−−−−−−−−−WP−−−−−−−−−−LS−−E−−−−−−−−−−−−−−VETAFQ−−−−−−−−SIAK−−−−−−−−−−−−DRP−−−−−−−IVVYCRSGNR−−−−SGMAQKYLIGQG−−Y−−−TQVHNGG−−−−−−GY−−−−DEM−−−−−−−−QRAVR−−−−−LV                                                                                          
fig|338969.3.peg.4098   Rhodoferax ferrireducens DSM 15236      SSGALLLDVREADEYAQ−−GHAPG−−−−−STL−−−−−−−−−−−−−−−IP−−−−−−−−−−LG−−Q−−−−−−−−−−−−−−LAQRLK−−−−−−−−EIAPFK−−−−−−−−−NQR−−−−−−−−VVLICRSGRR−−−−SAQATALL−−ETAGF−−−SAASNIEG−−−−−−GM−−−−LAW−−−−−−−−QQAG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LPVLT−−−GAASR                               
fig|350701.3.peg.4515   Burkholderia dolosa AUO158       PAVQVVDVREPDEFTGPLGHLPG−−−−−ATP−−−−−−−−−−−−−−−IP−−−−−−−−−−LG−−E−−−−−−−−−−−−−−LAARIG−−−−−−−−ELAR−−−−−−−−−−−−ERP−−−−−−−VVTVCRAGGR−−−−SAQATVILRNAG−−F−−−DAVANLGG−−−−−−GM−−−−LRW−−−−−−−−RAEGR−−−−−VV−−−−−−−−−T−−DGRA                                                                          
fig|234621.6.peg.352   Rhodococcus erythropolis PR4       SGAILIDVREDDEWAA−−GHAPA−−−−−AVH−−−−−−−−−−−−−−−VP−−−−−−−−−−LG−−S−−−−−−−−−−−−−−LDPSD−−−−−−−−YTP−−−−−−−−−−−−−DQP−−−−−−−LVVVCRSGAR−−−−SSKAAAVLGAAG−−R−−−TAHNLTG−−−−−−GM−−−−KAW−−−−−−−−HQDGR−−−−−PV−−−−−−−−−VRDDGTP                                                                          
fig|281090.11.peg.1116   Leifsonia xyli subsp. xyli str. CTCB07      AGAAWLLDVREQREWEA−−GHAPG−−−−−AHH−−−−−−−−−−−−−−−IA−−−−−−−−−−LS−−E−−−−−−−−−−−−−−FDGRQH−−−−−−−−ELPE−−−−−−−−−−−−GEQ−−−−−−−ILVICRSGGR−−−−SRMVTDALLRAS−−R−−−LAANVSG−−−−−−GM−−−−DAW−−−−−−−−ASSGG−−−−−AV−−−−−−−−−TRPDGSP                                                                          
fig|281090.3.peg.454   Leifsonia xyli subsp. xyli str. CTCB07      AGAAWLLDVREQREWEA−−GHAPG−−−−−AHH−−−−−−−−−−−−−−−IA−−−−−−−−−−LS−−E−−−−−−−−−−−−−−FDGRQH−−−−−−−−ELPE−−−−−−−−−−−−GEQ−−−−−−−ILVICRSGGR−−−−SRMVTDALLRAS−−R−−−LAANVSG−−−−−−GM−−−−DAW−−−−−−−−ASSGG−−−−−AV−−−−−−−−−TRPDGSP                                                                          
fig|443906.9.peg.1829   Clavibacter michiganensis subsp. michiganensis NCPPB 382       GESWLLDVREPDEWEA−−GHSAV−−−−−AHH−−−−−−−−−−−−−−−IP−−−−−−−−−−MG−−E−−−−−−−−−−−−−−LQARVD−−−−−−−−EIPT−−−−−−−−−−−−DQH−−−−−−−IAVVCRSGHR−−−−SAIATQALLRGG−−F−−−AASNITG−−−−−−GM−−−−HAW−−−−−−−−SEMGG−−−−−DV−−−−−−−−−VTEDGQP                                                                          
fig|471852.4.peg.2364   Thermomonospora curvata DSM 43183       QDAYLLDVREQDEWEA−−GHIPT−−−−−AVH−−−−−−−−−−−−−−−IP−−−−−−−−−−MG−−E−−−−−−−−−−−−−−LSDRAA−−−−−−−−EIPR−−−−−−−−−−−−DRD−−−−−−−VYVICRSGVR−−−−SAQVTVALNNAG−−W−−−RARNIDG−−−−−−GM−−−−KEW−−−−−−−−AGAGL−−−−−AM−−−−−−−−−VAESGAA−−−−P                                                                     
fig|391037.6.peg.5069   Salinispora arenicola CNS-205      ADDVYLLDVREDDEWLA−−GHAPG−−−−−AHH−−−−−−−−−−−−−−−LP−−−−−−−−−−MM−−D−−−−−−−−−−−−−−LPTRLA−−−−−−−−EVPG−−−−−−−−−−−−DRE−−−−−−−VAVICRSGGR−−−−SAQVVTYLLRNG−−W−−−ETVHNVEG−−−−−−GM−−−−GEW−−−−−−−−AAAGR−−−−−PV−−−−−−−−−VDGDGQP                                                                          
fig|369723.3.peg.4455   Salinispora tropica CNB-440       DDAYLLDVREDDEWLA−−GHAPN−−−−−AHH−−−−−−−−−−−−−−−LP−−−−−−−−−−MT−−Q−−−−−−−−−−−−−−LPTRLA−−−−−−−−EVPD−−−−−−−−−−−−NRE−−−−−−−VAVICRSGGR−−−−SAQVVTYLLRNG−−W−−−EQVRNVEG−−−−−−GM−−−−GEW−−−−−−−−AATGR−−−−−PV−−−−−−−−−VGGDGQP                                                                          
fig|648999.3.peg.3610   Micromonospora sp. L5       DDVYLLDVREDDEWAA−−GHAPA−−−−−AHH−−−−−−−−−−−−−−−LP−−−−−−−−−−MT−−E−−−−−−−−−−−−−−LPARIA−−−−−−−−EIPQ−−−−−−−−−−−−DRD−−−−−−−VAVICRSGGR−−−−SAQVVGYLMRNG−−W−−−DQVRNVDG−−−−−−GM−−−−GDW−−−−−−−−AAAGR−−−−−PV−−−−−−−−−VTDDGQP                                                                          
fig|644283.4.peg.6261   Micromonospora aurantiaca ATCC 27029       DDVYLLDVREDDEWAA−−GHAPA−−−−−AHH−−−−−−−−−−−−−−−LP−−−−−−−−−−MT−−E−−−−−−−−−−−−−−LPARIA−−−−−−−−EIPQ−−−−−−−−−−−−DRD−−−−−−−VAVICRSGGR−−−−SAQVVGYLMRNG−−W−−−DQVRNVDG−−−−−−GM−−−−GDW−−−−−−−−AAAGR−−−−−PV−−−−−−−−−VTDDGQP                                                                          
fig|648999.4.peg.6199   Micromonospora sp. L5       DDVYLLDVREDDEWAA−−GHAPA−−−−−AHH−−−−−−−−−−−−−−−LP−−−−−−−−−−MT−−E−−−−−−−−−−−−−−LPARIA−−−−−−−−EIPQ−−−−−−−−−−−−DRD−−−−−−−VAVICRSGGR−−−−SAQVVGYLMRNG−−W−−−DQVRNVDG−−−−−−GM−−−−GDW−−−−−−−−AAAGR−−−−−PV−−−−−−−−−VTDDGQP                                                                          
fig|479432.6.peg.127   Streptosporangium roseum DSM 43021       DGAFLLDVRENDEWRA−−GHAPA−−−−−AVH−−−−−−−−−−−−−−−IP−−−−−−−−−−LG−−E−−−−−−−−−−−−−−LQARVG−−−−−−−−EVPK−−−−−−−−−−−−DAP−−−−−−−VYVVCRAGSR−−−−SAHAAAWLGHVG−−W−−−DAINVGG−−−−−−GM−−−−QSW−−−−−−−−EVAGR−−−−−PM−−−−−−−−−VSESGQ                                                                           
fig|479433.5.peg.245   Catenulispora acidiphila DSM 44928       EGGLLLDVREDDEWAA−−GHAPT−−−−−AQH−−−−−−−−−−−−−−−IP−−−−−−−−−−MS−−E−−−−−−−−−−−−−−FAARKD−−−−−−−−ELGTP−−−−−−−−−−−EGP−−−−−−−VYVICRAGSR−−−−SAQVAQYLSQNG−−V−−−EAVNVTG−−−−−−GM−−−−QAW−−−−−−−−EAAGK−−−−−AV−−−−−−−−−VTDSGAA                                                                          
fig|478801.5.peg.110   Kytococcus sedentarius DSM 20547       DDAVVLDVREPEEWAA−−GHAPN−−−−−AVH−−−−−−−−−−−−−−−IP−−−−−−−−−−LA−−D−−−−−−−−−−−−−−VPARVD−−−−−−−−ELPDPS−−−−−−−−−TDGP−−−−−−−LPVTCRSGGR−−−−SSRAVQWLQAQG−−Y−−−EVVNVDG−−−−−−GM−−−−KAW−−−−−−−−SAAGK−−−−−QV−−−−−−−−−VSDAGEP                                                                          
fig|196162.6.peg.385   Nocardioides sp. JS614       DGLVVLDVREPAEWEH−−GHIEG−−−−−AVH−−−−−−−−−−−−−−−IP−−−−−−−−−−LA−−L−−−−−−−−−−−−−−LPLRHT−−−−−−−−ELP−−−−−−−−−−−−−EAQ−−−−−−−TLVVCRVGAR−−−−SAQAVAWLQQQG−−H−−−DAVNLAG−−−−−−GL−−−−LDW−−−−−−−−EAAGR−−−−−PM−−−−−−−−−VSDTGRP                                                                          
fig|288705.4.peg.3360   Renibacterium salmoninarum ATCC 33209      NDGTKILDVREDYEWDE−−GHIAG−−−−−AVH−−−−−−−−−−−−−−−IP−−−−−−−−−−LE−−E−−−−−−−−−−−−−−LPTRFE−−−−−−−−ELDP−−−−−−−−−−−DED−−−−−−−LYVICRSGGR−−−−SARATQWLNAQG−−Y−−−SALNVIG−−−−−−GM−−−−GAW−−−−−−−−QDAEK−−−−−PM−−−−−−−−−VSENGEP−−−−P                                                                     
fig|288705.3.peg.3359   Renibacterium salmoninarum ATCC 33209      NDGTKILDVREDYEWDE−−GHIAG−−−−−AVH−−−−−−−−−−−−−−−IP−−−−−−−−−−LE−−E−−−−−−−−−−−−−−LPTRFE−−−−−−−−ELDP−−−−−−−−−−−DED−−−−−−−LYVICRSGGR−−−−SARATQWLNAQG−−Y−−−SALNVIG−−−−−−GM−−−−GAW−−−−−−−−QDAEK−−−−−PM−−−−−−−−−VSENGEP−−−−P                                                                     
fig|321955.3.peg.1775   Brevibacterium linens BL2       EGAAIIDVREDDEWEA−−GHIDG−−−−−ALH−−−−−−−−−−−−−−−VP−−−−−−−−−−LA−−E−−−−−−−−−−−−−−LPTRLD−−−−−−−−DLPL−−−−−−−−−−−DDD−−−−−−−MYIICRTGGR−−−−SHRAVAWLTNNG−−F−−−DAYNVAG−−−−−−GM−−−−GSW−−−−−−−−NLDHGK−−−−−SI−−−−−−−−−VSENGEE−−−−PWVM                                                                  
fig|321955.4.peg.3057   Brevibacterium linens BL2       EGAAIIDVREDDEWEA−−GHIDG−−−−−ALH−−−−−−−−−−−−−−−VP−−−−−−−−−−LA−−E−−−−−−−−−−−−−−LPTRLD−−−−−−−−DLPL−−−−−−−−−−−DDD−−−−−−−MYIICRTGGR−−−−SHRAVAWLTNNG−−F−−−DAYNVAG−−−−−−GM−−−−GSW−−−−−−−−NLDHGK−−−−−SI−−−−−−−−−VSENGEE−−−−PWVM                                                                  
fig|762948.3.peg.408   Rothia dentocariosa ATCC 17931        GAKIIDVREDYEWEA−−GHVAG−−−−−AQH−−−−−−−−−−−−−−−IT−−−−−−−−−−LG−−T−−−−−−−−−−−−−−LTERLS−−−−−−−−ELPSK−−−−−−−−−−−DEE−−−−−−−FYVICHGGGR−−−−SNRAAEYLRQNG−−Y−−−QAKNIAG−−−−−−GT−−−−SAW−−−−−−−−FTAKL−−−−−PM−−−−−−−−−ESENGQE−−−−P                                                                     
fig|563033.4.peg.92   Rothia mucilaginosa M508        GATIIDVREDYEWEG−−GHATG−−−−−AKH−−−−−−−−−−−−−−−IT−−−−−−−−−−LG−−T−−−−−−−−−−−−−−IAERLE−−−−−−−−ELPAP−−−−−−−−−−−GED−−−−−−−FYVICHGGGR−−−−SNRAATFLREHG−−Y−−−AAHNIAG−−−−−−GT−−−−SAW−−−−−−−−FAAGL−−−−−PM−−−−−−−−−TSENGEA−−−−P                                                                     
fig|680646.3.peg.62   Rothia mucilaginosa DY-18       EGATIIDVREDYEWEG−−GHATG−−−−−AKH−−−−−−−−−−−−−−−IT−−−−−−−−−−LG−−T−−−−−−−−−−−−−−ITERLA−−−−−−−−ELPAP−−−−−−−−−−−GED−−−−−−−FYVICHGGGR−−−−SNRAATFLREHG−−Y−−−AAHNIAG−−−−−−GT−−−−SAW−−−−−−−−FAAGL−−−−−PM−−−−−−−−−TSENGEA−−−−P                                                                     
fig|522306.3.peg.2900   Accumulibacter phosphatis clade IIA str. UW-1      AAGVPVIDIRTEGEWKE−−SGIIPG−−−−−SRL−−−−−−−−−−−−−−−LT−−−−−−−−−−FV−−D−−−−−−−−−−−−−−ERGRTD−−−−−−−−AAAWLA−−−−−−−−−KVQAVAKPEQPVIVICRSGNR−−−−TRAASQLLAQQAGY−−−−QKVYNVKD−−−−−−GI−−−−RSW−−−−−−−−AGDGR−−−−−PL−−−−−−−−−−−−−−−−−−−−VAAPTALVTCAAGS                                                        
fig|321955.3.peg.2418   Brevibacterium linens BL2      SSPAILIDVRDGWERQI−−STIPG−−−−−SVH−−−−−−−−−−−−−−−LP−−−−−−−−−−LSVLQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−VQGWKA−−−−−−−−−VEATAIHQPDEVIFHCKSGAR−−−−SAQAVALLKEGAPGA−−−VRLRSLRG−−−−−−GI−−−−DAW−−−−−−−−SASGH−−−−−KT−−−−−−−−−VQAPGQT                                                                          
fig|321955.4.peg.2220   Brevibacterium linens BL2      SSPAILIDVRDGWERQI−−STIPG−−−−−SVH−−−−−−−−−−−−−−−LP−−−−−−−−−−LSVLQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−VQGWKA−−−−−−−−−VEATAIHQPDEVIFHCKSGAR−−−−SAQAVALLKEGAPGA−−−VRLRSLRG−−−−−−GI−−−−DAW−−−−−−−−SASGH−−−−−KT−−−−−−−−−VQAPGQT                                                                          
fig|504728.6.peg.21   Meiothermus ruber DSM 1279        GALLIDVRTPLERKL−−SKIPG−−−−−SQG−−−−−−−−−−−−−−−LP−−−−−−−−−−LA−−E−−−−−−−−−−−−−−LARRWE−−−−−−−−SLP−−K−−−−−−−−−−DRP−−−−−−−IICFCESGSR−−−−SQQAAEFLAEKG−−L−−−−EVYNLAG−−−−−−GI−−−−SAW−−−−−−−−QAAGL−−−−−PV−−−−−−−−−KKGDLQR                                                                          
fig|525909.11.peg.1232   Acidimicrobium ferrooxidans DSM 10331      DGSLVVLDVRPEEEWRA−−AHLPG−−−−−AVP−−−−−−−−−−−−−−−AP−−−−−−−−−−LV−−A−−−−−−−−−−−−−−LREVPTRL−−−−−−−−−−−A−−−−−−−−−PGSE−−−−−−−VIVYCRGPWCAY−−ASIAVRWLRDRGIE−−−−−ARRLED−−−−−−GF−−−−LGW−−−−−−−−LVDGR−−−−−AV−−−−−−−−−ESGST                                                                            
fig|156889.10.peg.1148   Magnetococcus sp. MC-1       GSVTVLDVRPEEEYAA−−GHLPG−−−−−AVN−−−−−−−−−−−−−−−IP−−−−−−−−−−LK−−D−−−−−−−−−−−−−−LEANLALL−−−−−−−−−−−P−−−−−−−−−AGQE−−−−−−−VVAYCRGPWCVL−−AFDAVARLRARGIK−−−−−ARRLQD−−−−−−GL−−−−PEW−−−−−−−−RLAGL−−−−−PV−−−−−−−−−EGGSRA                                                                           
fig|394.7.peg.745   Rhizobium sp. NGR234      DEDVTLLDVRPEDEFNL−−GHLPG−−−−−ALN−−−−−−−−−−−−−−−VP−−−−−−−−−−LG−−E−−−−−−−−−−−−−−LERHLAEL−−−−−−−−−−−P−−−−−−−−−RDHE−−−−−−−IVAYCRGPYCVL−−SFEAVAALRAKGYH−−−−−VRRLKD−−−−−−GF−−−−PEW−−−−−−−−KAAGY−−−−−AV−−−−−−−−−EVASS                                                                            
fig|75379.4.peg.757   Thiomonas intermedia K12       GDAVLIDVRPEAEYRT−−AHLPE−−−−−ARS−−−−−−−−−−−−−−−LP−−−−−−−−−−LP−−E−−−−−−−−−−−−−−LEARLREL−−−−−−−−−−−P−−−−−−−−−RSKE−−−−−−−IVAYCRGPFCVM−−SDTAVKLLVERGFR−−−−−ARKIAE−−−−−−GV−−−−PEW−−−−−−−−QAAGL−−−−−PL−−−−−−−−−EQNTAP                                                                           
fig|485918.5.peg.7066   Chitinophaga pinensis DSM 2588      DPDTIVVDMRNHYEYEV−−GHFQN−−−−−AIE−−−−−−−−−−−−−−−VP−−−−−−−−−−SD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TFREQLPMAVDMLKDQKDKNI−−−−−−VMYCTGG−−−−IRCEKASAYMLHNGF−−−−−KNVFHLEG−−−−−−GIIEYTNKA−−−−−−−−KEQGL−−−−−PL−−−−−−−−−KFKGK                                                                            
fig|485918.6.peg.3681   Chitinophaga pinensis DSM 2588      DPDTIVVDMRNHYEYEV−−GHFQN−−−−−AIE−−−−−−−−−−−−−−−VP−−−−−−−−−−SD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TFREQLPMAVDMLKDQKDKNI−−−−−−VMYCTGG−−−−IRCEKASAYMLHNGF−−−−−KNVFHLEG−−−−−−GIIEYTNKA−−−−−−−−KEQGL−−−−−PL−−−−−−−−−KFKGK                                                                            
fig|411469.3.peg.1858   Eubacterium hallii DSM 3353      DSEGLLVDVRSEEVFKK−−GHLPM−−−−−AVN−−−−−−−−−−−−−−−LP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FEEIMNEKFDIEAIEKDFNIEKEQPVFLYCDTGSTSMLAAKKLDSVGIH−−−−−−−−−−AYSVVG−−−−−−GIMFY−−−−−−−−−−−−−−−KGY−−−−−LE−−−−−−−−−KEKNDLWTMVR                                                                      
fig|203122.15.peg.1886   Saccharophagus degradans 2-40       QSPVYVDVRTDEEYNL−−GHLSF−−−−−SAN−−−−−−−−−−−−−−−IP−−−−−−−−−−LGLLS−−−−−−−−−−−−−−LKKRLL−−−−−−−−−−−−−−−−−−−−−−DPAKP−−−−−−−YVFYCDTGRR−−−−SRAAAYLLGKQG−−−−−−YNAMALAG−−−−−−GF−−−−I−−−−−−−−−−−−EAGL−−−−−SE−−−−−−−−−−−−−−−NLVQEAGYMLRHGELVAGA                                                        
fig|367737.6.peg.75   Arcobacter butzleri RM4018      NNSALLVDPRPFAKYL−−−−QETIIG−−−−−AIS−−−−−−−−−−−−−−−VPDTDFEKLLGRFP−−−−−−−−−−−−−−−−−INKDEK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ILIFCSGFNCEKSNIVANKLYALGY−−−−−KNVVVYAG−−−−−−GL−−−−PAW−−−−−−−−KEAGL−−−−−KT−−−−−−−−−TSFAKA                                                                           
fig|479433.5.peg.3120   Catenulispora acidiphila DSM 44928       EGALLIDIRPHANREAE−−GEIPG−−−−−−−A−−−−−−−−−−−−−−−LP−−−−−−−−−−VERIH−−−−−−−−−−−−−−LEWRLAPDNEWRLPGVTADSQ−−−−−−−−−−−−−−−−−−−VIVFCNEGYA−−−−SSLAARDLQLLGL−−−−−VHATDLVG−−−−−−GF−−−−RAW−−−−−−−−AEAGL−−−−−PT−−−−−−−−−EAGGRPALP                                                                        
fig|87626.3.peg.3573   Pseudoalteromonas tunicata D2      NNTVILLDVRSDEEFKD−−GHIPG−−−−−AIN−−−−−−−−−−−−−−−YSHLDIINNTAVLD−−−−−−−−−−−−−−−−−YQKDQA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IIVYCRSGRR−−−−AAAAEQALIDLGF−−−−−TNVKHLEG−−−−−−DW−−−−LGW−−−−−−−−QETQL−−−−−KT−−−−−−−−−DNTKAQ                                                                           
fig|391735.5.peg.3219   Verminephrobacter eiseniae EF01-2      GRNLYLLDVRTPEEYQA−−GHLPG−−−−−SRS−−−−−−−−−−−−−−−AP−−−−−−−−−−GG−−Q−−−−−−−−−−−−−−LVQSTD−−−−−−−−−−−−−−−−−−−−−−−−−DYVGVRNACLVLVDDNGVR−−−−ARVTASWLLQMGC−−−−−KDVHVLRD−−−−−−GL−−−−−−−−−−−−−−−HSAGA−−−−−AL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RRGWQGP 
fig|391735.7.peg.3758   Verminephrobacter eiseniae EF01-2      GRNLYLLDVRTPEEYQA−−GHLPG−−−−−SRS−−−−−−−−−−−−−−−AP−−−−−−−−−−GG−−Q−−−−−−−−−−−−−−LVQSTD−−−−−−−−−−−−−−−−−−−−−−−−−DYVGVRNACLVLVDDNGVR−−−−ARVTASWLLQMGC−−−−−KDVHVLRD−−−−−−GL−−−−−−−−−−−−−−−HSAGA−−−−−AL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RRGWQGP 
fig|443143.3.peg.2272   Geobacter sp. M18        GARVVDVMTPEDYAA−−CHLAG−−−−−ACNACIYEMVFMDRISEAVP−−−−−−−−−−−−−−D−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RDTE−−−−−−−LIVYDATGTRRT−−AELARERLLQAGY−−−−−PKVSVLEG−−−−−−GL−−−−RAL−−−−−−−−RAAGF−−−−−AM−−−−−−−−−ESGEGPPASGTEMQV                                                                  
fig|504728.6.peg.2866   Meiothermus ruber DSM 1279       RGAVLLDVRSPEEFAS−−GHIPG−−−−−SRN−−−−−−−−−−−−−−−LP−−−−−−−−−−LE−−Q−−−−−−−−−−−−−−LLEALD−−−−−−−−TL−−−−−−−−−−−−−−KSP−−−−−−−VVTICATGSR−−−−AGLAAEVLGYEG−−−−−−LEVGKLVG−−−−−−GI−−−−QGY−−−−−−−−AAQGY−−−−−PL−−−−−−−−−ERTATQV                                                                          
fig|663278.3.peg.2276   Ethanoligenens harbinense YUAN-3      GQNILLLDVRSPEEYAE−−VHIPH−−−−−SVS−−−−−−−−−−−−−−−VP−−−−−−−−−−LD−−R−−−−−−−−−−−−−−LQSQIS−−−−−−−−KVANDK−−−−−−−−−DME−−−−−−−−IIVYCLSGAR−−−−AASACSLLTAMG−−−−−−YTNVSSMG−−−−−−GI−−−−RSWAYET−−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−RGTRSR                                                                     
fig|693985.5.peg.3715   Pseudomonas savastanoi pv. savastanoi NCPPB 3335       QELALVDVREEAPFAQ−−AHPLF−−−−−AVN−−−−−−−−−−−−−−−IP−−−−−−−−−−LS−−K−−−−−−−−−−−−−−LELEVF−−−−−−−−PRIPRR−−−−−−−−−−DTA−−−−−−−ITLYDDGEGL−−−AQVALQRLQALG−−Y−−−SDVRLLDG−−−−−−GL−−−−QGW−−−−−−−−REAGG−−−−−EL−−−−−−−−−FIDVNVP−−−−SKA                                                                   
fig|666475.3.peg.4166   Pseudomonas syringae pv. aesculi str. 2250       QELALVDVREEAPFAQ−−AHPLF−−−−−AVN−−−−−−−−−−−−−−−IP−−−−−−−−−−LS−−K−−−−−−−−−−−−−−LELEVF−−−−−−−−PRIPRR−−−−−−−−−−DTA−−−−−−−ITLYDDGEGL−−−AQVALQRLQALG−−Y−−−SDVRLLDG−−−−−−GL−−−−QGW−−−−−−−−REAGG−−−−−EL−−−−−−−−−FIDVNVP−−−−SKA                                                                   
fig|573066.3.peg.1150   Pseudomonas syringae pv. tabaci ATCC 11528       QELALVDVREEAPFAQ−−AHPLF−−−−−AVN−−−−−−−−−−−−−−−IP−−−−−−−−−−LS−−K−−−−−−−−−−−−−−LELEVF−−−−−−−−PRIPRR−−−−−−−−−−DTA−−−−−−−ITLYDDGEGL−−−AQVALQRLQALG−−Y−−−SDVKLLDG−−−−−−GL−−−−QGW−−−−−−−−REAGG−−−−−EL−−−−−−−−−FIDVNVP−−−−SKA                                                                   
fig|264730.9.peg.3792   Pseudomonas syringae pv. phaseolicola 1448A       QELALVDVREEAPFAQ−−AHPLF−−−−−AVN−−−−−−−−−−−−−−−IP−−−−−−−−−−LS−−K−−−−−−−−−−−−−−LELEVF−−−−−−−−PRIPRR−−−−−−−−−−DTA−−−−−−−ITLYDDGEGL−−−AQVALQRLQALG−−Y−−−SDVRLLEG−−−−−−GL−−−−QGW−−−−−−−−REAGG−−−−−EL−−−−−−−−−FIDVNVP−−−−SKA                                                                   
fig|216595.1.peg.1885   Pseudomonas fluorescens SBW25      HEEVALVDVREEAPFAE−−SHPLF−−−−−AAN−−−−−−−−−−−−−−−IP−−−−−−−−−−LS−−K−−−−−−−−−−−−−−LELEVY−−−−−−−−SRIPRR−−−−−−−−−−DTQ−−−−−−−VTVYDNGEGL−−−AARAAERLVALG−−Y−−−TQVSVLEG−−−−−−GL−−−−DGW−−−−−−−−RKAGG−−−−−EL−−−−−−−−−FIDVNVP−−−−SKA                                                                   
fig|573066.3.peg.5380   Pseudomonas syringae pv. tabaci ATCC 11528      GQEIALFDVREHGQYGD−−AHLFH−−−−−GVT−−−−−−−−−−−−−−−LP−−−−−−−−−−YS−−R−−−−−−−−−−−−−−LELDIR−−−−−−−−RLAPNP−−−−−−−−−−NVR−−−−−−−LVIYDQTGSDV−−−APRAALRLVASG−−Y−−−CNVHLLEG−−−−−−GV−−−−QGW−−−−−−−−QASGR−−−−−QL−−−−−−−−−FAGVHVP−−−−SKAFGELVEQV                                                           
fig|296591.12.peg.2061   Polaromonas sp. JS666      GEEIALFDVREHGQYGQ−−AHLFY−−−−−GIP−−−−−−−−−−−−−−−LP−−−−−−−−−−YS−−R−−−−−−−−−−−−−−LELDAP−−−−−−−−RLAPRQ−−−−−−−−−−SVR−−−−−−−LVVYDDDGQQV−−−APSAALRLAALG−−Y−−−SNVHVLQG−−−−−−GS−−−−AGW−−−−−−−−QAAGF−−−−−PL−−−−−−−−−FAGVNVP−−−−SKSFGELAEQV                                                           
fig|296591.1.peg.2565   Polaromonas sp. JS666      GEEIALFDVREHGQYGQ−−AHLFY−−−−−GIP−−−−−−−−−−−−−−−LP−−−−−−−−−−YS−−R−−−−−−−−−−−−−−LELDAP−−−−−−−−RLAPRQ−−−−−−−−−−SVR−−−−−−−LVVYDDDGQQV−−−APSAALRLAALG−−Y−−−SNVHVLQG−−−−−−GS−−−−AGW−−−−−−−−QAAGF−−−−−PL−−−−−−−−−FAGVNVP−−−−SKSFGELAEQV                                                           
fig|96561.5.peg.2886   Desulfococcus oleovorans Hxd3      DTDLVVVDVRTDDHYD−−−−GSVIPG−−−−−AVR−−−−−−−−−−−−−−−LP−−−−−−−−−−WSEFQ−−−−−−−−−−−−−−FNDVGE−−−−−−−−DLASTFVGVRQAQDILGRHGITRKDTVVLYDSVERDGGATASYVFWVLDVLGH−−−−−ENKMLLER−−−−−−GI−−−−NAW−−−−−−−−RDAGY−−−−−EV−−−−−−−−−TTAPRTPEPLLYQ                                                                    
fig|91464.3.peg.797   Synechococcus sp. PCC 7335       PALTIVDVRDREAFND−−ERIMG−−−−−AVS−−−−−−−−−−−−−−−MPADKNLVERAKQS−−−−−−−−−−−−−−−−−MSPERD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFVYSDSDQD−−−−TAAAAIQLQEAGF−−−−−QKVSAIKG−−−−−−GL−−−−PAW−−−−−−−−KAINGA−−−−−−−−−−−−−−−−VEGRGQA                                                                          
fig|530564.3.peg.3294   Pirellula staleyi DSM 6068      AGKAVIVDVREQAEWDE−−KHVAG−−−−−AIH−−−−−−−−−−−−−−−LP−−−−−−−−−−KS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KL−−ELSSGLEELVKQLDKSK−−−−−−TIYTHCGAG−−KRALACGEILKKAGF−−−−−−DVKPLKP−−−−−−GI−−−−NQL−−−−−−−−LEAGFEKGKTP                                                                                           
fig|296591.12.peg.1397   Polaromonas sp. JS666      NKPTVILDVRT−−−−−−E−−LSRAG−−−−−GGI−−−−−−−−−−−−−−−IP−−−−−−−−−−GA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LVWSDLDRKMASLDLPHDAHV−−−−−−VVYCACPND−−ASAAQVAKRLMAAGF−−−−−SNVRPLHG−−−−−−GI−−−−DAW−−−−−−−−EAAGF−−−−−PL−−−−−−−−−EYPSR                                                                            
fig|296591.1.peg.1892   Polaromonas sp. JS666      NKPTVILDVRT−−−−−−E−−LSRAG−−−−−GGI−−−−−−−−−−−−−−−IP−−−−−−−−−−GA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LVWSDLDRKMASLDLPHDAHV−−−−−−VVYCACPND−−ASAAQVAKRLMAAGF−−−−−SNVRPLHG−−−−−−GI−−−−DAW−−−−−−−−EAAGF−−−−−PL−−−−−−−−−EYPSR                                                                            
fig|324602.8.peg.690   Chloroflexus aurantiacus J-10-fl       PDLLIIDVRDAAEVAQT−−GAIPG−−−−−AIN−−−−−−−−−−−−−−−LS−−−−−−−−−−YG−−T−−−−−−−−−−−−−−LTYAADHTAPEDWRDPRLAD−−−−−−−−−HARP−−−−−−−IVTTCGLGPL−−−−GALGGGLLHEMGFTN−−−−−VQILEG−−−−−−GV−−−−QAW−−−−−−−−IDAGL−−−−−PV−−−−−−−−−VKPGDQ                                                                           
fig|279714.4.peg.344   Pseudogulbenkiania ferrooxidans 2002       DGVLVVDVREPAEYAA−−GHVPG−−−−−ALN−−−−−−−−−−−−−−−LP−−−−−−−−−−RG−−V−−−−−−−−−−−−−−LEFRLEAV−−−−−−−PEWAK−−−−−−−−−RQRP−−−−−−−VLLYCQTSNC−−−−AALAALSLLQMGYST−−−−−VRSIAG−−−−−−GF−−−−DDW−−−−−−−−VAAGL−−−−−PV−−−−−−−−−EKPAQPA                                                                          
fig|318586.4.peg.4357   Paracoccus denitrificans PD1222      DPQVVLVDIRDPRELERE−−GLIPG−−−−−AFH−−−−−−−−−−−−−−−AP−−−−−−−−−−RG−−M−−−−−−−−−−−−−−LEFWIDPDSPYHKPRFA−−−−−−−−−−−−EGGT−−−−−−−YVFYCASGWR−−−−SLLAARVAQEMGLDA−−−−−−RSLRG−−−−−−GF−−−−GEW−−−−−−−−RRAGQ−−−−−PV−−−−−−−−−AERPAR                                                                           
fig|318586.5.peg.4552   Paracoccus denitrificans PD1222      DPQVVLVDIRDPRELERE−−GLIPG−−−−−AFH−−−−−−−−−−−−−−−AP−−−−−−−−−−RG−−M−−−−−−−−−−−−−−LEFWIDPDSPYHKPRFA−−−−−−−−−−−−EGGT−−−−−−−YVFYCASGWR−−−−SLLAARVAQEMGLDA−−−−−−RSLRG−−−−−−GF−−−−GEW−−−−−−−−RRAGQ−−−−−PV−−−−−−−−−AERPAR                                                                           
fig|266779.9.peg.3255   Chelativorans sp. BNC1      SDEFVLVDIRDPRELERD−−GMIPS−−−−−AFH−−−−−−−−−−−−−−−AP−−−−−−−−−−RG−−M−−−−−−−−−−−−−−LEFWIDPESPYHKPKFA−−−−−−−−−−−−EGKT−−−−−−−YVFYCASGWR−−−−SLLAARLAMEMGIDA−−−−−−RSLRG−−−−−−GF−−−−GDW−−−−−−−−KRAGY−−−−−PV−−−−−−−−−AQKTKQ                                                                           
fig|1247725.3.peg.3795   Rhodobacter sp. AKP1      DADIVMVDIRDPRELERE−−GMIPG−−−−−AFH−−−−−−−−−−−−−−−AP−−−−−−−−−−RG−−M−−−−−−−−−−−−−−LEFWIDPESPYHKPRFA−−−−−−−−−−−−EDRT−−−−−−−FVFYCASGWR−−−−SLLAARLAQEMGLKA−−−−−−LSLRG−−−−−−GF−−−−GDW−−−−−−−−KKAGR−−−−−PV−−−−−−−−−AEGGRR                                                                           
fig|267608.8.peg.277   Ralstonia solanacearum GMI1000      DPQVQFVDVRDIRELERE−−GGIPH−−−−−ALH−−−−−−−−−−−−−−−AP−−−−−−−−−−RG−−M−−−−−−−−−−−−−−LEFWVDPDSPYHKPAFA−−−−−−−−−−−−QDKT−−−−−−−FVFFCAAGWR−−−−SALAAKTVQDMGLGSGHTGRVAHIDG−−−−−−GF−−−−TAW−−−−−−−−KAAGA−−−−−PV−−−−−−−−−AAYEKPT                                                                          
fig|266835.9.peg.430   Mesorhizobium loti MAFF303099      DEGTIFVDLRDPREVERD−−GGIPG−−−−−AKH−−−−−−−−−−−−−−−VT−−−−−−−−−−RG−−M−−−−−−−−−−−−−−LEFWIDPESPYHKPFFA−−−−−−−−−−−−SGKS−−−−−−−FVFFCAGGWR−−−−SALATKTAQDMGLVP−−−−−VKHILG−−−−−−GY−−−−TAW−−−−−−−−KAAGL−−−−−PV−−−−−−−−−EPGEKK                                                                           
fig|536019.3.peg.307   Mesorhizobium opportunistum WSM2075      DEGTIFVDLRDPREIERD−−GRIPG−−−−−AKH−−−−−−−−−−−−−−−VT−−−−−−−−−−RG−−M−−−−−−−−−−−−−−LEFWIDPESPYHKPFFA−−−−−−−−−−−−SEKS−−−−−−−FVFFCAGGWR−−−−SALATKTAQDMGLSP−−−−−VKHILG−−−−−−GY−−−−TAW−−−−−−−−KAAGL−−−−−PV−−−−−−−−−EPGDKK                                                                           
fig|312153.5.peg.1923   Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1      DSNAVFVDIRDVRELERE−−GMIPN−−−−−ALH−−−−−−−−−−−−−−−AP−−−−−−−−−−RG−−M−−−−−−−−−−−−−−LEFWVDPDSPYYKPIFG−−−−−−−−−−−−EGKR−−−−−−−LILYCASAWR−−−−SALATEILQKMGVPN−−−−−VCHLAG−−−−−−GF−−−−NAW−−−−−−−−KKASL−−−−−PT−−−−−−−−−VEKASKP                                                                          
fig|312153.3.peg.1906   Polynucleobacter sp. QLW-P1DMWA-1      DSNAVFVDIRDVRELERE−−GMIPN−−−−−ALH−−−−−−−−−−−−−−−AP−−−−−−−−−−RG−−M−−−−−−−−−−−−−−LEFWVDPDSPYYKPIFG−−−−−−−−−−−−EGKR−−−−−−−LILYCASAWR−−−−SALATEILQKMGVPN−−−−−VCHLAG−−−−−−GF−−−−NAW−−−−−−−−KKASL−−−−−PT−−−−−−−−−VEKASKP                                                                          
fig|582899.5.peg.937   Hyphomicrobium denitrificans ATCC 51888      GPNVTFIDIREPHELEAD−−GAIPG−−−−−AVH−−−−−−−−−−−−−−−AP−−−−−−−−−−RG−−M−−−−−−−−−−−−−−LEFLADPASPYHKDVFS−−−−−−−−−−−−SGNE−−−−−−−LILYCASSGR−−−−SSLAAATLQDMGLSH−−−−−VAHIDG−−−−−−GF−−−−KAW−−−−−−−−KQAGL−−−−−PI−−−−−−−−−EPVAKQ                                                                           
fig|323097.3.peg.4039   Nitrobacter hamburgensis X14      DSDVVFVDIRESDELQKT−−GTLKG−−−−−ALH−−−−−−−−−−−−−−−VP−−−−−−−−−−RG−−F−−−−−−−−−−−−−−LEFQADPTSPTHKPELG−−−−−−−−−−−−GGKK−−−−−−−LVLYCGSGSR−−−−SALGANTLMEMGIIN−−−−−IAHVAG−−−−−−GF−−−−PAL−−−−−−−−QQAGA−−−−−PC−−−−−−−−−EEAKQ                                                                            
fig|318167.14.peg.2055   Shewanella frigidimarina NCIMB 400      NPDVIIIDVREHDEFTT−−GHIEG−−−−−AVN−−−−−−−−−−−−−−−FP−−−−−−−−−−RG−−V−−−−−−−−−−−−−−LEMKI−−−−−HEHPLVSHHCEWVLALNELADKD−−−−−−−IYLICRTGGR−−−−SALAAASLQDMGFSK−−−−−PMSVAG−−−−−−GM−−−−MQW−−−−−−−−QQDGF−−−−−PL−−−−−−−−−VPHKK                                                                            
fig|272624.3.peg.685   Legionella pneumophila subsp. pneumophila str. Philadelphia 1        NLSLIDVRELDEWEM−−MHIPG−−−−−ALH−−−−−−−−−−−−−−−IP−−−−−−−−−−KD−−R−−−−−−−−−−−−−−ISLEIQ−−−−−−−−NQIPNK−−−−−−−−−−EQT−−−−−−−IYLHCRSGVR−−−−SLYAAQCLMDLG−−Y−−−YEVYSVDG−−−−−−GI−−−−MAW−−−−−−−−AMSGY−−−−−PV−−−−−−−−−K−−−−−−−−−−−−−−−QESY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TP                         
fig|1081095.3.peg.1739   Legionella pneumophila subsp. pneumophila str. Hextuple_3a        NLSLIDVRELDEWEM−−MHIPG−−−−−ALH−−−−−−−−−−−−−−−IP−−−−−−−−−−KD−−R−−−−−−−−−−−−−−ISLEIQ−−−−−−−−NQIPNK−−−−−−−−−−EQT−−−−−−−IYLHCRSGVR−−−−SLYAAQCLMDLG−−Y−−−YEVYSVDG−−−−−−GI−−−−MAW−−−−−−−−AMSGY−−−−−PV−−−−−−−−−K−−−−−−−−−−−−−−−QESY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TP                         
fig|1312904.3.peg.1348   Legionella pneumophila subsp. pneumophila LPE509        NLSLIDVRELDEWEM−−MHIPG−−−−−ALH−−−−−−−−−−−−−−−IP−−−−−−−−−−KD−−R−−−−−−−−−−−−−−ISLEIQ−−−−−−−−NQIPNK−−−−−−−−−−EQT−−−−−−−IYLHCRSGVR−−−−SLYAAQCLMDLG−−Y−−−YEVYSVDG−−−−−−GI−−−−MAW−−−−−−−−AMSGY−−−−−PV−−−−−−−−−K−−−−−−−−−−−−−−−QESY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TP                         
fig|297246.15.peg.2088   Legionella pneumophila str. Paris        NLSLIDVRELDEWEM−−MHIPG−−−−−ALH−−−−−−−−−−−−−−−IP−−−−−−−−−−KD−−R−−−−−−−−−−−−−−ISIEIQ−−−−−−−−NQIPNK−−−−−−−−−−EQT−−−−−−−IYLHCRSGVR−−−−SLYAAQCLMDLG−−Y−−−YEVYSVDG−−−−−−GI−−−−MAW−−−−−−−−AMSGY−−−−−PV−−−−−−−−−K−−−−−−−−−−−−−−−QESY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TP                         
fig|297245.3.peg.2094   Legionella pneumophila str. Lens      QSNLSLIDVRELDEWEM−−MHIPG−−−−−ALH−−−−−−−−−−−−−−−IP−−−−−−−−−−KD−−C−−−−−−−−−−−−−−ISTEIQ−−−−−−−−NQIPNK−−−−−−−−−−EQT−−−−−−−IYLHCRSGVR−−−−SLYAAQCLMDLG−−Y−−−YEVYSVDG−−−−−−GI−−−−MAW−−−−−−−−AMSGY−−−−−PV−−−−−−−−−K−−−−−−−−−−−−−−−QESY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TP                         
fig|309801.4.peg.1242   Thermomicrobium roseum DSM 5159      GRRPVIIDVREREEWEQ−−GYVPG−−−−−ALF−−−−−−−−−−−−−−−IP−−−−−−−−−−RG−−Y−−−−−−−−−−−−−−LEMRIE−−−−−−−−EEVPDK−−−−−−−−−−STP−−−−−−−IYVYCAGGVR−−−−SAFAAKTLEELG−−Y−−−QNVYSVAG−−−−−−GF−−−−SAW−−−−−−−−KHAGY−−−−−PF−−−−−−−−−VTPRQWT−−−−REQ−−LQRYSRHFLIPEVGEEGQAKLLDSKV−−−LIIGAGGLGSPAALYLAA−−AGVGTLGIVDADVVD 
fig|137722.3.peg.2470   Azospirillum sp. B510       GGAILVDVRDDEETAA−−GAPAG−−−−−ALR−−−−−−−−−−−−−−−VP−−−−−−−−−−RG−−F−−−−−−−−−−−−−−LELRIE−−−−−−−−DGVPDP−−−−−−−−−−ASP−−−−−−−LLLMCAGGTR−−−−SLLAAEDLLRMG−−Y−−−GDVRSVRG−−−−−−GF−−−−SAW−−−−−−−−KAAGL−−−−−PV−−−−−−−−−EVPPRLD−−−−AGQ−−RERYRRHLTMPEVGEAGQHRLLNSSV−−−ALIGAGGLGSPIALYLAA−−AGVG            
fig|160492.1.peg.463   Xylella fastidiosa 9a5c      ASGAVFIDVRQSYERVS−−GQAEG−−−−−ALG−−−−−−−−−−−−−−−ID−−−−−−−−−−QA−−T−−−−−−−−−−−−−−LEAHSS−−−−−−−−THLPDT−−−−−−−−−−NAE−−−−−−−IVLICQSGQR−−−−SRHTGERLQAAG−−Y−−−RQLYSVAG−−−−−−GT−−−−DAW−−−−−−−−RKAGL−−−−−PL−−−−−−−−−LRPILST−−−−DEQDFIERYARHLRLPHIGPHGQQRLAEARV−−−LLIGAGGLGSPAAFYLTA−−AGVG            
fig|160492.11.peg.496   Xylella fastidiosa 9a5c      ASGAVFIDVRQSYERVS−−GQAEG−−−−−ALG−−−−−−−−−−−−−−−ID−−−−−−−−−−QA−−T−−−−−−−−−−−−−−LEAHSS−−−−−−−−THLPDT−−−−−−−−−−NAE−−−−−−−IVLICQSGQR−−−−SRHTGERLQAAG−−Y−−−RQLYSVAG−−−−−−GT−−−−DAW−−−−−−−−RKAGL−−−−−PL−−−−−−−−−LRPILST−−−−DEQDFIERYARHLRLPHIGPHGQQRLAEARV−−−LLIGAGGLGSPAAFYLTA−−AGVG            
fig|405441.5.peg.2108   Xylella fastidiosa M23      ASGAVFIDVRQSYERVS−−GQAEG−−−−−ALG−−−−−−−−−−−−−−−ID−−−−−−−−−−QA−−T−−−−−−−−−−−−−−LEAHSS−−−−−−−−THLPDT−−−−−−−−−−NAE−−−−−−−IVLICQSGQR−−−−SRHTGERLQAAG−−Y−−−RRLYSVAG−−−−−−GT−−−−DAW−−−−−−−−RKAGL−−−−−PL−−−−−−−−−LRPILST−−−−DEQDFMERYARHLRLPHIGPHGQQRLAEARV−−−LLIGAGGLGSPAAFYLTA−−AGVG            
fig|155920.4.peg.4069   Xylella fastidiosa subsp. sandyi Ann-1      ASGAVFIDVRQSYERVS−−GQAEG−−−−−ALG−−−−−−−−−−−−−−−ID−−−−−−−−−−QA−−T−−−−−−−−−−−−−−LEAHSS−−−−−−−−THLPDT−−−−−−−−−−NAE−−−−−−−IVLICQSGQR−−−−SRHTGERLQAAG−−Y−−−RRLYSVAG−−−−−−GT−−−−DAW−−−−−−−−RKAGL−−−−−PL−−−−−−−−−LRPMLTT−−−−DEQDFMERYARHLRLPHIGPHGQQRLAEARV−−−LLIGAGGLGSPAAFYLTA−−AGVG            
fig|405440.3.peg.1613   Xylella fastidiosa M12      ASGAVFIDVRQSYERVS−−GQAEG−−−−−ALG−−−−−−−−−−−−−−−ID−−−−−−−−−−QA−−T−−−−−−−−−−−−−−LEAHSS−−−−−−−−THLPDT−−−−−−−−−−NAE−−−−−−−IVLICQSGQR−−−−SRHTGERLQAAG−−Y−−−RRLYSVAG−−−−−−GT−−−−DAW−−−−−−−−RKAGL−−−−−PL−−−−−−−−−LRPMLTT−−−−DEQDFMERYARHLRLPHIGPHGQQRLAEARM−−−LLIGAGGLGSPAAFYLTA−−AGVG            
fig|155920.4.peg.682   Xylella fastidiosa subsp. sandyi Ann-1      ASGAVFIDVRQSYERVS−−GQAEG−−−−−ALG−−−−−−−−−−−−−−−ID−−−−−−−−−−QA−−T−−−−−−−−−−−−−−LEARSS−−−−−−−−THLPDT−−−−−−−−−−NAE−−−−−−−IVLICQSGQR−−−−SRHTGERLQAAG−−Y−−−RRLYSVAG−−−−−−GT−−−−DAW−−−−−−−−RKAGL−−−−−PL−−−−−−−−−LRPMLTA−−−−DEQDFMERYARHLRLPHIGPHGQQRLAEARV−−−LLIGAGGLGSPAAFYLTA−−AGVG            
fig|314565.5.peg.2352   Xanthomonas campestris pv. campestris str. 8004       RGALLIDIRQPHERVS−−GQAEG−−−−−ALA−−−−−−−−−−−−−−−IA−−−−−−−−−−QA−−D−−−−−−−−−−−−−−LEQAPA−−−−−−−−QHLPDR−−−−−−−−−−DRD−−−−−−−ILLICQSGKR−−−−SAQTAAQLREQG−−Y−−−PHALSVLG−−−−−−GT−−−−TAW−−−−−−−−SRDGL−−−−−PL−−−−−−−−−VRPTLPS−−−−DETDFLERYSRHLRLPQVGIDGQQRLARARV−−−LLIGAGGLGSPAAFYLAA−−AGVG            
fig|190485.1.peg.1959   Xanthomonas campestris pv. campestris ATCC 33913       RGALLIDIRQPHERVS−−GQAEG−−−−−ALA−−−−−−−−−−−−−−−IA−−−−−−−−−−QA−−D−−−−−−−−−−−−−−LEQAPA−−−−−−−−QHLPDR−−−−−−−−−−DRD−−−−−−−ILLICQSGKR−−−−SAQTAAQLREQG−−Y−−−PHALSVLG−−−−−−GT−−−−TAW−−−−−−−−SRDGL−−−−−PL−−−−−−−−−VRPTLPS−−−−DETDFLERYSRHLRLPQVGIDGQQRLARARV−−−LLIGAGGLGSPAAFYLAA−−AGVG            
fig|509169.4.peg.2336   Xanthomonas campestris pv. campestris str. B100       RGALLIDIRQPHERVS−−GQAEG−−−−−ALA−−−−−−−−−−−−−−−IA−−−−−−−−−−QA−−D−−−−−−−−−−−−−−LEQAPA−−−−−−−−QHLPDR−−−−−−−−−−DCD−−−−−−−ILLICQSGKR−−−−SAQTAAQLREQG−−Y−−−PHALSVLG−−−−−−GT−−−−TAW−−−−−−−−SRDGL−−−−−PL−−−−−−−−−VRPTLPP−−−−DEVDFLERYSRHLRLPQVGIDGQQRLARARV−−−LLIGAGGLGSPAAFYLAA−−AGIG            
fig|291331.3.peg.1519   Xanthomonas oryzae pv. oryzae KACC10331       QGALLIDIRQLHERAS−−GQAEG−−−−−ALA−−−−−−−−−−−−−−−IA−−−−−−−−−−QN−−A−−−−−−−−−−−−−−LETEPA−−−−−−−−THLPEH−−−−−−−−−−ARE−−−−−−−IVLICQRGKR−−−−SAHTAAILRAHG−−Y−−−ARVASVAG−−−−−−GT−−−−SAW−−−−−−−−ASDGL−−−−−PL−−−−−−−−−VRPTLPP−−−−DEQDFLERYSRHLRLSQVGVEGQRRLARARV−−−LLVGAGGLGSPAAFYLAA−−AGVG            
fig|291331.8.peg.2787   Xanthomonas oryzae pv. oryzae KACC10331       QGALLIDIRQLHERAS−−GQAEG−−−−−ALA−−−−−−−−−−−−−−−IA−−−−−−−−−−QN−−A−−−−−−−−−−−−−−LETEPA−−−−−−−−THLPEH−−−−−−−−−−ARE−−−−−−−IVLICQRGKR−−−−SAHTAAILRAHG−−Y−−−ARVASVAG−−−−−−GT−−−−SAW−−−−−−−−ASDGL−−−−−PL−−−−−−−−−VRPTLPP−−−−DEQDFLERYSRHLRLSQVGVEGQRRLARARV−−−LLVGAGGLGSPAAFYLAA−−AGVG            
fig|383407.3.peg.2342   Xanthomonas oryzae pv. oryzicola BLS256       QGALLIDIRQLHERAS−−GQAEG−−−−−ALA−−−−−−−−−−−−−−−IA−−−−−−−−−−QN−−A−−−−−−−−−−−−−−LETEPA−−−−−−−−THLPEH−−−−−−−−−−ARE−−−−−−−IVLICQRGKR−−−−SAHTAAILRAHG−−Y−−−ARVASVAG−−−−−−GT−−−−SAW−−−−−−−−ASNGL−−−−−PL−−−−−−−−−VRPTLPP−−−−DEQDFLERYSRHLRLPQVGVEGQRRLAHARV−−−LLVGAGGLGSPAAFYLAA−−AGVG            
fig|1094180.3.peg.3647   Xanthomonas vasicola pv. vasculorum NCPPB 1381       QGALLVDIRQLHERAS−−GQAEG−−−−−ALA−−−−−−−−−−−−−−−IT−−−−−−−−−−QN−−A−−−−−−−−−−−−−−LETEPA−−−−−−−−VHLPEQ−−−−−−−−−−TRA−−−−−−−IVLICQSGKR−−−−SAHTAAILRALG−−Y−−−AQVASVAG−−−−−−GT−−−−S