(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00002052

fig|340186.5.peg.829   Escherichia coli E110019     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVT                           
fig|1181762.3.peg.1638   Escherichia coli KTE216     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVT                           
fig|431946.3.peg.1098   Escherichia coli SE15     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVT                           
fig|585054.5.peg.2635   Escherichia fergusonii ATCC 35469     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVT                           
fig|444450.8.peg.3224   Escherichia coli O157:H7 str. EC4115     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVT                           
fig|550676.3.peg.1357   Escherichia coli B185     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVT                           
fig|340186.3.peg.797   Escherichia coli E110019     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVT                           
fig|1182687.3.peg.1181   Escherichia coli KTE80     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVT                           
fig|1182689.3.peg.1307   Escherichia coli KTE83     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVT                           
fig|656380.3.peg.1898   Escherichia coli FVEC1412     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVT                           
fig|216593.1.peg.1654   Escherichia coli E2348/69     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVT                           
fig|469008.4.peg.2986   Escherichia coli BL21(DE3)     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVT                           
fig|574521.7.peg.1020   Escherichia coli O127:H6 str. E2348/69     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVT                           
fig|585397.7.peg.2558   Escherichia coli ED1a     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVT                           
fig|573235.3.peg.3271   Escherichia coli O26:H11 str. 11368     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVT                           
fig|1258580.3.peg.4590   Escherichia coli LCT-EC59     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVT                           
fig|199310.1.peg.1501   Escherichia coli CFT073     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVT                           
fig|714962.3.peg.1284   Escherichia coli IHE3034     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVT                           
fig|585035.6.peg.1175   Escherichia coli S88     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVT                           
fig|1005470.3.peg.492   Escherichia coli FDA504     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVT                           
fig|155864.1.peg.274   Escherichia coli O157:H7 EDL933     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVT                           
fig|444449.5.peg.4199   Escherichia coli O157:H7 str. EC4042     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVT                           
fig|444449.5.peg.5084   Escherichia coli O157:H7 str. EC4042     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVT                           
fig|444450.8.peg.422   Escherichia coli O157:H7 str. EC4115     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVT                           
fig|502346.5.peg.985   Escherichia coli O157:H7 str. TW14588     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVT                           
fig|562.374.peg.91   Escherichia coli 536A     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVT                           
fig|1005440.3.peg.402   Escherichia coli 99.1753     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVT                           
fig|340186.3.peg.3709   Escherichia coli E110019     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVT                           
fig|340186.5.peg.3892   Escherichia coli E110019     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVT                           
fig|656379.3.peg.1324   Escherichia coli FVEC1302     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVT                           
fig|502347.3.peg.152   Escherichia albertii TW07627     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVT                           
fig|1005470.3.peg.3023   Escherichia coli FDA504     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVT                           
fig|444449.5.peg.1687   Escherichia coli O157:H7 str. EC4042     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVT                           
fig|444450.8.peg.3531   Escherichia coli O157:H7 str. EC4115     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVT                           
fig|502346.5.peg.4397   Escherichia coli O157:H7 str. TW14588     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVT                           
fig|562.374.peg.121   Escherichia coli 536A     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVT                           
fig|83334.1.peg.2983   Escherichia coli O157:H7     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVT                           
fig|869679.4.peg.1439   Escherichia coli 3.2608     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVT                           
fig|701177.3.peg.3280   Escherichia coli O55:H7 str. CB9615     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVT                           
fig|155864.1.peg.1274   Escherichia coli O157:H7 EDL933     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVT                           
fig|340186.3.peg.2748   Escherichia coli E110019     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVT                           
fig|340186.5.peg.2850   Escherichia coli E110019     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVT                           
fig|573235.3.peg.1611   Escherichia coli O26:H11 str. 11368     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVT                           
fig|340197.3.peg.3211   Escherichia coli F11     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVT                           
fig|1169370.3.peg.1045   Escherichia coli KTE97     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVT                           
fig|340197.5.peg.3358   Escherichia coli F11     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVT                           
fig|550677.3.peg.2593   Escherichia coli B354     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVT                           
fig|1169374.3.peg.1176   Escherichia coli KTE106     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVT                           
fig|550672.3.peg.77   Escherichia coli B088     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVT                           
fig|444449.5.peg.1371   Escherichia coli O157:H7 str. EC4042     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVT                           
fig|562.373.peg.3841   Escherichia coli 1125A     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVT                           
fig|701177.3.peg.668   Escherichia coli O55:H7 str. CB9615     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVT                           
fig|869671.4.peg.1809   Escherichia coli 5.0588     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVT                           
fig|155864.1.peg.2992   Escherichia coli O157:H7 EDL933     LTAAEXMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVT                           
fig|1182689.3.peg.539   Escherichia coli KTE83     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVTV                          
fig|656379.3.peg.1044   Escherichia coli FVEC1302     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVTV                          
fig|656380.3.peg.801   Escherichia coli FVEC1412     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVTV                          
fig|1005550.3.peg.2939   Escherichia coli EC1865     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVTV                          
fig|573235.3.peg.590   Escherichia coli O26:H11 str. 11368     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVTV                          
fig|340185.3.peg.3960   Escherichia coli E22     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAVVT                           
fig|869679.4.peg.5143   Escherichia coli 3.2608     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAVVT                           
fig|1125652.3.peg.2668   Escherichia coli 179100     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAVVT                           
fig|701177.3.peg.942   Escherichia coli O55:H7 str. CB9615     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAVVT                           
fig|1246623.3.peg.4414   Escherichia coli O10:K5(L):H4 str. ATCC 23506     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAVVT                           
fig|701177.3.peg.294   Escherichia coli O55:H7 str. CB9615     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAVVT                           
fig|344601.3.peg.4023   Escherichia coli B171     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAVVT                           
fig|344601.5.peg.4229   Escherichia coli B171     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAVVT                           
fig|573235.3.peg.859   Escherichia coli O26:H11 str. 11368     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAAVT                           
fig|340185.3.peg.4891   Escherichia coli E22     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAAVT                           
fig|1116107.3.peg.695   Escherichia coli 178200     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEI                                     
fig|585034.5.peg.752   Escherichia coli IAI1     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEI                                     
fig|340184.3.peg.1657   Escherichia coli B7A     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEI                                     
fig|331111.3.peg.3317   Escherichia coli E24377A     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEI                                     
fig|155864.1.peg.1661   Escherichia coli O157:H7 EDL933     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEI                                     
fig|444449.5.peg.4943   Escherichia coli O157:H7 str. EC4042     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEI                                     
fig|444450.8.peg.1667   Escherichia coli O157:H7 str. EC4115     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEI                                     
fig|1005440.3.peg.1618   Escherichia coli 99.1753     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEI                                     
fig|502346.5.peg.2683   Escherichia coli O157:H7 str. TW14588     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEI                                     
fig|562.373.peg.273   Escherichia coli 1125A     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEI                                     
fig|562.374.peg.578   Escherichia coli 536A     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEI                                     
fig|570506.3.peg.4619   Escherichia coli O157:H7 str. FRIK966     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEI                                     
fig|83334.1.peg.1656   Escherichia coli O157:H7     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEI                                     
fig|1268238.3.peg.1736   Escherichia coli O5:K4(L):H4 str. ATCC 23502     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEI                                     
fig|358709.5.peg.2014   Escherichia coli 101-1     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEI                                     
fig|331111.12.peg.1101   Escherichia coli E24377A     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEI                                     
fig|1068621.3.peg.2485   Escherichia coli O104:H4 str. 11-4632 C5     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEI                                     
fig|1240770.3.peg.2866   Escherichia coli O104:H4 str. 11-02092     LTAAEWMFDMVKTIAPSA−−−−−−−−−−RKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEI                                     
fig|454167.5.peg.2934   Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433     LTAAEWMFDLIKTISPSA−−−−−−−−−−RKPNLAGWANDIRLMRECDGRTHRDMCVLFRWACHDSFWAGNVISPAKLREKWTQLDINRNKQQTGTTASKPKLDLNNTDWIYGVEL        
fig|859197.3.peg.1958   Salmonella enterica subsp. enterica serovar Newport str. CVM 4176     LTAAEWMFDLIKTISPSA−−−−−−−−−−RKPNLAGWANDIRLMRECDGRTHRDMCVLFRWACHDSFWAGNVISPAKLREKWTQLDINRNKQQTGTTASKPKLDLNNTDWIYGVEL        
fig|789646.3.peg.1462   Salmonella enterica subsp. enterica serovar Newport str. CVM 35188     LTAAEWMFDLIKTISPSA−−−−−−−−−−RKPNLAGWANDIRLMRECDGRTHRDMCVLFRWACHDSFWAGNVISPAKLREKWTQLDINRNKQQTGTTASKPKLDLNNTDWIYGVEL        
fig|218493.5.peg.958   Salmonella bongori NCTC 12419     LTAAEWMFDLIKTISPSA−−−−−−−−−−RKPNLAGWANDIRLMRECDGRTHRDMCVLFRWACHDSFWAGNVISPAKLREKWTQLDINRNKQQTGTTASKPKLDLNNTDWIYGVEL        
fig|399742.4.peg.1038   Enterobacter sp. 638     LRCAEWLFSEVQRIAPSA−−−−−−−−−−KQPTWATWANDIRLMREKDGRSHKEIAALFKWACNDSFWQGNVLCPDKLREKWTQLEIQ                                    
fig|465517.10.peg.4027   Salmonella enterica subsp. enterica serovar Virchow str. SL491     LRCAEWMLALRNITKPSL−−−−−−−−−−KKPNMAGWANDIRLMRELDGRTHKEICELFRWACKDSFWYKNILSPAKLRAKWDTLTLHREDTTR                              
fig|290338.8.peg.1594   Citrobacter koseri ATCC BAA-895     LRCAEWMLALRDITKPSL−−−−−−−−−−KKPNMAGWANDIRLMRQLDGRTHKEICELFRWACKDSFWYKNILSPAKLRAKWDTLTLHREDTTR                              
fig|290338.6.peg.1596   Citrobacter koseri ATCC BAA-895     LRCAEWMLALRDITKPSL−−−−−−−−−−KKPNMAGWANDIRLMRQLDGRTHKEICELFRWACKDSFWYKNILSPAKLRAKWDTLTLHREDTTR                              
fig|471881.3.peg.951   Proteus penneri ATCC 35198     LKTAKWMFGRVKKLNPSA−−−−−−−−−−LEPTWYDWANDIRLMRQIDGRTHEQICALFDWANKDSFWHQNILSPRKLRKHFDELIVRSQKPKDEPKVQVDTVERDSAFSR             
fig|529507.6.peg.884   Proteus mirabilis HI4320     LKTAKWMFGRVKKLNPSA−−−−−−−−−−LEPTWYDWANDIRLMRQIDGRTHEQICALFDWANKDSFWYQNILSPRKLRKHFDELFVRSQKPKDELKVQVDTVERDSAFSR             
fig|525369.4.peg.3579   Proteus mirabilis ATCC 29906     LKTAKWMFGRVKKLNPSA−−−−−−−−−−LEPTWYDWANDIRLMRQIDGRTHEKICALFDWANKDSFWHKNILSPRKLRKHFDELTIRSQEPRNEPKVQVDTIERDSAFSR             
fig|500637.6.peg.3357   Providencia rustigianii DSM 4541     LETAQWMFKRVQVINSTQ−−−−−−−−−−KAPKWFDWANDIRLMREIDGRTHEQICALFDWASRDSFWHKNILSTKSLRKHFDTLTVKSQES                                
fig|500637.6.peg.4403   Providencia rustigianii DSM 4541     LETAQWMFKRVQVINSTQ−−−−−−−−−−KAPKWFDWANDIRLMREIDGRTHEQICALFDWASRDSFWHKNILSTKSLRKHFDTLTVKSQES                                
fig|316385.7.peg.1354   Escherichia coli str. K-12 substr. DH10B     LETAKWISSRVKLINPTC−−−−−−−−−−KAPDMTSWSNTVRLMRQIDNRSHQDICALYDWASKHHFWQTNILSPESLRKQWDKLTMQ                                    
fig|340185.3.peg.3221   Escherichia coli E22     LETAKWISSRVKLINPTC−−−−−−−−−−KAPDMTSWSNTVRLMRQIDDRSHQDICALYDWASKHHFWQTNILSPESLRKQWDKLTMQ                                    
fig|272629.3.peg.1530   Mannheimia haemolytica PHL213     MAVAKWIFKRVKQLAPQT−−−−−−−−−−KESYLPNWANEVRLMVERDKHTHQEICSLFKFATEHHFWGRNILSVVSLRAKWDRLNLERQSSLRPNNIHS                        
fig|298386.1.peg.607   Photobacterium profundum SS9     LLLAGYMFEKIIEIFPDE−−−−−−−−−−KKPNLEQWAEHIRLTRERDKRTHKEILKLFTWCNEHSFHAQNVRSPKKLRDKWADLS                                      
fig|443152.3.peg.2188   Marinobacter algicola DG893     M−−YDTLADQLGEDRP−−−−−−−−−−−−KAPNYSRWANTIRLMREQDKRELRHIRALYAWCRDHSFWTTVVQCPDKLRDKWSQLAMQRKTERRKPAAESRDDRNAELQRI             
fig|451707.4.peg.5569   Bacillus cereus NVH0597-99     MEHAQLLFKLILDTNPEH−−−−−−−−−−KEPDLEKWANEFRLIRERDEKTNEQIIYLIKWSQSNSFWKKNILSPSKLRKQWDRLVIEAKEEHEVKKNGQIRKHSGSNGRFAKEGYEKLP    
fig|527020.3.peg.1551   Bacillus thuringiensis IBL 4222                                 KEPNFEKWANEFRLIRERDKKTNQQIVYLLEWSQNHSFWKKNILSPSKLRKQWDRLVIEAKEEHEVKKNEQIRKHSGSHGRFAKEGYEKLPEPTR
fig|527032.3.peg.1714   Bacillus thuringiensis serovar andalousiensis BGSC 4AW1                                 KEPNLEKWANDFRLMREKDNRTDEQIKYLINWTQKDDFWSTNILSPAKLRKQFDALVVKIKKEKAKTQPKAVKGKKELREEDF            
fig|526974.3.peg.1013   Bacillus cereus BDRD-ST24     LENAKLLFELMLQNNPSA−−−−−−−−−−KEPNLEKWANDFRLMRERDNRTGEAIKYLINWTQKDDFWSANILSPAKLRKQFDALVVKIKKEKAKTQPKVVKGKKEVREEDF            
fig|573061.3.peg.3408   Clostridium cellulovorans 743B     LTLAKYLFKHIKNNNPKA−−−−−−−−−−KEPNLEKWAKTFKLILKKDQRNFEEVKIIIDLSQKHHFWYKNILSPEALRKQYDRLIL                                     
fig|386415.6.peg.1294   Clostridium novyi NT        AEYLYKHIKVNNPNA−−−−−−−−−−KEPNFQNWAKTFDYILRIDKRDLEEVKQLIVFCQKHSFWYKNILSADKFRKQYERLLLEKNDSKKV                             
fig|445337.5.peg.622   Clostridium botulinum C str. Eklund        AEYLYKHIKVNNPNA−−−−−−−−−−KEPNLQNWAKTFNYILRIDKRDLEEVRELIVFCQKHSFWYKNILSADKFRKQYERLLLEKNDSKKV                             
fig|393117.11.peg.1633   Listeria monocytogenes FSL J1-194     LSLANLLFEMIKSNNPEE−−−−−−−−−−KVPDVEKWAHDIRIMIEQDKRDAEKVKNAIIWSQKNDFWCGVIKSPKSLRKNYDQM                                       
fig|393130.3.peg.1550   Listeria monocytogenes J0161     LSLANLLFEMIKSNNPEE−−−−−−−−−−KVPDVEKWAHDIRIMIEQDKRDAEKVKNAIIWSQKNDFWCGVIKSPKSLRKNYDQMATQRNKPVANKPTFNKYNKQTKPEILPDWFD        
fig|267410.6.peg.1024   Listeria monocytogenes str. 4b H7858     LSLANLLFEMIKSNNPEE−−−−−−−−−−KVPDIEKWAHDIRIMIEQDKRDAEKVKNAIIWSQKNDFWCGVIKSPKSLRKNYDQM                                       
fig|393121.7.peg.3155   Listeria monocytogenes FSL J2-071     LSLANLLFELIKKNNPEE−−−−−−−−−−REHDLEKWAHDIRIMIEQDKRDAEKVKNAIIWSQKNDFWCGVIKSPKSLRKNYDQMATQRNKPVANKPTFNKYNKQTKPEILPDWFD        
fig|393125.10.peg.2701   Listeria monocytogenes FSL R2-503     LSLAKLLFEMIKENNPEE−−−−−−−−−−REPKLEKWANDIRIMIEQDNRDTEKVKNAIIWSQKNDFWCGVIKSPSSLRRNYDKM                                       
fig|565653.4.peg.1843   Enterococcus gallinarum EG2                                 KEPNLDDWANTIRLTIESDKRSGKEVQEMIVWATQHEFWGGVILSPSSLRKHYDKMKAQKENPMKKNGGQRLKSEEDYDYNKLP           
fig|350702.3.peg.14   Burkholderia cenocepacia PC184        AAWMARRLLDSDPGA−−−−−−−−−−SEPNLSAWVPDVRRMLADGFDPQQIAKLWAWALRDGFWCSVIRSPARLRKNWDQVRAKRNQSLQRERQPANQQTHDD                 
fig|333990.5.peg.874   Carnobacterium sp. AT7           LFKEIQNNNPEA−−−−−−−−−−RSPNLQTWSDDIRKMIEIDNRKPEQVTNMIHWSQSNDFWSGIILSAKKLREKYDQMKIQANKAV                               
fig|565658.4.peg.1367   Enterococcus faecium 1,231,501                    PKEM−−−−−−−−−NKVDIEKWADTIRLMEERDKASIEAIEYVINWLPTNEFWFGNIRSAKKLREKFEKLKFEIKADKNNHKKQSQKLQYSNPSEYDDLP         
fig|1134840.3.peg.2845   Enterococcus faecium S447                    PKEM−−−−−−−−−NKVDIEKWADTIRLMEERDKASIEAIEYVINWLPTNEFWFGNIRSAKKLREKFEKLKFEIKADKKNHKKQSQKLQYSNPSEYDDLP         
fig|565665.3.peg.2515   Enterococcus faecium D344SRF                    PKEM−−−−−−−−−NKVDIEKWADTIRLMEERDKASIEAIEYVINWLPTNEFWFGNIRSAKKLREKFEKLKFEIKADKKNHKKQSQKLHYSNPSEYDDLP         
fig|219305.4.peg.3128   Micromonospora sp. ATCC 39149                                 KRPTITKKWRTDARLLIDKDGRALDEIRDVIAWSQRDPFWRSNILSLPKLREKYDQLRLAMQREQPGTGLASAGQPIPSSISAADGAPLPAG    
fig|527026.3.peg.3493   Bacillus thuringiensis serovar sotto str. T04001        AKYLFELIKGNNPKQ−−−−−−−−−−KEPNFDSWANEFRLMRERDNRELQDIKDVIDWCQADAFWQGNILSPKKLREKFDQLTIQMN                                  
fig|315730.11.peg.513   Bacillus weihenstephanensis KBAB4        AKYLFGKIKGNNPKQ−−−−−−−−−−KEPNFDSWANDFRLMREKDSREPQEIKDVIDWCQADPFWQGNILSPKKLREKFDQLTIQMKSK                                
fig|527022.3.peg.2204   Bacillus thuringiensis serovar monterrey BGSC 4AJ1        AKYLFGKIKGNNPKQ−−−−−−−−−−KEPNFDSWANEFRLMRERDNREPQEIKDVIDWCQADPFWQGNILSPKKLREKFDQLTIQMNSK                                
fig|405917.4.peg.5275   Bacillus cereus W        AKYLFEKIKGNNHKQ−−−−−−−−−−KEPNFDSWANDFRLMREKDNRELQEIKDVIDWCQADPFWQGNILSPKKLREKFDQLTIQMNSK                                
fig|526985.3.peg.90   Bacillus cereus Rock3-42        AKYLFEKIKGNNPKQ−−−−−−−−−−KEPNFDSWANDFRLMREKDNRELKEIKDVIDWCQADPFWQGNILSPKKLREKFDQLTIQMNSKKGVKN                           
fig|572264.4.peg.1767   Bacillus cereus 03BB102        AKYLFEKIKGNNPKQ−−−−−−−−−−KEPNFDSWANDFRLMREKDNRESKEIKDVIDWCQADPFWQGNILSPKKLREKFDQLTIQMNSK                                
fig|520999.6.peg.584   Providencia alcalifaciens DSM 30120     LKAAQWIYSQVLIISPST−−−−−−−−−−KEPNWSSWANDVRLMRQLDGHTHQEICRLFQWANRDSFWCSVVLSPAKLRKKWATLVIQSQQLNRMKRVSGNLQPARQSIDY             
fig|520999.6.peg.1072   Providencia alcalifaciens DSM 30120     LKAAQWIYSQVLIISPTS−−−−−−−−−−KEPNWSSWANDIRLMRQLDGYSHKDICRLFQWANRDSFWCSVVLSPAKLRKKWATLVIQSQQPNRNKRVVEQEP                     
fig|520999.6.peg.2336   Providencia alcalifaciens DSM 30120     LKAAQWIYSQVLIVSPTT−−−−−−−−−−KEPNWSTWANDIRLMRQLDGHTHQDICKMFKWANKDLFWCSNVLSPAKLREKWATLVIQSQQPSRTQRASGSQQSARQSIDY             
fig|521000.6.peg.2428   Providencia rettgeri DSM 1131     LKAAQWIYSQVLIVSPTT−−−−−−−−−−KEPNWSTWANDVRLMRQLDGRTHQDICKMFKWANKDSFWCSNVLSPAKLREKWPTLVIQSQQPNRTQRVAEQAP                     
fig|351745.9.peg.2619   Shewanella sp. W3-18-1     LTCAEYIFNKVLIVNPTA−−−−−−−−−−KKPNWPDWANQVRLMRVQDNRTHHEICKLFKFANTDSFWASNVLCPKTLRKQWDKLNAKLLARSSNETTANDSAANNQRYEN             
fig|351745.7.peg.2334   Shewanella sp. W3-18-1     LTCAEYIFNKVLIVNPTA−−−−−−−−−−KKPNWPDWANQVRLMRVQDNRTHHEICKLFKFANTDSFWASNVLCPKTLRKQWDKLNAKLLARSSNETTANDSAANNQRYEN             
fig|407976.7.peg.2704   Shewanella baltica OS223     LTCAEYIFNKVLIVNPTA−−−−−−−−−−KQPNWPDWANQVRLMRVQDQRTHHEICKLFKFANTDSFWASNVLCPKTLRKQWDKLNAKLLARTSHETTANDSAAHNQRYEN             
fig|211586.1.peg.2712   Shewanella oneidensis MR-1     LKCAEYIFNKVLIVNPTA−−−−−−−−−−KQPNWPDWANQVRLMRMQDNRSHHDICKLFKFANSDSFWASNVLCPKTLRKQWDKLNAKL                                   
fig|211586.9.peg.2680   Shewanella oneidensis MR-1     LKCAEYIFNKVLIVNPTA−−−−−−−−−−KQPNWPDWANQVRLMRMQDNRSHHDICKLFKFANSDSFWASNVLCPKTLRKQWDKLNAKL                                   
fig|500638.3.peg.1641   Edwardsiella tarda ATCC 23685     LDCAGWIFQRIQIINPTA−−−−−−−−−−RQPNWTEWSNEVRLMRQLDGRSHRDICELFKVVNRDSFWCQNVLSPRKLREKWDELTVKLLNKPTGNNHASGD                      
fig|520999.6.peg.1841   Providencia alcalifaciens DSM 30120     LKCAEWLFSRKCEVFKEL−−−−−GLQEPKEPNFTEWANDVRLMVSQDGRTHKEICQFYKRVSHDEFWKKNVQCPRTLRTQWDDLTLRLAGEQKVSIDQVERDEAFTR                
fig|471881.3.peg.4132   Proteus penneri ATCC 35198     MKCAKWLFSRKCEVFQEM−−−−−GLKTPKEPNFTDWANDIRLMTTIDGHTHKEICQFYKRITQDDFWKKNVQCPRTLRAQWDDLTLRLAGKKKITIDSVERDETF                  
fig|667129.3.peg.1910   Serratia odorifera DSM 4582     LKCAEWIWGRIIGMYEQAAEYDGEVSRPKEPNWVVWSNEVRLMCAQDGKSHKQICQLFGRANRDKFWCRNVLSPSKLRERWDDLVIKLAPAVAAASEE                         
fig|634503.3.peg.2038   Edwardsiella ictaluri 93-146     LTCAEWIWGRILRLHEQAAEYDGEMVRPKAPNWIAWANEVRLMCELDGRTHRQICELFGRVNRDPFWCRNVLSPAKLREKWDELVIRL                                   
fig|585035.6.peg.2853   Escherichia coli S88     LTCAQWLWKKIIALYEQAAECDGEVVRPKEPNWTAWANEIRLMCVQDGRTHKQICEMYSRVSRDPFWCRNVLSPSKLREKWDELSLRLSPSVSTYTEKREDPYFKASYDNVDYSQIPAGFRG
fig|714962.3.peg.3055   Escherichia coli IHE3034     LTCAQWLWKKIIALYEQAAECDGEVVRPKEPNWTAWANEIRLMCVQDGRTHKQICEMYSRVSRDPFWCRNVLSPSKLREKWDELSLRLSPSVSTYTEKREDPYFKASYDNVDYSQIPAGFRG
fig|199310.1.peg.3117   Escherichia coli CFT073     LTCAQWLWKKIIALYEQAAECDGEVVRPKEPNWTAWANEIRLMCVQDGRTHKQICEMYSRVSRDPFWCRNVLSPSKLREKWDELSLRLSPSVSTYTEKREDPYFKASYDNVDYSQIPAGFRG
fig|1182687.3.peg.4549   Escherichia coli KTE80     LTCAQWLWKKIIALYEQAAECDGEVVRPKEPNWTAWANEIRLMCVQDGRTHKQICEMYSRVSRDPFWCRNVLSPSKLREKWDELSLRLSPSVSTYTEKREDPYFKASYDNVDYSQIPAGFRG
fig|656379.3.peg.1566   Escherichia coli FVEC1302                             MVRPKEPNWTAWANEIRLMCVQDGRTHKQICEMYNRVSRDPFWCRNVLSPSKLREKWDELSLRLSPSVSTYTEKREDPYFKASYDNVDYSQIPAGFRG
fig|656380.3.peg.1392   Escherichia coli FVEC1412                             MVRPKEPNWTAWANEIRLMCVQDGRTHKQICEMYNRVSRDPFWCRNVLSPSKLREKWDELSLRLSPSVSTYTEKREDPYFKASYDNVDYSQIPAGFRG
fig|1182689.3.peg.815   Escherichia coli KTE83     LTCAQWLWKKIIALYEQAAECDGEVVRPKEPNWTAWANEIRLMCVQDGRTHKQICEMYNRVSRDPFWCRNVLSPSKLREKWDELSLRLSPSVSTYTEKREDPYFKASYDNVDYSQIPAGFRG
fig|316385.7.peg.2545   Escherichia coli str. K-12 substr. DH10B     MTCAQWLWKKIIALYEQAAECDGEVVRPKEPNWTAWANEIRLMCVQDGRTHKQICEMYSRVSRDPFWCRNVLSPSKLREKWDELSLRLSPSVSTYTEKREDPYFKASYDNVDYSQIPAGFRG
fig|714962.3.peg.539   Escherichia coli IHE3034     LTCAQWLWKKIIALYEHAAECDGEVVRPKEPNWTAWANEIRLMCVQDGRTHKQICEMYSRVSRDPFWCRNVLSPSKLREKWDELSLRLSPSVSTYTEKREDPYFKASYDNVDYSQIPAGFRG
fig|344601.5.peg.5366   Escherichia coli B171     LTCAQWLWKKIIALYEHAAECDGEVVRPKEPNWTAWANEIRLMCVQDGRTHKQICEMYSRVSRDPFWCRNVLSPSKLREKWDELSLRLSPSVSTYTEKREDPYFKASYDNVDYSQIPAGFRG
fig|570506.3.peg.1751   Escherichia coli O157:H7 str. FRIK966     LTCAQWLWKKIIALYEHAAECDGEVVRPKEPNWTAWANEIRLMCVQDGRTHKQICEMYSRVSRDPFWCRNVLSPSKLREKWDELSLRLSPSVSTYTEKREDPYFKASYDNVDYSQIPAGFRG
fig|550672.3.peg.1424   Escherichia coli B088     LTCAQWLWKKIIALYEHAAECDGEVVRPKEPNWTAWANEIRLMCVQDGRTHKQICEMYSRVSRDPFWCRNVLSPSKLREKWDELSLRLSPSVSTYTEKREDPYFKASYDNVDYSQIPAGFRG
fig|562.374.peg.1382   Escherichia coli 536A     LTCAQWLWKKIIALYEHAAECDGEVVRPKEPNWTAWANEIRLMCVQDGRTHKQICEMYSRVSRDPFWCRNVLSPSKLREKWDELSLRLSPSVSTYTEKREDPYFKASYDNVDYSQIPAGFRG
fig|1169374.3.peg.462   Escherichia coli KTE106     LTCAQWLWKKIIALYEHAAECDGEVVRPKEPNWTAWANEIRLMCVQDGRTHKQICEMYSRVSRDPFWCRNVLSPSKLREKWDELSLRLSPSVSTYTEKREDPYFKASYDNVDYSQIPAGFRG
fig|344601.3.peg.5037   Escherichia coli B171     LTCAQWLWKKIIALYEHAAECDGEVVRPKEPNWTAWANEIRLMCVQDGRTHKQICEMYSRVSRDPFWCRNVLSPSKLREKWDELSLRLSPSVSTYTEKREDPYFKASYDNVDYSQIPAGFRG
fig|570506.3.peg.2741   Escherichia coli O157:H7 str. FRIK966     LTCAQWLWKKIIALYEQAAECDGEVVRPKEPNWTAWANEIRLMCVQDGRTHKQICEMYCRVSRDPFWCRNVLSPSKLREKWDELSLRLSPSVSTYTEKREDPYFKSSYDNVDYSQIPAGFRG
fig|869679.4.peg.4871   Escherichia coli 3.2608     LTCAQWLWKKIIALYEQAAECDGEVVRPKEPNWTAWANEIRLMCVQDGRTHKQICEMYSRVSRDPFWCRNVLSPSKLREKWDELSLRLSPSVSTYTEKREDPYFKSSYDNVDYSQIPAGFRG
fig|585054.5.peg.560   Escherichia fergusonii ATCC 35469     LTCAQWLWKKIIALYEQAAECDGEVVRPKEPNWTAWANEIRLMCVQDGRTHKQICEMYSRVSRDPFWCRNVLSPSKLREKWDELSLRLSPSVSTYTEKREDPYFKSSYDNVDYSQIPAGFRG
fig|556266.3.peg.2457   Shigella sp. D9     LTCAQWLWKKIIALYEQAAECDGEVVRPKEPNWTAWANEIRLMCVQDGRTHKQICEMYSRVSRDPFWCRNVLSPSKLREKWDELSLRLSPSVSTHTEKREDPYFKSSYDNVDYSQIPAGFRG
fig|701177.3.peg.5197   Escherichia coli O55:H7 str. CB9615     LTCAQWLWKKIIALYEQAAECDGEVVRPKEPNWTAWANEIRLMCVQDGRTHKQICEMYSRVSRDPFWCRNVLSPSKLREKWDELSLRLSPSVSTHTEKREDPYFKASYDNVDYSQIPAGFRG
fig|585054.5.peg.4254   Escherichia fergusonii ATCC 35469     LTCAQWLWKKIIALYEQAAECDGEVVRPKEPNWTAWANEIRLMCVQDGRTHKQICEMYSRVSRDPFWCRNVLSPSKLREKWDELSLRLSPSVSTHTEKREDPYFKASYDNVDYSQIPAGFRG
fig|454167.5.peg.4095   Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433     LTCAQWIWKKIIALYEQAAESDGELVRPKEPNWTVWANEIRLMCAQDGRTHKQICEMYSRVSRDPFWCRNILSPSKLREKWDELSLRLSAPIGGRFENREDPMFKSSYGNVDYSQIPTGFRG
fig|465518.5.peg.4009   Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537     LTCAQWIWKKIIALYEQAAESDGELVRPKEPNWTVWANEIRLMCAQDGRTHKQICEMYSRVSRDPFWCRNILSPSKLREKWDELSLRLSAPIGGRFENREDPMFKSSYGNVDYSQIPTGFRG
fig|716541.4.peg.1880   Enterobacter cloacae subsp. cloacae ATCC 13047     LTCAQWMWNRIVKLYEKAAETDGELVRPKEPNWTAWSNEIRLMCAVDGRTHKQICEMFSRVQRDPFWCRNVMSPSKLREKWDDLILRLPSTGVVQNQAGGRDINRISRP−−−−DSSVPPGFRG
fig|469008.4.peg.2136   Escherichia coli BL21(DE3)     LACAQWIWGRIVGLYEQAASDDGEIMRPKEPNWTAWANDVRTMRMLDGRSHRQICEMFGRVQRDPFWVKNIMSPSKLREKWDELVIRLGRSPVQRCVNHISEP−−−−−−−−−−DTEIPPGFRG
fig|216592.1.peg.2149   Escherichia coli 042     LACAQWIWGRIVGLYEQAASDDGEIMRPKEPNWTAWANDVRTMRMLDGRSHRQICEMFGRVQRDPFWVKNIMSPSKLREKWDELVIRLGRSPVQRCVNHISEP−−−−−−−−−−DTEIPPGFRG
fig|1246623.3.peg.4422   Escherichia coli O10:K5(L):H4 str. ATCC 23506     LACAQWIWGRIVGLYEQAASDDGEIMRPKEPNWTAWANDVRTMRMLDGRSHRQICEMFGRVQRDPFWVKNIMSPSKLREKWDELVIRLGRSPVQRCVNHISEP−−−−−−−−−−DTEIPPGFRG
fig|358709.5.peg.1089   Escherichia coli 101-1     LACAQWIWGRIVGLYEQAASDDGEIMRPKEPNWTAWANDVRTMRMLDGRSHRQICEMFGRVQRDPFWVKNIMSPSKLREKWDELVIRLGRSPVQRCVNHISEP−−−−−−−−−−DTEIPPGFRG
fig|585034.5.peg.1596   Escherichia coli IAI1     LACAQWIWGRIVGLYEQAASDDGEIMRPKEPNWTAWANDVRTMRMLDGRSHRQICEMFGRVQRDPFWVKNIMSPSKLREKWDELVIRLGRSPVQRCVNHISEP−−−−−−−−−−DTEIPPGFRG
fig|1182687.3.peg.1711   Escherichia coli KTE80     LACAQWIWGRIVGLYEQAASDDGEIMRPKEPNWTVWANDVRTMRMLDGRSHRQICEMFGRVQRDPFWVKNIMSPSKLREKWDELVIRLGRSPVQRCVNHISEP−−−−−−−−−−DTEIPPGFRG
fig|1182689.3.peg.1848   Escherichia coli KTE83     LACAQWIWGRIVGLYEQAASDDGEIMRPKEPNWTVWANDVRTMRMLDGRSHRQICEMFGRVQRDPFWVKNIMSPSKLREKWDELVIRLGRSPVQRCVNHISEP−−−−−−−−−−DTEIPPGFRG
fig|1258580.3.peg.3388   Escherichia coli LCT-EC59     LACAQWIWGRIVGLYEQAASDDGEIMRPKEPNWTVWANDVRTMRMLDGRSHRQICEMFGRVQRDPFWVKNIMSPSKLREKWDELVIRLGRSPVQRCVNHISEP−−−−−−−−−−DTEIPPGFRG
fig|656379.3.peg.2035   Escherichia coli FVEC1302     LACAQWIWGRIVGLYEQAASDDGEIMRPKEPNWTVWANDVRTMRMLDGRSHRQICEMFGRVQRDPFWVKNIMSPSKLREKWDELVIRLGRSPVQRCVNHISEP−−−−−−−−−−DTEIPPGFRG
fig|656380.3.peg.2998   Escherichia coli FVEC1412     LACAQWIWGRIVGLYEQAASDDGEIMRPKEPNWTVWANDVRTMRMLDGRSHRQICEMFGRVQRDPFWVKNIMSPSKLREKWDELVIRLGRSPVQRCVNHISEP−−−−−−−−−−DTEIPPGFRG
fig|701177.3.peg.2488   Escherichia coli O55:H7 str. CB9615     LACAQWIWGRIVGLYEQAASDDGEIMRPKEPNWTAWANDVRTMRMLDGRSHRQICEMFGRVQRDPFWVKNIMSPSKLREKWDELVIRLGRSSIQRCVNHISEP−−−−−−−−−−DTEIPPGFRG
fig|331111.12.peg.2063   Escherichia coli E24377A     LACAQWIWGRIVGLYEQAASDDGEIMRPKEPNWTAWANDVRTMRMLDGRSHRQICEMFGRVQRDPFWVKNIMSPSKLREKWDELVIRLGRSPIKRCVNHISEP−−−−−−−−−−DTEIPPGFRG
fig|331111.3.peg.4210   Escherichia coli E24377A     LACAQWIWGRIVGLYEQAASDDGEIMRPKEPNWTAWANDVRTMRMLDGRSHRQICEMFGRVQRDPFWVKNIMSPSKLREKWDELVIRLGRSPIKRCVNHISEP−−−−−−−−−−DTEIPPGFRG
fig|573235.3.peg.2240   Escherichia coli O26:H11 str. 11368     LACAQWIWGRIVNLYEQAASDDGEIMRPKEPNWTAWANDVRTMRMLDGRSHRQICEMFGRVQRDQFWVKNIMSPSKLREKWDELVIRLGRSPVQRCVNHISEP−−−−−−−−−−DTEIPPGFRG
fig|502347.3.peg.3249   Escherichia albertii TW07627     LACAQWIWGRIVSLYEQAASDDGEITRPKEPNWTAWANDVRTMRMLDGRSHRQICEMFGRVQRDPFWVKNIMSPLKLREKWDDLVIRLGRSPVQCCVNHISEP−−−−−−−−−−DTEIPPGFRG
fig|344610.3.peg.4953   Escherichia coli 53638     LACAQWFWGRIVSLYEQAASDDGEISRPKEPNWTAWANDVRTMRMLDGRTHRQICEMFGRVQRDPFWVKNVMSPSKLREKWDELVIRLGRSPVQRCVNHISEP−−−−−−−−−−DTEIPPGFRG
fig|358709.5.peg.2808   Escherichia coli 101-1                                                MRMLDGRTHRQICEMFGRXQRDPFWVKNIMSPSKLRGKWDELVIRLGRSSVQRCVNHISEP−−−−−−−−−−DTEIPPXFRG
fig|701177.3.peg.1961   Escherichia coli O55:H7 str. CB9615     LACAQWIWGRIVSLYEQAASDDGEISRPKEPNWTAWANDVRTMRMLDGRTHRQICEMFGRVQRDPFWVKNIMSPSKLREKWDELVIRLGRSSVQRCVNHISEP−−−−−−−−−−DTEIPPGFRG
fig|331111.12.peg.1550   Escherichia coli E24377A     LACAQWIWGRIVSLYEQAASDDGEISRPKEPNWTAWANDVRTMRMLDGRTHRQICEMFGRVQRDPFWVKNIMSPSKLREKWDELVIRLGRSSVQRCVNHISEP−−−−−−−−−−DTEIPPGFRG
fig|331111.3.peg.3733   Escherichia coli E24377A     LACAQWIWGRIVSLYEQAASDDGEISRPKEPNWTAWANDVRTMRMLDGRTHRQICEMFGRVQRDPFWVKNIMSPSKLREKWDELVIRLGRSSVQRCVNHISEP−−−−−−−−−−DTEIPPGFRG
fig|344601.3.peg.4995   Escherichia coli B171     LACAQWIWGRIVSLYEQAASDDGEISRPKEPNWTAWANDVRTMRMLDGRTHRQICEMFGRVQRDPFWVKNIMSPSKLREKWDELVIRLGRSSVQRCVNHISEP−−−−−−−−−−DTEIPPGFRG
fig|344601.5.peg.5316   Escherichia coli B171     LACAQWIWGRIVSLYEQAASDDGEISRPKEPNWTAWANDVRTMRMLDGRTHRQICEMFGRVQRDPFWVKNIMSPSKLREKWDELVIRLGRSSVQRCVNHISEP−−−−−−−−−−DTEIPPGFRG
fig|1005550.3.peg.1853   Escherichia coli EC1865     LTCAQWIWGRVVNLYEQAASDDGEITRPKEPNWTAWANDVRTMRMLDGRSHRQICEMFSRAQRDPFWIKNIKSPEKLREKWDELVIRLWRGPAQRCVNHISEP−−−−−−−−−−DTEIPPGFRG
fig|573235.3.peg.2308   Escherichia coli O26:H11 str. 11368     LTCAQWIWGRVVNLYEQAASDDGEITRPKEPNWTAWANDVRTMRMLDGRSHRQICEMFSRAQRDPFWIKNIKSPEKLREKWDELVIRLWRGPAQRCVNHISEP−−−−−−−−−−DTEIPPGFRG
fig|869671.4.peg.4874   Escherichia coli 5.0588     LTCAQWIWGRVVNLYEQAASDDGEITRPKEPNWTAWANDVRTMRMLDGRSHRQICEMFSRAQRDPFWIKNIKSPEKLREKWDELVIRLWRGPAQRCVNHISEP−−−−−−−−−−DTEIPPGFRG
fig|502346.5.peg.5603   Escherichia coli O157:H7 str. TW14588     LTCAQWIWGRVVALYEQAASDDGEVSRPREPNWTTWANDVRMMRMLDGRSHRQICEMFGRVQRDSFWVKNIMSPAKLREKWDELVIRLGRSPAQRCVNHISEP−−−−−−−−−−DTEIPPGFRG
fig|570506.3.peg.495   Escherichia coli O157:H7 str. FRIK966     LTCAQWIWGRVVALYEQAASDDGEVSRPREPNWTTWANDVRMMRMLDGRSHRQICEMFGRVQRDSFWVKNIMSPAKLREKWDELVIRLGRSPAQRCVNHISEP−−−−−−−−−−DTEIPPGFRG
fig|216593.1.peg.1834   Escherichia coli E2348/69     LVCAQWIWGRIVSLYEQAASYDGEITRPKEPNWTAWANDVRTMRMLDGRTHRQICEMFGRLQRDSFWVKNIMSPAKLREKWDELVIRLGRSPAQRCVNHISEP−−−−−−−−−−DTEIPPGFRG
fig|1258580.3.peg.4790   Escherichia coli LCT-EC59     LVCAQWIWGRIVSLYEQAASYDGEITRPKEPNWTAWANDVRTMRMLDGRTHRQICEMFGRLQRDSFWVKNIMSPAKLREKWDELVIRLGRSPAQRCVNHISEP−−−−−−−−−−DTEIPPGFRG
fig|457401.3.peg.781   Escherichia sp. 4_1_40B     LVCAQWIWGRIVSLYEQAASYDGEITRPKEPNWTAWANDVRTMRMLDGRTHRQICEMFGRLQRDSFWVKNIMSPAKLREKWDELVIRLGRSPAQRCVNHISEP−−−−−−−−−−DTEIPPGFRG
fig|1182689.3.peg.2309   Escherichia coli KTE83     LVCAQWIWGRIVSLYEQAASYDGEITRPKEPNWTAWANDVRTMRMLDGRTHRQICEMFGRLQRDSFWVKNIMSPAKLREKWDELVIRLGRSPAQRCVNHISEP−−−−−−−−−−DTEIPPGFRG
fig|344609.3.peg.1019   Shigella boydii BS512     LVCAQWIWGRIVSLYEQAASYDGEITRPKEPNWTAWANDVRTMRMLDGRTHRQICEMFGRLQRDSFWVKNIMSPAKLREKWDELVIRLGRSPAQRCVNHISEP−−−−−−−−−−DTEIPPGFRG
fig|574521.7.peg.1425   Escherichia coli O127:H6 str. E2348/69     LVCAQWIWGRIVSLYEQAASYDGEITRPKEPNWTAWANDVRTMRMLDGRTHRQICEMFGRLQRDSFWVKNIMSPAKLREKWDELVIRLGRSPAQRCVNHISEP−−−−−−−−−−DTEIPPGFRG
fig|216592.1.peg.5560   Escherichia coli 042     LVCAQWIWGRIVSLYEQAASDDGEITRPKEPNWTAWANDVRTMRMLDGRTHRQICEMFGRLQRDSFWVKNIMSPAKLREKWDELVIRLGRSPAQRCVNHISEP−−−−−−−−−−DTEIPPGFRG
fig|83334.1.peg.2304   Escherichia coli O157:H7     LVCAQWIWGRIVSLYEQAASDDGEITRPKEPNWTAWANDVRTMRMLDGRTHRQICEMFGRLQRDSFWVKNIMSPAKLREKWDELVIRLGRSPAQRCVNHISEP−−−−−−−−−−DTEIPPGFRG
fig|1005440.3.peg.1571   Escherichia coli 99.1753     LVCAQWIWGRIVSLYEQAASDDGEITRPKEPNWTAWANDVRTMRMLDGRTHRQICEMFGRLQRDSFWVKNIMSPAKLREKWDELVIRLGRSPAQRCVNHISEP−−−−−−−−−−DTEIPPGFRG
fig|1005470.3.peg.2289   Escherichia coli FDA504     LVCAQWIWGRIVSLYEQAASDDGEITRPKEPNWTAWANDVRTMRMLDGRTHRQICEMFGRLQRDSFWVKNIMSPAKLREKWDELVIRLGRSPAQRCVNHISEP−−−−−−−−−−DTEIPPGFRG
fig|444450.8.peg.2315   Escherichia coli O157:H7 str. EC4115     LVCAQWIWGRIVSLYEQAASDDGEITRPKEPNWTAWANDVRTMRMLDGRTHRQICEMFGRLQRDSFWVKNIMSPAKLREKWDELVIRLGRSPAQRCVNHISEP−−−−−−−−−−DTEIPPGFRG
fig|502346.5.peg.5128   Escherichia coli O157:H7 str. TW14588     LVCAQWIWGRIVSLYEQAASDDGEITRPKEPNWTAWANDVRTMRMLDGRTHRQICEMFGRLQRDSFWVKNIMSPAKLREKWDELVIRLGRSPAQRCVNHISEP−−−−−−−−−−DTEIPPGFRG
fig|1068621.3.peg.3199   Escherichia coli O104:H4 str. 11-4632 C5     LVCAQWIWGRIVSLYEQAASDDGEITRPKEPNWTAWANDVRTMRMLDGRTHRQICEMFGRLQRDSFWVKNIMSPAKLREKWDELVIRLGRSPAQRCVNHISEP−−−−−−−−−−DTEIPPGFRG
fig|1125652.3.peg.2720   Escherichia coli 179100     LVCAQWIWGRIVSLYEQAASDDGEITRPKEPNWTAWANDVRTMRMLDGRTHRQICEMFGRLQRDSFWVKNIMSPAKLREKWDELVIRLGRSPAQRCVNHISEP−−−−−−−−−−DTEIPPGFRG
fig|1181762.3.peg.1552   Escherichia coli KTE216     LVCAQWIWGRIVSLYEQAASDDGEITRPKEPNWTAWANDVRTMRMLDGRTHRQICEMFGRLQRDSFWVKNIMSPAKLREKWDELVIRLGRSPAQRCVNHISEP−−−−−−−−−−DTEIPPGFRG
fig|1240770.3.peg.315   Escherichia coli O104:H4 str. 11-02092     LVCAQWIWGRIVSLYEQAASDDGEITRPKEPNWTAWANDVRTMRMLDGRTHRQICEMFGRLQRDSFWVKNIMSPAKLREKWDELVIRLGRSPAQRCVNHISEP−−−−−−−−−−DTEIPPGFRG
fig|344601.5.peg.5301   Escherichia coli B171     LVCAQWIWGRIVSLYEQAASDDGEITRPKEPNWTAWANDVRTMRMLDGRTHRQICEMFGRLQRDSFWVKNIMSPAKLREKWDELVIRLGRSPAQRCVNHISEP−−−−−−−−−−DTEIPPGFRG
fig|869679.4.peg.181   Escherichia coli 3.2608     LVCAQWIWGRIVSLYEQAASDDGEITRPKEPNWTAWANDVRTMRMLDGRTHRQICEMFGRLQRDSFWVKNIMSPAKLREKWDELVIRLGRSPAQRCVNHISEP−−−−−−−−−−DTEIPPGFRG
fig|570506.3.peg.3894   Escherichia coli O157:H7 str. FRIK966     LVCAQWIWGRIVSLYEQAASDDGEITRPKEPNWTAWANDVRTMRMLDGRTHRQICEMFGRLQRDSFWVKNIMSPAKLREKWDELVIRLGRSPAQRCVNHISEP−−−−−−−−−−DTEIPPGFRG
fig|444449.5.peg.495   Escherichia coli O157:H7 str. EC4042     LVCAQWIWGRIVSLYEQAASDDGEITRPKEPNWTAWANDVRTMRMLDGRTHRQICEMFGRLQRDSFWVKNIMSPAKLREKWDELVIRLGRSPAQRCVNHISEP−−−−−−−−−−DTEIPPGFRG
fig|585397.7.peg.1017   Escherichia coli ED1a     LVCAQWIWGRIVSLYEQAASDDGEITRPKEPNWTAWANDVRTMRMLDGRTHRQICEMFGRLQRDSFWVKNIMSPAKLREKWDELVIRLGRSPAQRCVNHISEP−−−−−−−−−−DTEIPPGFRG
fig|1005550.3.peg.2199   Escherichia coli EC1865     LVCAQWIWGRIVSLYEQAASDDGEITRPKEPNWTAWANDVRTMRMLDGRTHRQICEMFGRLQRDSFWVKNIMSPAKLREKWDELVIRLGRSPAQRCVNHISEP−−−−−−−−−−DTEIPPGFRG
fig|573235.3.peg.2704   Escherichia coli O26:H11 str. 11368     LVCAQWIWGRIVSLYEQAASDDGEITRPKEPNWTAWANDVRTMRMLDGRTHRQICEMFGRLQRDSFWVKNIMSPAKLREKWDELVIRLGRSPAQRCVNHISEP−−−−−−−−−−DTEIPPGFRG
fig|344601.3.peg.4980   Escherichia coli B171     LVCAQWIWGRIVSLYEQAASDDGEITRPKEPNWTAWANDVRTMRMLDGRTHRQICEMFGRLQRDSFWVKNIMSPAKLREKWDELVIRLGRSPAQRCVNHISEP−−−−−−−−−−DTEIPPGFRG
fig|562.373.peg.5312   Escherichia coli 1125A     LVCAQWIWGRIVSLYEQAASDDGEITRPKEPNWTAWANDVRTMRMLDGRTHRQICEMFGRLQRDSFWVKNIMSPAKLREKWDELVIRLGR