(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00001743

fig|63737.11.peg.139   Nostoc punctiforme PCC 73102      QLDLRGTPCPINFVRTKLRLEKMPLGG−−LLEVWLDPGEPIEQVP                     
fig|63737.4.peg.128   Nostoc punctiforme PCC 73102      QLDLRGTPCPINFVRTKLRLEKMPLGG−−LLEVWLDPGEPIEQVP                     
fig|103690.10.peg.3010   Nostoc sp. PCC 7120      QLDLRGTPCPINFVRTKLRLEKMPPGA−−LLEVWLDPGEPIEQVPDSLTMAGYQV          
fig|240292.3.peg.1059   Anabaena variabilis ATCC 29413      QLDLRGTPCPLNFVRTKLRLEKMPPGA−−LLEVWLDPGEPIEQVPDSLTMAGYQV          
fig|313624.3.peg.4377   Nodularia spumigena CCY9414      QLDLRGTPCPINFVRTKLCLEKMLPGS−−LLEVWLDSGEPIEQVPDSLTMAGYQV          
fig|203124.6.peg.2222   Trichodesmium erythraeum IMS101      QIDLRGTPCPINFVRTKLYLEKMMPGE−−ILEVWLDSGEPIEQVP                     
fig|65393.5.peg.588   Cyanothece sp PCC 7424       LDLRGTPCPINFVRTKLKLEQMPPDV−−VLEVWLDPGEPIEQVPE                    
fig|497965.5.peg.1224   Cyanothece sp. PCC 7822       LDLRGTPCPINFVRTKLKLEKMPPGT−−LLEVWLDPGEPIEQVPESLTMEGYH           
fig|269084.3.peg.2087   Synechococcus elongatus PCC 6301      RLDLRGIVCPINFVRTKLKLEQMPAGS−−LLEVWLDAGEPVEQVPDSLRLEGYEV          
fig|551115.6.peg.2617   Trichormus azollae 0708      QLDLRGTPCPINFVRTKLRLEQMPNGG−−LLEVWLDAGEPIEQVP                     
fig|533240.4.peg.796   Cylindrospermopsis raciborskii CS-505      QLDLRGTPCPINFVRTKLRLEQMSDGS−−LLEVWLDPGEPIEQVP                     
fig|533247.5.peg.2634   Raphidiopsis brookii D9      QLDLRGTPCPINFVRTKLRLEQMSDGS−−LLEVWLDPGEPIEQVP                     
fig|391612.5.peg.611   Cyanothece sp. CCY0110       LDLRGTPCPINFVRTKLKLEQMSPGS−−LLEVWLDPGEPIEQVPDSLTMEGYQV          
fig|860575.3.peg.1165   Cyanothece sp. ATCC 51472       LDLRGTPCPINFVRTKLKLEQMSPGS−−LLEVWLDPGEPIEQVPDSLTMEGYQV          
fig|395961.4.peg.4637   Cyanothece sp PCC 7425        DLRGTPCPINFVRTKLRLEQMAPGA−−LLEVWLDPGEPVEQVP                     
fig|313612.3.peg.1851   Lyngbya sp. PCC 8106      QMDLRGTPCPLNFVRTKLKLEQMAPGS−−LLEVWLDSGEPIEQVP                     
fig|91464.3.peg.1686   Synechococcus sp. PCC 7335     HRIDLRGTPCPLNFVRTKLTLEKMEPGS−−LLEVWLDPGEPIEQVPDSLRMDGYGV          
fig|329726.14.peg.350   Acaryochloris marina MBIC11017      QIDLRGTPCPLNFVRTKLHLQKMAPGS−−LLEVWLDPGEPIEQVPDSLKMAGYTI          
fig|118168.3.peg.4659   Microcoleus chthonoplastes PCC 7420      QLDLRGTPCPINFVRTKLRLEQMTPGS−−LLEVWLDPGEPIEQVP                     
fig|376219.3.peg.4582   Arthrospira sp. PCC 8005      KLDLRGTPCPINFVRTKLRLQQMTPGT−−LLEVWLDGGEPIEQVP                     
fig|1235808.3.peg.4721   Microcystis aeruginosa DIANCHI905      TLDLRGTPCPINFVRTKLQLEKMTAGE−−RLEVWLDAGEPIEQVP                     
fig|449447.4.peg.4500   Microcystis aeruginosa NIES-843      TLDLRGTPCPINFVRTKLQLEKMTAGE−−RLEVWLDAGEPIEQVP                     
fig|321332.10.peg.2940   Synechococcus sp. JA-2-3B'a(2-13)       LDQRGIPCPLNYVRAKLRLERMAPGE−−LLELWLDAGEPLEQVPNSLAMAGHRI          
fig|321327.21.peg.779   Synechococcus sp. JA-3-3Ab      VLDQRGIPCPLNYVRAKLRLERMAPGE−−VLELWLDAGEPLEQVPKSLTMAGH            
fig|41431.8.peg.3371   Cyanothece sp. PCC 8801       LDLRGTPCPINFVRTKLKLEQMSPGE−−LLEVWLDGGEPIEQVP                     
fig|395962.4.peg.3034   Cyanothece sp. PCC 8802       LDLRGTPCPINFVRTKLKLEQMSPGE−−LLEVWLDGGEPIEQVP                     
fig|41431.3.peg.3351   Cyanothece sp PCC 8801       LDLRGTPCPINFVRTKLKLEQMSPGE−−LLEVWLDGGEPIEQVP                     
fig|1148.72.peg.4955   Bacillus subtilis BEST7613       LDLRGTPCPINFVRTKLKLAQMAPGQ−−CLEVWLDEGEPVEQVPHSLE                 
fig|221359.3.peg.2264   Synechococcus sp. RS9916     QRLDLRGTPCPVNFIRCKLTLETMASGE−−VLSVTLDRGEPEAMVVPGLEQDGHRV          
fig|293826.4.peg.55   Alkaliphilus metalliredigens QYMF       VDLKGVKCPMNFVKAKVALGKIASGE−−EIGFYLDDDAPINNVPKSVEGEGHQIV         
fig|293826.6.peg.57   Alkaliphilus metalliredigens QYMF       VDLKGVKCPMNFVKAKVALGKIASGE−−EIGFYLDDDAPINNVPKSVEGEGHQIV         
fig|457570.14.peg.1126   Natranaerobius thermophilus JW/NM-WN-LF      VVDLRGVKCPMNFVKVKMALSSLQNGE−−IQAFYLDNGEPMDNVPQSVRDEGH            
fig|511995.9.peg.481   Azobacteroides pseudotrichonymphae genomovar. CFP2        DLRGVICPMNFVQVKIQLASMQSGE−−KLEIWLDDSHL−−−SVIISIQNEGHQIL         
fig|273121.8.peg.949   Wolinella succinogenes DSM 1740        DYQGVACPMNFVKTKMDLAQMQSGE−−ILEILLDEGAPIENVPKSVANEGHLIL         
fig|59374.5.peg.524   Fibrobacter succinogenes subsp. succinogenes S85       LDLRGVKCPLNSVRSRIVMSGYPAGR−−TLKIWLDEGSPIENVPGSLIADGHKVL         
fig|589865.4.peg.881   Desulfurivibrio alkaliphilus AHT2        NLRGVNCPMNLVYTKVAMKDIQPGE−−ILEIILDEGPPINNVPGSVKKEGHEVL         
fig|314345.3.peg.957   Mariprofundus ferrooxydans PV-1      ELDLSGVACPMNFVKTKIKLSTMPVGA−−QLAVILDDGAPINNVPLSLEEQGQKIL         
fig|123214.3.peg.561   Persephonella marina EX-H1       LDLRGVECPFNYVKAKMKLKEMDTGS−−ILVLTIDGEESIRSVPQSIRDDGHEII         
fig|313628.3.peg.4457   Lentisphaera araneosa HTCC2155       LDLRGIECPMNYVKAKLVLNGLEDGK−−ELAMIIDTGDSFRQVPSSLKKDGHTVV         
fig|404380.3.peg.1950   Geobacter bemidjiensis Bem     ETIDLRGVSCPTNFVKAKLELEDIEAGT−−TVEFLLDDGEPVKNVPRSLKDEGHKLL         
fig|443144.3.peg.2190   Geobacter sp. M21     ETIDLRGVSCPTNFVKAKLELEDIEAGT−−TVEFLLDDGEPVKNVPRSLKDEGHKLL         
fig|443143.4.peg.2237   Geobacter sp. M18     QTIDLRGVTCPTNFVMAKLELEEIEAGT−−CVEFLLDDGEPVKNVPRSLKDEGHKLL         
fig|269799.3.peg.1410   Geobacter metallireducens GS-15      TIDLRGVTCPTNFVKAKLALEMVDTGE−−VVEFLLDDGEPVKNVPRSLKGEGHKLV         
fig|691164.3.peg.115   Geobacter metallireducens RCH3      TIDLRGVTCPTNFVKAKLALEMVDTGE−−VVEFLLDDGEPVKNVPRSLKGEGHKLV         
fig|243231.5.peg.1349   Geobacter sulfurreducens PCA      TVDLRGVTCPTNFVKAKLALETVDTGA−−VVEFLLDDGEPVKNVPRSLKGEGHKLL         
fig|316067.3.peg.814   Geobacter sp. FRC-32     QTVDLRGVSCPTNFVKAKLALEMLDEGE−−TVEFLLDDGEPVKNVPRSLKGEGHKLL         
fig|351605.4.peg.3862   Geobacter uraniireducens Rf4     HTVDLRGVSCPTNFVKAKLALEMLDEGE−−VVEFLLDDGEPVKNVPRSLKGEGHKLI         
fig|521011.3.peg.1186   Methanosphaerula palustris E1-9c     KRLDLHGVICPINFVKTKLALEELEPGD−−QLEVILDEGDAILNVPRSLKDEGHTIV         
fig|555088.4.peg.1329   Dethiobacter alkaliphilus AHT 1      RLDITGEVCPVTFIKVKLKLEDMASGE−−QLEVLLDDGTPIKNVPKTLKGDGHAVL         
fig|447217.4.peg.2346   Anaeromyxobacter sp. K      RIDIRAYACPMTWVKTRIALERLAEGE−−RLEVWLRAGEPLESVPRSAEEDGHRVL         
fig|455488.3.peg.2453   Anaeromyxobacter dehalogenans 2CP-1      RIDIRAYACPMTWVKTRIALERLAEGE−−RLEVWLRAGEPLESVPRSAEEDGHRVL         
fig|290397.18.peg.1588   Anaeromyxobacter dehalogenans 2CP-C      RIDIRAFACPMTWVKTRIALERLAEGE−−TLEVWLRAGEPLESVPRTAEEDGHRVL         
fig|404589.4.peg.1961   Anaeromyxobacter sp. Fw109-5      RVDVRAYACPMTYVKAKIALDRLAAGD−−RLEVWLAGGEPLENLPRSAAEDGHRVV         
fig|404589.10.peg.2383   Anaeromyxobacter sp. Fw109-5      RVDVRAYACPMTYVKAKIALDRLAAGD−−RLEVWLAGGEPLENLPRSAAEDGHRVV         
fig|1043206.3.peg.1567   Acidiphilium sp. PM     RAIDITAETCPMTYVRTRLALDSMAAGE−−VLLVRLRGAEPRANVPRAASDQGHDLL         
fig|349163.14.peg.2272   Acidiphilium cryptum JF-5     RAIDITAETCPMTYVRTRLALDSMAAGE−−VLLVRLRGAEPRANVPRAASDQGHDLL         
fig|414684.4.peg.2539   Rhodospirillum centenum SW       IDITALVCPMTFVRTKLAVERLSPGQ−−TLEVRLSPGEPLVNVPRALVEQGHAVL         
fig|634453.3.peg.315   Acetobacter pasteurianus IFO 3283-03      VLDITTEKCPMTFVRTRLALDGLPPGG−−LLAVRLKGEEPLKNISRSARALGHTIL         
fig|634456.3.peg.315   Acetobacter pasteurianus IFO 3283-26      VLDITTEKCPMTFVRTRLALDGLPPGG−−LLAVRLKGEEPLKNISRSARALGHTIL         
fig|391165.9.peg.407   Granulibacter bethesdensis CGDNIH1       LDVTADICPMTFVRTRIALDKLPSGA−−LLSVLTAGDEASRNVPQSAAALGHEII         
fig|391165.8.peg.396   Granulibacter bethesdensis CGDNIH1       LDVTADICPMTFVRTRIALDKLPSGA−−LLSVLTAGDEASRNVPQSAAALGHEII         
fig|1198133.3.peg.7082   Myxococcus xanthus DZ2      RLDITREVCPMTYVRTKLKLESLEPGT−−LLEVLLRGTEPLKNVPRNARDEGHEVV         
fig|1198538.3.peg.6299   Myxococcus xanthus DZF1      RLDITREVCPMTYVRTKLKLESLEPGT−−LLEVLLRGTEPLKNVPRNARDEGHEVV         
fig|246197.24.peg.4016   Myxococcus xanthus DK 1622      RLDITREVCPMTYVRTKLKLESLEPGT−−LLEVLLRGTEPLKNVPRNARDEGHEVV         
fig|573370.3.peg.3476   Desulfovibrio magneticus RS-1     RRLDITRYYCPMTFVKVKVQLCEMAAGD−−VLEVLLKGEEPLRNVPAAATRDGYSVL         
fig|331678.5.peg.693   Chlorobium phaeobacteroides BS1     HSIDITRERCPMTMVKVKLKLAQIEEGD−−ILDVLLAEGEPLESVPRTAEEQGHRV          
fig|314345.3.peg.944   Mariprofundus ferrooxydans PV-1     HFLDITRETCPMTFVKVKLKLARMDTGE−−QLEVLLNPGEPLENVPRSCEEQGYKVL         
fig|264732.11.peg.2134   Moorella thermoacetica ATCC 39073     KRLDITGDCCPITFVKTKLALEEMQPGE−−ILEVLLKDGEPLANVPRSLKSEGHKIL         
fig|555088.4.peg.1334   Dethiobacter alkaliphilus AHT 1     KTLDITGDQCPMTFVKTKLALEGIEAGQ−−FLEVFLNSGEPVKNVPRSLRNEGHKVV         
fig|635013.3.peg.2423   Thermincola sp. JR      TLDITSDVCPITFVKTKLKLEQMKKGE−−ILEVILNDGEPIQNVPRSVKDEGHKII         
fig|370438.3.peg.274   Pelotomaculum thermopropionicum SI      TLDITDVVCPVTFAKTLLKLEDMQEGQ−−ILEVILNDGEPIQNVPKSLKNEGHKII         
fig|663278.4.peg.2223   Ethanoligenens harbinense YUAN-3       VDITDVVCPITFVKTKIAMEELGAGQ−−TLEIHLNGGEPIQNVPRSLEDEGHTVL         
fig|500635.8.peg.1113   Mitsuokella multacida DSM 20544      TIDITDVVCPITFVKVKLALEDLEDGQ−−TLAVHLNDGEPIQNVPRSLKDEDHKVL         
fig|1090321.3.peg.1394   Desulfitobacterium hafniense PCP-1     RVVDITSVVCPITFVKVKVALEELEPGQ−−LLEILMKDGEPIQNVPRSLKDEGHKLV         
fig|138119.3.peg.3741   Desulfitobacterium sp. Y51     RVVDITSVVCPITFVKVKVALEELEPGQ−−LLEILMKDGEPIQNVPRSLKDEGHKLV         
fig|580327.3.peg.564   Thermoanaerobacterium thermosaccharolyticum DSM 571       IDITDVVCPITFVKAKVAIEELEDGQ−−ILEVRMNEGEPIKNVPSSFKDEGHKIL         
fig|351627.8.peg.1805   Caldicellulosiruptor saccharolyticus DSM 8903       LDITNLVCPMTFVKAKATMEDMEVGQ−−IIEIRMNEGEPIQNVPRSLKEEGHEIL         
fig|521460.8.peg.1257   Anaerocellum thermophilum DSM 6725       LDITNLVCPMTFVKAKATMEDMEAGQ−−IIEIRMNEGEPIQNVPRSLKEEGHEIL         
fig|203119.11.peg.2705   Clostridium thermocellum ATCC 27405       VDITDVVCPMTFVKAKIAIEELEEGQ−−ILEIKMNEGEPILNVPRSFKEEGHRVL         
fig|411474.6.peg.1477   Coprococcus eutactus ATCC 27759      RVDITDVVCPMTFVKAKVAMEELEIGQ−−VLAVTMNDGEPVQNVPRSFKEEGQQIL         
fig|515620.4.peg.593   Eubacterium eligens ATCC 27750      TVDITDVVCPTTFVKAKVAIEELDDGQ−−ILAVRMNDGEPVQNVPRSIKEEGHQIL         
fig|59374.5.peg.161   Fibrobacter succinogenes subsp. succinogenes S85             KCPTTFVKAKVAIEELDEGQ−−ILAIRLNDGEPVQNVPRSLKEEGHEIL         
fig|411459.7.peg.2017   Ruminococcus obeum ATCC 29174      TVDITDVVCPVTFVKAKVALEELDDGQ−−ILAVRMNNGEPVQNVPRSIKEEGHQIL         
fig|411469.3.peg.2807   Eubacterium hallii DSM 3353     EQVDITDVVCPVTFVKAKVALEEMDEGQ−−VLAVKMNDGEPVQNVPRSIKEEGHQIL         
fig|536231.5.peg.163   Roseburia intestinalis L1-82     ETVDITDKVCPLTFVKAKVALEELDDGE−−VIAIRMNDGEPVQNVPRSVKEEGHQIL         
fig|483218.5.peg.2462   Bacteroides pectinophilus ATCC 43243      QVDITDKVCPLTFVKAKVALDELEDGE−−VIAIRMNDGEPVQNVPRSIKEEGHQIL         
fig|457412.4.peg.1614   Ruminococcus sp. 5_1_39BFAA      EVDITDKVCPLTFVKAKVAIEELEDGE−−ILAVRMNDGEPVQNVPRSMKEEGHKVL         
fig|515619.6.peg.752   Eubacterium rectale ATCC 33656      QVDITDKVCPLTFVKAKVAIEELDDGE−−VLAIRMNDGEPVQNVPRSMKEEGHKIL         
fig|411461.4.peg.2687   Dorea formicigenerans ATCC 27755      QVDITDKVCPLTFVKAKVAIEELDDGE−−VLAIRMNDGEPVQNVPRSMKEEGHKIL         
fig|292459.1.peg.1419   Symbiobacterium thermophilum IAM 14863     RAIDLRGDVCPVTFAKTKIALEEMQIGQ−−VLLVRLDYEPATRNVPRSAELYGDEVL         
fig|292459.5.peg.1475   Symbiobacterium thermophilum IAM 14863     RAIDLRGDVCPVTFAKTKIALEEMQIGQ−−VLLVRLDYEPATRNVPRSAELYGDEVL         
fig|502025.10.peg.4197   Haliangium ochraceum DSM 14365     EVLDLRGEVCPFTFVRTRLRLEELSLGA−−CLDILLDHEPAARNVPRSAREWGQEV          
fig|224325.1.peg.549   Archaeoglobus fulgidus DSM 4304     EVLDIRGEVCPFTFIETKLKLEEMKSGE−−ILRVIIDHEPAVRDVPRSVEQEGHEVL         
fig|123214.3.peg.186   Persephonella marina EX-H1     RELDLRGEVCPFTFVKSKLIIEQMEPGQ−−VLKVILDYKPSVENVPKSMREEGQEVL         
fig|436114.4.peg.990   Sulfurihydrogenibium sp. YO3AOP1     RELDLKGEVCPFTFVKSKLIIEQMDKGQ−−VLRVILDYKPSVENVPKSMEMEGQEVL         
fig|204536.4.peg.1064   Sulfurihydrogenibium azorense Az-Fu1     RELDLKGEVCPFTFVKSKLIIEQMEKGQ−−ILRVILDYEPSVENVPKSMEMEGQKVL         
fig|608538.3.peg.1049   Hydrogenobacter thermophilus TK-6     RELDIRGDVCPFTFVKSKLVLEQMEKGE−−ILRVIVDYRPSAENVPKSMREEGQEVL         
fig|224324.8.peg.1331   Aquifex aeolicus VF5     KELDIRGEVCPFTFVKSKLALEEMETGQ−−ILRVLVDYPPSAESVPKSMREEGQEVI         
fig|638303.3.peg.106   Thermocrinis albus DSM 14484     KELDIRGEVCPFTFVKSKLALEDMEVGQ−−VLRVLVDYKPSAESVPKSLREEGQEVL         
fig|380749.5.peg.1299   Hydrogenobaculum sp. Y04AAS1     KELDITGEVCPFTFVKSKLVLETMGKGQ−−ILRVIVDYEPSAVSVPKSMRDEGQEVL         
fig|547143.3.peg.1292   Hydrogenobaculum sp. 3684     KELDITGEVCPFTFVKSKLVLETMEKGE−−VLRVIVDYEPSAVSVPKSMRDEGQEVL         
fig|547146.4.peg.1291   Hydrogenobaculum sp. SN     KELDITGEVCPFTFVKSKLVLETMEKGE−−VLRVIVDYEPSAVSVPKSMRDEGQEVL         
fig|583345.3.peg.1909   Methylotenera mobilis JLW8      VLDVRHEDSPIPTIRTKEALDTLAPGS−−VLKVITSQESTVKNI                      
fig|456442.10.peg.327   Methanoregula boonei 6A8     RTLDIRGKVCPHCLIAVKKETDTMKPGD−−DLVVTCDHPPAATKNIPLYAKE                
fig|413999.7.peg.1552   Clostridium botulinum A str. ATCC 3502     KDLDCLYEPCPIPLVRASQELKKMKTGD−−IVVLHSDQSCIGVMAEEWAKQ                
fig|441770.4.peg.1482   Clostridium botulinum A str. ATCC 19397     KDLDCLYEPCPIPLVRASQELKKMKTGD−−IVVLHSDQSCIGVMAEEWAKQ                
fig|445336.4.peg.1270   Clostridium botulinum Bf     KDLDCLYEPCPIPLVRASQELKKMKTGD−−IVVLHSDQSCIGVMAEEWAKQ                
fig|471871.7.peg.1975   Clostridium sporogenes ATCC 15579     KDLDCLYEPCPIPLVRASQELKKMKTGD−−IVVLHSDQSCIGVMAEEWAKQ                
fig|498214.7.peg.1963   Clostridium botulinum A3 str. Loch Maree     KDLDCLYEPCPIPLVRASQELKKMKTGD−−IVVLHSDQSCIGVMAEEWAKQ                
fig|441772.13.peg.1576   Clostridium botulinum F str. Langeland     KDLDCLYEPCPIPLVRASQELKKMKTGD−−IVVLHSDQSCIGVMAEEWAKQ                
fig|498213.7.peg.1725   Clostridium botulinum B1 str. Okra     KDLDCLYEPCPIPLVRASQELKKMKTGD−−IVVLHSDQSCIGVMAEEWAKQ                
fig|758678.3.peg.1669   Clostridium botulinum F str. 230613     KDLDCLYEPCPIPLVRASQELKKMKTGD−−IVVLHSDQSCIGVMAEEWAKQ                
fig|445335.4.peg.2753   Clostridium botulinum NCTC 2916     KDLDCLYEPCPIPLVRASQELKKMKTGD−−IVVLHSDQSCIGVMAEEWAKQ                
fig|536232.3.peg.1695   Clostridium botulinum A2 str. Kyoto     KDLDCLYEPCPIPLVRASQELKKMKTGD−−IVVLHSDQSCIGVMAEEWAKQ                
fig|212717.8.peg.1188   Clostridium tetani E88     KEVDCLYEACPIPIIKAIKELKKMKSGD−−ILILHSDHSCVGISMEEW                   
fig|386415.6.peg.1844   Clostridium novyi NT     KELDCLYEACPVPLIKAVKELKTMDAGD−−ILILHSDHSCVGISVEEWGEK                
fig|445337.5.peg.1868   Clostridium botulinum C str. Eklund     KELDCLYEACPVPLIKAVKELKNMNSGD−−ILILHSDHSCVGISVEEWGEK                
fig|212717.8.peg.366   Clostridium tetani E88     RKLNCLSEVCPIPILRAIKEFKTMEAGD−−ILILHSDHSCVGVDIKKWAFQHK             
fig|293826.4.peg.4528   Alkaliphilus metalliredigens QYMF     YKLDCLYEACPIPLLKALKQLKKMEIGD−−LLIMHTDHNCSIRNVVEWTKKQGHEI          
fig|293826.6.peg.4847   Alkaliphilus metalliredigens QYMF     YKLDCLYEACPIPLLKALKQLKKMEIGD−−LLIMHTDHNCSIRNVVEWTKKQGHEI          
fig|350688.3.peg.1005   Alkaliphilus oremlandi oremlandii OhILAs     YELDCMYEACPIPLLKALKKLNTMKIGD−−VLVMRTDHNCSITNVVEWTKKQGH            
fig|292459.1.peg.102   Symbiobacterium thermophilum IAM 14863     YTLNVYGEMCPAPLLKAEAKLRSMQPGD−−LLIMESDHSCTVR                         
fig|292459.5.peg.105   Symbiobacterium thermophilum IAM 14863     YTLNVYGEMCPAPLLKAEAKLRSMQPGD−−LLIMESDHSCTVR                         
fig|264732.11.peg.482   Moorella thermoacetica ATCC 39073      RMDTCGEMCPIPIVRARVKLKQMAPGD−−ILVVTSDHSCTSQSLAETMAKMGHRV          
fig|469381.4.peg.2073   Dethiosulfovibrio peptidovorans DSM 11002     YTLDCLGEACPIPLIKAQKKMAEMSVGD−−TITIEIDHSCAVKNVPEWANKE               
fig|519441.4.peg.145   Streptobacillus moniliformis DSM 12112      TLDCLGEACPVPLIRTQGKMEELEIGD−−VLVVSIDHSCAMKNIPEWARKVGHNV          
fig|580331.4.peg.79   Thermoanaerobacter italicus Ab9     YRLDCLGEACPVPLLKTQKEMEKLKVGD−−VLIVEIDHSCAMKNVPEWARNM               
fig|583358.4.peg.138   Thermoanaerobacter mathranii subsp. mathranii str. A3     YRLDCLGEACPVPLLKTQKEMEKLKVGD−−VLIVEIDHSCAMKNVPEWARNM               
fig|573062.4.peg.87   Thermoanaerobacter sp. X513     YRLDCLGEACPVPLLKTQKEMEKLKVGD−−VLIVEIDHSCAMKNVPEWARNM               
fig|401526.3.peg.1322   Thermosinus carboxydivorans Nor1     HYLDMLGEICPHPLHMAQAKMEKLKSGD−−VLVVESDFSRSVRNLLAWADKQ               
fig|246194.6.peg.2448   Carboxydothermus hydrogenoformans Z-2901      KIDLTGEVCPVPLWRVQEELKKLQPGD−−KITVITDFSRSVRNI                      
fig|635013.3.peg.542   Thermincola sp. JR     KKLDLLGEVCPFPLFKTQAELEQMNSGD−−VLLIEVDFNQSVRNIIKWCEDQGH            
fig|273068.3.peg.254   Thermoanaerobacter tengcongensis MB4     HEIMCMGEICPLPLLKAKKKYEEMKEGE−−ILKVVVDHRCTLDNL                      
fig|273068.5.peg.75   Thermoanaerobacter tengcongensis MB4           GEICPLPLLKAKKKYEEMKEGE−−ILKVVVDHRCTLDNL                      
fig|573062.4.peg.84   Thermoanaerobacter sp. X513           GEICPLPLLKAIEKYKKMEKGD−−VLKIVVDHSCSLKNIQEY                   
fig|583358.4.peg.135   Thermoanaerobacter mathranii subsp. mathranii str. A3     HELMTFGEICPLPLLKAIEKYKKMEKGD−−MLKIVVDHSCSLKNIQEY                   
fig|580331.4.peg.76   Thermoanaerobacter italicus Ab9     HELITFGEICPLPLLKAIEKYKKMEKGD−−MLKIVVDHSCSLKNIQEY                   
fig|469381.4.peg.2070   Dethiosulfovibrio peptidovorans DSM 11002     KKIDCLGDFCPIPGMKAKVAMEKMRPGE−−SILLVSDHSCAPLNVKDIADEM               
fig|1245026.4.peg.2998   Bacillus coagulans XZL9     KVLEVMGQVCPFPLIEAKKAIEEIQPGD−−DLVIHFDCTQATESIPRWAAEAGHTV          
fig|345219.8.peg.1712   Bacillus coagulans 36D1     KVLEVMGQVCPFPLIEAKKAIEEIQPGD−−DLVIHFDCTQATESIPRWAAEAGHTV          
fig|292459.1.peg.1333   Symbiobacterium thermophilum IAM 14863      HLDVLGEACPYPLIMAKQKINEVAPGG−−RLIIDFDCTQATETLPRWATESGHAV          
fig|292459.5.peg.1385   Symbiobacterium thermophilum IAM 14863      HLDVLGEACPYPLIMAKQKINEVAPGG−−RLIIDFDCTQATETLPRWATESGHAV          
fig|562970.4.peg.3385   Bacillus tusciae DSM 2912     HHLQVLGYVCPFPVVEAEKAMANLAPGD−−ELVIDFDCTQATESLPRWAMQHGHRV          
fig|1116036.3.peg.2733   Escherichia coli 2875150     KKLDVVTQVCPFPLIEAKAALAEMASGD−−ELVIEFDCTQATEAIPQWAAEEGHAI          
fig|1181748.3.peg.2852   Escherichia coli KTE202     KKLDVVTQVCPFPLIEAKAALAEMASGD−−ELVIEFDCTQATEAIPQWAAEEGHAI          
fig|439855.10.peg.1203   Escherichia coli SMS-3-5     KKLDVVTQVCPFPLIEAKAALAEMASGD−−ELVIEFDCTQATEAIPQWAAEEGHAI          
fig|444454.5.peg.1679   Escherichia coli O157:H7 str. EC4024     KKLDVVTQVCPFPLIEAKAALAEMASGD−−ELVIEFDCTQATEAIPQWAAEEGHAI          
fig|550677.3.peg.1550   Escherichia coli B354     KKLDVVTQVCPFPLIEAKAALAEMASGD−−ELVIEFDCTQATEAIPQWAAEEGHAI          
fig|585054.5.peg.2013   Escherichia fergusonii ATCC 35469     KKLDVVTQVCPFPLIEAKAALAEMASGD−−ELVIEFDCTQATEAIPQWAAEEGHAI          
fig|591020.3.peg.2503   Shigella flexneri 2002017     KKLDVVTQVCPFPLIEAKAALAEMASGD−−ELVIEFDCTQATEAIPQWAAEEGHAI          
fig|621.8.peg.5079   Shigella boydii ATCC 9905     KKLDVVTQVCPFPLIEAKAALAEMASGD−−ELVIEFDCTQATEAIPQWAAEEGHAI          
fig|656435.3.peg.1738   Escherichia coli TA124     KKLDVVTQVCPFPLIEAKAALAEMASGD−−ELVIEFDCTQATEAIPQWAAEEGHAI          
fig|754091.3.peg.2361   Shigella flexneri CCH060     KKLDVVTQVCPFPLIEAKAALAEMASGD−−ELVIEFDCTQATEAIPQWAAEEGHAI          
fig|766155.3.peg.2372   Shigella flexneri 1485-80     KKLDVVTQVCPFPLIEAKAALAEMASGD−−ELVIEFDCTQATEAIPQWAAEEGHAI          
fig|868171.3.peg.2760   Escherichia coli DEC8B     KKLDVVTQVCPFPLIEAKAALAEMASGD−−ELVIEFDCTQATEAIPQWAAEEGHAI          
fig|868184.3.peg.2357   Escherichia coli DEC10E     KKLDVVTQVCPFPLIEAKAALAEMASGD−−ELVIEFDCTQATEAIPQWAAEEGHAI          
fig|868210.3.peg.2645   Escherichia coli DEC15E     KKLDVVTQVCPFPLIEAKAALAEMASGD−−ELVIEFDCTQATEAIPQWAAEEGHAI          
fig|869690.3.peg.3817   Escherichia coli 2.4168     KKLDVVTQVCPFPLIEAKAALAEMASGD−−ELVIEFDCTQATEAIPQWAAEEGHAI          
fig|300267.13.peg.2695   Shigella dysenteriae Sd197     KKLDVVTQVCPFPLIEAKAALAEMASGD−−ELVIEFDCTQATEAIPQWAAEEGHAI          
fig|754093.3.peg.4760   Shigella dysenteriae 1617     KKLDVVTQVCPFPLIEAKAALAEMASGD−−ELVIEFDCTQATEAIPQWAAEEGHAI          
fig|637910.3.peg.2082   Citrobacter rodentium ICC168     KKLDVVTQVCPFPLIEAKAALAEMASGD−−QLVIEFDCTQATEAIPQWAAEEGHTI          
fig|754089.3.peg.2152   Escherichia coli STEC_MHI813     KKLDVVTQVCPFPLIEAKAALAEMASGD−−KLVIEFDCTQATEAIPQWAAEEGHAI          
fig|670905.4.peg.2243   Escherichia coli OK1357     KKLDVVTQVCPFPLIEAKAALAGMASGD−−ELVIEFDCTQATEAIPQWAAEEGHAI          
fig|1068608.3.peg.3747   Escherichia coli XH140A     KKLDVVTQVCPFPLIEAKAALAEMVSGD−−ELVIEFDCTQATEAIPQWAAEEGHAI          
fig|481805.3.peg.1745   Escherichia coli ATCC 8739     KKLDVVTQVCPFPLIEAKAALAEMTSGD−−ELVIEFDCTQATEAIPQWAAEEGHAI          
fig|343509.6.peg.3702   Sodalis glossinidius str. 'morsitans'     KKLDVISQVCPFPLIEAQSAMAALQVGD−−ELVIDFDCTQATESLPQWAAEQGHVV          
fig|649743.3.peg.617   Actinomyces sp. oral taxon 848 str. F0332     YVLDTIGQVCPFPLVEAKRAIGGLRSGD−−ELQIDFDCTQATDSIPAWASAAGHAV          
fig|321955.4.peg.338   Brevibacterium linens BL2     QVLETNGLVCPFPLVEAKDAIGGMDNGD−−ELVINFDCTQATEAIPQWAAENGYPV          
fig|306537.10.peg.169   Corynebacterium jeikeium K411     YKLDTLGAVCPFPLIDAKAAMADLSVGD−−SLQIDFDCTQATDAIPRWAATDGHEV          
fig|525262.3.peg.2033   Corynebacterium jeikeium ATCC 43734     YKLDTLGAVCPFPLIDAKAAMADLSVGD−−SLQIDFDCTQATDAIPRWAATDGHEV          
fig|306537.3.peg.229   Corynebacterium jeikeium K411     YKLDTLGAVCPFPLIDAKAAMADLSVGD−−SLQIDFDCTQATDAIPRWAATDGHEV          
fig|504474.3.peg.174   Corynebacterium urealyticum DSM 7109     YKLDSLGAVCPFPLIDAKAAIAQLEVGD−−SLQIDFDCTQATDAIPRWAATDGHEV          
fig|553204.6.peg.964   Corynebacterium amycolatum SK46     YELDTVGAVCPFPLIEAKDAIGKIEIGE−−ELVIPFDCTQATDAIPRWAAKDGHEV          
fig|645127.4.peg.171   Corynebacterium kroppenstedtii DSM 44385      VLDTLGAVCPFPLIEAKAAMQQLSSGD−−ELVIDFDCTQATDAIPRWAATDGHEV          
fig|378753.5.peg.2322   Kocuria rhizophila DC2201     YALDSLGAVCPFPLIEAKDVMQTLQTGD−−HLVIDFDCTQATEAIPQWAATDGHEV          
fig|196164.6.peg.2697   Corynebacterium efficiens YS-314     YALDSLGAVCPFPLIEAKDVMKTLQSGD−−HLVIDFDCTQATDAIPQWCATDGHEV          
fig|585529.3.peg.2122   Corynebacterium genitalium ATCC 33030     YKLDTLGAVCPFPLIEAKDAIAELDSGE−−ALVIDFDCTQATESIPQWAADNGHSV          
fig|525263.3.peg.1930   Corynebacterium lipophiloflavum DSM 44291     YKLDTLGAVCPFPLIEAKDAIAELDDGE−−KLVIDFDCTQATESIPQWAADNGH            
fig|553206.4.peg.14   Corynebacterium tuberculostearicum SK141     YVLDTLGAVCPFPLIEAKQVMAELEPGE−−ALVIDFDCTQATESIPQWAADEGHEI          
fig|548478.3.peg.1754   Corynebacterium glucuronolyticum ATCC 51866       LDTLGSVCPFPLIDAKQAMNELEPGE−−CLRIDFDCTQATESIPRWAADEGYEV          
fig|548477.4.peg.900   Corynebacterium glucuronolyticum ATCC 51867       LDTLGSVCPFPLIDAKQAMNELEPGE−−CLRIDFDCTQATESIPRWAADEGYEV          
fig|360109.7.peg.2092   Campylobacter jejuni subsp. doylei 269.97      TLDTRGKVCPFPLVEAKNLVQTLKSGE−−ELEILFDCTQATETIPQWAAEEGHEIV         
fig|887287.3.peg.1008   Campylobacter coli 84-2      TLDTRGKVCPFPLVEAKNLVQTLKSGE−−ELEILFDCTQATETIPQWAAEEGHEIV         
fig|537970.9.peg.1460   Helicobacter canadensis MIT 98-5491 (Prj:30719)       LDTRGKVCPFPLVDAKNFIQTLQSGE−−ELEILFDCTQATETIPQWAAEEGHEVI         
fig|478801.4.peg.1901   Kytococcus sedentarius DSM 20547     YTLDTAGDVCPFPLVDARAAMEQLAPGD−−ELRIDFDCTQATESLPQWAAEDGHEV          
fig|446465.4.peg.1431   Brachybacterium faecium DSM 4810     YTLETNGAVCPFPLIDAKNAMQQLTTGD−−DLVIGFDCTQATDSLPQWAAEDGHEVV         
fig|465515.4.peg.2212   Micrococcus luteus NCTC 2665     HLLETDGQVCPFPLVEANQAMEQIPTGD−−ELVIDFDCTQATDSLPRWAAENGHEV          
fig|596312.3.peg.846   Micrococcus luteus SK58     HLLETDGQVCPFPLVEANQAMQQIPSGD−−ELVIDFDCTQATDSLPRWAAENGHEV          
fig|272629.3.peg.718   Mannheimia haemolytica PHL213      RLPASGLVCPFPLVEAKAAMAKLNKGD−−SLTIEFDCTQATEAIPNWAEEEGYEV          
fig|669262.3.peg.1391   Mannheimia haemolytica serotype A2 str. BOVINE      RLPASGLVCPFPLVEAKAAMAKLNKGD−−SLTIEFDCTQATEAIPNWAEEEGYEV          
fig|679198.3.peg.582   Aggregatibacter aphrophilus F0387       LDTVGHLCPFPLIEGKKAMAKLNRGD−−SLTINFDCAQATENLPNWAAEEGYQV          
fig|981539.3.peg.109   Streptococcus gallolyticus subsp. gallolyticus ATCC 43143      ELETGGLVCPFPLIDAKNKMKELSIGD−−ELLIKFDCTQATESIPNWAAE                
fig|471872.6.peg.714   Streptococcus infantarius subsp. infantarius ATCC BAA-102      ELETGGLVCPFPLIDAKNKMKELSIGD−−ELLIKFDCTQATESIPNWSAE                
fig|637911.3.peg.1507   Actinobacillus minor NM305                   MEAKKKIVELAVGD−−ELLIQFTCAEATENLPRWAAE                
fig|1187956.3.peg.1826   Streptococcus thermophilus MN-ZLW-002      KLETGGLVCPFPLIDAKKKMAELAVGD−−ELLIAFDCTQATESIPNWA                  
fig|264199.4.peg.1826   Streptococcus thermophilus LMG 18311      KLETGGLVCPFPLIDAKKKMAELAVGD−−ELLIAFDCTQATESIPNWA                  
fig|347254.3.peg.1821   Streptococcus salivarius JIM8780      KLETGGLVCPFPLIDAKKKMAELATGD−−ELLIAFDCTQATESIPNWAA                 
fig|176279.9.peg.1466   Staphylococcus epidermidis RP62A     YELGTVGMVCPFPLIEAQKKMNELNQGD−−ELKIDFDCTQATEALPNWAAENGYPV          
fig|176280.1.peg.1645   Staphylococcus epidermidis ATCC 12228     YELGTVGMVCPFPLIEAQKKMNELNQGD−−ELKIDFDCTQATEALPNWAAENGYPV          
fig|176280.10.peg.1609   Staphylococcus epidermidis ATCC 12228     YELGTVGMVCPFPLIEAQKKMNELNQGD−−ELKIDFDCTQATEALPNWAAENGYPV          
fig|596317.3.peg.32   Staphylococcus epidermidis SK135     YELGTVGMVCPFPLIEAQKKMNELNQGD−−ELKIDFDCTQATEALPNWAAENGYPV          
fig|979220.3.peg.1667   Staphylococcus epidermidis NIH05005     YELGTVGMVCPFPLIEAQKKMNELNQGD−−ELKIDFDCTQATEALPNWAAENGYPV          
fig|525376.3.peg.2007   Staphylococcus epidermidis W23144     YELGTVGMVCPFPLIEAQKKMNDLNQGD−−ELKIDFDCTQATEALPNWAAENGYPV          
fig|979204.3.peg.119   Staphylococcus epidermidis NIHLM061     YELGTVGMVCPFPLIEAQKKMNDLNQGD−−ELKIDFDCTQATEALPNWAAENGYPV          
fig|553212.3.peg.2282   Staphylococcus capitis SK14     HELGTVGMVCPFPLIEAQKKMEELEQGD−−ELKIDFDCTQATEALPNWAAE                
fig|904334.3.peg.27   Staphylococcus epidermidis VCU116     HELGTVGMVCPFPLIEAQKKMEELEQGD−−ELKIDFDCTQATEALPNWAAE                
fig|525378.3.peg.2245   Staphylococcus epidermidis M23864:W1     HELGTVGMVCPFPLIEAQKKMQELNQGD−−ELKIDFDCTQATEALPNWAAE                
fig|596319.3.peg.1911   Staphylococcus warneri L37603     YELGTVGMVCPFPLIEAQKKMTELDSGD−−ELKIDFDCTQATEAIPNWAAENGYPV          
fig|1123523.3.peg.1997   Staphylococcus aureus subsp. aureus 11819-97     HELGTVGMVCPFPLIEAQKKMATLQSGD−−ELKIDFDCTQATEAIPNWAAENGYPV          
fig|1158485.3.peg.1168   Staphylococcus aureus M1311     HELGTVGMVCPFPLIEAQKKMATLQSGD−−ELKIDFDCTQATEAIPNWAAENGYPV          
fig|1158495.3.peg.1986   Staphylococcus aureus M1462     HELGTVGMVCPFPLIEAQKKMATLQSGD−−ELKIDFDCTQATEAIPNWAAENGYPV          
fig|450394.6.peg.2550   Staphylococcus aureus subsp. aureus USA300_TCH959     HELGTVGMVCPFPLIEAQKKMATLQSGD−−ELKIDFDCTQATEAIPNWAAENGYPV          
fig|644279.4.peg.2188   Staphylococcus aureus subsp. aureus 132     HELGTVGMVCPFPLIEAQKKMATLQSGD−−ELKIDFDCTQATEAIPNWAAENGYPV          
fig|1169255.3.peg.1172   Staphylococcus aureus M0946     HELGTVGMVCPFPLIEAQKKMATLQSGD−−ELKIDFDCTQATEAIPNWAAENGYPV          
fig|1075079.3.peg.1871   Staphylococcus aureus ST228/16035     HELGTVGMVCPFPLIEAQKKMATLQSGD−−ELKIDFDCTQATEAIPNWAAE                
fig|1158486.3.peg.1539   Staphylococcus aureus M1320     HELGTVGMVCPFPLIEAQKKMATLQSGD−−ELKIDFDCTQATEAIPNWAAE                
fig|1169273.3.peg.1929   Staphylococcus aureus M1286     HELGTVGMVCPFPLIEAQKKMATLQSGD−−ELKIDFDCTQATEAIPNWAAE                
fig|418127.4.peg.1882   Staphylococcus aureus subsp. aureus Mu3     HELGTVGMVCPFPLIEAQKKMATLQSGD−−ELKIDFDCTQATEAIPNWAAE                
fig|505321.3.peg.541   Staphylococcus aureus subsp. aureus str. CF-Marseille     HELGTVGMVCPFPLIEAQKKMATLQSGD−−ELKIDFDCTQATEAIPNWAAE                
fig|553571.3.peg.429   Staphylococcus aureus A6300     HELGTVGMVCPFPLIEAQKKMATLQSGD−−ELKIDFDCTQATEAIPNWAAE                
fig|273036.6.peg.2034   Staphylococcus aureus RF122     HELGTVGMVCPFPLIEAQKKMATLKSGD−−ELKIDFDCTQATEAIPNWAAENGYPV          
fig|458233.11.peg.465   Macrococcus caseolyticus JCSC5402     YELGTVGMVCPFPLIEAQKKIEALSSGD−−ELKIDFDCTQATEAIPNWAAEQGYPV          
fig|396513.4.peg.1548   Staphylococcus carnosus subsp. carnosus TM300     YELGTVGMVCPFPLIEAQKKMETLNIGD−−ELKIDFDCTQATEAIPNWAAE                
fig|435837.3.peg.885   Staphylococcus hominis subsp. hominis C80     YELGTVGMVCPFPLIEAQKKMETLKNGD−−ELKIDFDCTQATEAIPNWAAEQ               
fig|904339.3.peg.293   Staphylococcus hominis VCU122     YELGTVGMVCPFPLIEAQKKMETLKNGD−−ELKIDFDCTQATEAIPNWAAEQ               
fig|1131257.3.peg.848   Staphylococcus saprophyticus subsp. saprophyticus KACC 16562     HELGTVGMVCPFPLIEAQKKMNTLDNGE−−ELKIDFDCTQATEALPNWAAEQ               
fig|342451.4.peg.1296   Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305     HELGTVGMVCPFPLIEAQKKMNTLDNGE−−ELKIDFDCTQATEALPNWAAEQ               
fig|279808.3.peg.1572   Staphylococcus haemolyticus JCSC1435     YELGTVGMVCPFPLIEAQKKMQTLDNGD−−ELKIDFDCTQATEAIPNWAAEQGYPV          
fig|1034809.4.peg.1004   Staphylococcus lugdunensis N920143     YELGTVGMVCPFPLIEAQKKMQTLDAGD−−ELKIDFDCTQATEAIPNWAAEQ               
fig|883164.3.peg.20   Staphylococcus lugdunensis ACS-027-V-Sch2     YELGTVGMVCPFPLIEAQKKMQTLDAGD−−ELKIDFDCTQATEAIPNWAAEQ               
fig|904346.3.peg.866   Staphylococcus lugdunensis VCU139     YELGTVGMVCPFPLIEAQKKMQTLDAGD−−ELKIDFDCTQATEAIPNWAAEQ               
fig|309799.3.peg.391   Dictyoglomus thermophilum H-6-12     YTLDVRGEVCPVPDVETKRKLKTMQSGE−−VLEVLIDYPLSKERIPQGVKEVGGEVL         
fig|515635.3.peg.540   Dictyoglomus turgidum DSM 6724     YTLDVRGEVCPVPDVETKRKLKTMQSGE−−ILEVLIDYPLSKERIPQGIKEVGGEVL         
fig|273068.3.peg.256   Thermoanaerobacter tengcongensis MB4     YTLDERGEVCPVPDVDTRRKLKEMKSGE−−ILEVLVDYALSKERIPAGVKEVGG            
fig|273068.5.peg.77   Thermoanaerobacter tengcongensis MB4     YTLDERGEVCPVPDVDTRRKLKEMKSGE−−ILEVLVDYALSKERIPAGVKEVGG            
fig|309798.3.peg.1348   Coprothermobacter proteolyticus DSM 5265     YTLDMRGEVCPVPDVETRRKLKSMKSGE−−VLEVLIDYPLSKERIPASAPKEGGEVL         
fig|126740.6.peg.1851   Thermotoga sp. RQ2     KTLDVRGEVCPVPDVETKRALQNMKPGE−−ILEVWIDYPMSKERIPETVKKLGHEVL         
fig|309803.4.peg.1587   Thermotoga neapolitana DSM 4359     KTLDVRGEVCPVPDVETKRALQNMKPGE−−ILEVWIDYPMSKERIPETVKKLGHEVL         
fig|390874.10.peg.1772   Thermotoga petrophila RKU-1     KTLDVRGEVCPVPDVETKRALQNMKPGE−−ILEVWIDYPMSKERIPETVKKLGHEVL         
fig|443254.3.peg.490   Marinitoga piezophila KA3     KTLDVRGEVCPVPDVETKRALQNMKPGE−−ILEVWIDYPMSKERIPETVKKLGHEVL         
fig|590168.4.peg.1799   Thermotoga naphthophila RKU-10     KTLDVRGEVCPVPDVETKRALQNMKPGE−−ILEVWIDYPMSKERIPETVKKLGHEVL         
fig|416591.5.peg.1376   Thermotoga lettingae TMO     KSLDVRGEVCPVPDVETKRALKEMKPGE−−ILEVWIDYPMSKERIPETVRKLGHEVL         
fig|416591.5.peg.1381   Thermotoga lettingae TMO     RVLDFRGETCPIPELTTRRELKELTNGE−−TLLVIVDYPLSKERIISFCRKMGYKVI         
fig|390874.10.peg.1777   Thermotoga petrophila RKU-1     KLLDMRGQICPVPEITTRKELEKLQPGE−−TLIIVCDYPLSGERITSFSLREGYEV          
fig|443254.3.peg.485   Marinitoga piezophila KA3     KLLDMRGQICPVPEITTRKELEKLQPGE−−TLIIVCDYPLSGERITSFSLREGYEV          
fig|309803.4.peg.1592   Thermotoga neapolitana DSM 4359       LDMRGQICPVPEITTRKELEKLQPGE−−TLIVMCDYPLSGERITSFSLREGYEV          
fig|590168.4.peg.1805   Thermotoga naphthophila RKU-10     KLLDMRGQICPVPEITTRKELEKLQPGE−−TLIVMCDYPLSGERITSFSLREGYEV          
fig|126740.6.peg.1857   Thermotoga sp. RQ2     KLLDMRGQICPVPEITTRKELEKLQPGE−−TLIVMCDYPLSGERITSFSLREGYEV          
fig|273063.1.peg.950   Sulfolobus tokodaii str. 7       LDLRGYSCPVPEIKTKQKLLKMEKGK−−VLEVLIDNPAAIEYTLPEVAR                 
fig|273057.1.peg.2827   Sulfolobus solfataricus P2     KVVDLRGEECPVPEITLKRELMKANRGE−−IIEALTDNPAAVAHTIPEIIKLFNCRYEVL       
fig|399549.6.peg.379   Metallosphaera sedula DSM 5348     RHLDVRGEQCPIPEIAAKKELTKMKPGE−−ELEILVDHPAAVDVTLPEVAK                 
fig|273063.1.peg.952   Sulfolobus tokodaii str. 7     EVLDVRGEECPIPETLAAKKLNKMTDGE−−ILEVLTDHQPAV                          
fig|273063.1.peg.953   Sulfolobus tokodaii str. 7     QVLDVRGESCPVPEMEASKKLKKMKVGQ−−LLEVLTDHQPAVDVTLPSLAKN                
fig|399549.6.peg.373   Metallosphaera sedula DSM 5348      QLDVIGESCPVPEMMASKKLKKMKPGQ−−VLEVITDHQPAVDVTLPSLCKNM               
fig|273057.1.peg.2824   Sulfolobus solfataricus P2     EVLDVRGEECPVPEMSASKKLKKMKVGQ−−MLEVLTDHEPAVHVTLPSLCKSLGYPFV         
fig|399549.6.peg.422   Metallosphaera sedula DSM 5348        DVRGEECPIPEMRAAKELQKIPSGK−−LVVLTDHEPAIDVTLPSLCK                 
fig|399549.6.peg.889   Metallosphaera sedula DSM 5348      VLDLRGEACPEPQIEIVKKLNHMKPGQ−−VLEVISDEEPMNVTIPKICESRGYPCV         
fig|273063.1.peg.2250   Sulfolobus tokodaii str. 7      TLDLRGEPCPEPQIEIVKMLNHMKEGQ−−VLEILSDDEPAELSIPVICE                 
fig|396588.4.peg.62   Thioalkalivibrio sp. HL-EbGR7     RTVNCIGDGCPKPQLLTLKALNLVDEGE−−IVELISDNPTAVETIPAMMLAAYG             
fig|396588.3.peg.63   Thioalkalivibrio sp. HL-EbGR7     RTVNCIGDGCPKPQLLTLKALNLVDEGE−−IVELISDNPTAVETIPAMMLAAYG             
fig|537457.7.peg.784   Actinobacillus pleuropneumoniae serovar 7 str. AP76        DLRQYRCPLPLLMTKKALNRLALNE−−RLVVLLDLASSVQDFELLCEEYGYELV         
fig|434271.4.peg.725   Actinobacillus pleuropneumoniae serovar 3 str. JL03        DLRQYRCPLPLLMTKKALNRLALNE−−RLVVLLDLASSVQDFELLCEEYGYELV         
fig|754255.3.peg.727   Actinobacillus pleuropneumoniae serovar 4 str. M62     YQLDLRQYRCPLPLLMTKKALNRLALNE−−RLVVLLDLASSVQDFELLCEEYGYELV         
fig|754256.7.peg.799   Actinobacillus pleuropneumoniae serovar 6 str. Femo        DLRQYRCPLPLLMTKKALNQLALNE−−RLVLLLDLASSVQDFELLCEEYGYELV         
fig|228399.1.peg.1698   Actinobacillus pleuropneumoniae serovar 1 str. 4074     YQLDLRQYRCPLPLLMTKKALNQLALNE−−RLVLLLDLASSVQDFELLCEEYGYELV         
fig|679198.3.peg.746   Aggregatibacter aphrophilus F0387     YQLDTREYRCPLPLLMTKKAVKTLTLND−−VLTVLLSSESNIEDFRLLCEEQD             
fig|157239.3.peg.346   Haemophilus influenzae R2866     YQLNLTALRCPIPLLSAKKALKNLDKND−−ELMLILNLESAVENFSIFAEE                
fig|374931.10.peg.769   Haemophilus influenzae PittGG     YQLNLTALRCPIPLLSAKKALKNLDKND−−ELMLILNLESAVENFSIFAEE                
fig|374933.4.peg.1755   Haemophilus influenzae PittII     YQLNLTALRCPIPLLSAKKALKNLDKND−−ELMLILNLESAVENFSIFAEE                
fig|656912.3.peg.1083   Haemophilus influenzae RdAW     YQLNLTALRCPIPLLSAKKALKNLDKND−−ELMLILNLESAVENFSIFAEE                
fig|521005.3.peg.573   Haemophilus influenzae 7P49H1     YQLNLTALRCPIPLLSAKKALKNLNKND−−ELMLILNLESAVENFSIFAEE                
fig|281310.3.peg.1541   Haemophilus influenzae 86-028NP     YQLNLTALRCPIPLLSAKKALKNLNKND−−ELMLILNLESAVENFSIFAEE                
fig|456298.4.peg.1654   Haemophilus parasuis 29755     YSLDLTAYRCPLPLLSAKRGMLQLNSGE−−SLKLHFNKDVLLNDIILLCQE                
fig|339671.5.peg.1037   Actinobacillus succinogenes 130Z     YQLNLTKYLCPLPIVMTKRAMMELAVGD−−SLTLDMNHSTSMRDIRQLCEQ                
fig|339671.7.peg.1115   Actinobacillus succinogenes 130Z     YQLNLTKYLCPLPIVMTKRAMMELAVGD−−SLTLDMNHSTSMRDIRQLCEQ                
fig|669262.3.peg.1463   Mannheimia haemolytica serotype A2 str. BOVINE     YSLDLTDYACPLPLLMAKKAMNDLKKGD−−SLEILLNQQSSLTDFELLAKEQ               
fig|272629.3.peg.1344   Mannheimia haemolytica PHL213     YVLDLTGYACPLPLLMAKKAMNDLKKGD−−SLEILLNQQSSLTDFELLAKEQ               
fig|221988.1.peg.1466   Mannheimia succiniciproducens MBEL55E     YRLDLTGYICPLPLLMARQVLDKLEKGA−−ILTLFLNHTSAVTDFVSLCEQQGYQLI         
fig|221988.4.peg.1422   Mannheimia succiniciproducens MBEL55E     YRLDLTGYICPLPLLMARQVLDKLEKGA−−ILTLFLNHTSAVTDFVSLCEQQGYQLI         
fig|396588.3.peg.65   Thioalkalivibrio sp. HL-EbGR7     YMLNVTGYTCPHPQMYTKKALQKIESGS−−VLTLVFDNPSSGESIISMCESEGNEL          
fig|396588.4.peg.64   Thioalkalivibrio sp. HL-EbGR7     YMLNVTGYTCPHPQMYTKKALQKIESGS−−VLTLVFDNPSSGESIISMCESEGNEL          
fig|178306.1.peg.1838   Pyrobaculum aerophilum str. IM2     YELDLKGYVCPYPQMYTSQALSKLPKGS−−VLKVIIDNPPSIENIKSVAQKA               
fig|410359.7.peg.1552   Pyrobaculum calidifontis JCM 11548     YELDLKGFVCPYPQMYTAQALKSIKKGE−−VLVVYTDNPPSCDNIKSVAERNGSKVV         
fig|397948.3.peg.839   Caldivirga maquilingensis IC-167     YVVDLRGLICPYPQLYTAKVIKSVEDGA−−VIDILVDYPASCQTIP                     
fig|397948.3.peg.571   Caldivirga maquilingensis IC-167     YELDLRGYACPYPVLFTRKYFTQLSRGD−−EVEILIDNPLSCETVPAAVEELNGEVI         
fig|410359.7.peg.1543   Pyrobaculum calidifontis JCM 11548     RVLDLRGYVCPYPQLATVKALREMAVGE−−VLEVITDNPPSCENVPAVARREGQEVV         
fig|340102.3.peg.1160   Pyrobaculum arsenaticum DSM 13514     YVLDLKGRVCPYPQLATLRAIRALPPGS−−TLEVITDNPPSCENVPAVARREGKEVL         
fig|178306.1.peg.1819   Pyrobaculum aerophilum str. IM2     YVLDLRGYVCPYPQLATVRAMRKLPKGS−−VLEVITDNPPSCENVPAVARREGG            
fig|224325.1.peg.163   Archaeoglobus fulgidus DSM 4304     HELDCRNMVCPYPVIITKLAMQKVDR−−−−−−LEVLTNNPPSVRDIEKIAEKE               
fig|481743.5.peg.2919   Geobacillus sp. Y412MC10      TLDLRGESCPYPVIYTLETLRDMKKGQ−−TLQVISDCPSAFRNVPEEVVKHGYTM          
fig|635013.3.peg.2878   Thermincola sp. JR      VLDLRGEPCPYPLIYSLETLGKMQPGQ−−TLEVLADCPQSFRTVPEEAVKHGYIVL         
fig|246194.6.peg.28   Carboxydothermus hydrogenoformans Z-2901     YVLDLRGEPCPYPVVYSLQVLAELESGA−−LLEILADCPQSFKSVPEEVVKAGYEMV         
fig|471857.4.peg.1585   Saccharomonospora viridis DSM 43017     YRLDIRGEVCPYPVIYSLEALASMEAGQ−−VLEVVADCPQSFRNVPEEAVKHGYQLV         
fig|1071395.3.peg.1276   Bacillus coagulans XZL4      TLDVRGESCPYPELYTLEAIEKLEDGK−−ILEVIADCPQSFINVPASCKRHGHEVL         
fig|1245026.4.peg.1376   Bacillus coagulans XZL9      TLDVRGESCPYPELYTLEAIEKLEDGK−−ILEVIADCPQSFINVPASCKRHGHEVL         
fig|345219.8.peg.3574   Bacillus coagulans 36D1      TLDVRGESCPYPELYTLEAIEKLEDGK−−ILEVIADCPQSFINVPASCKRHGHEVL         
fig|1198629.3.peg.2172   Pseudomonas aeruginosa MRW44.1       LDLRGEHCPYNAIATLETLATMQPGE−−RLEVVTDCSQSVHGIPEDTQRQGYKCL         
fig|983919.3.peg.1285   Pseudomonas aeruginosa 152504       LDLRGEHCPYNAIATLETLATMQPGE−−RLEVVTDCSQSVHGIPEDTQRQGYKCL         
fig|381754.5.peg.1450   Pseudomonas aeruginosa PA7       LDLRGEHCPYNAIATLETLATMQPGE−−RLEVVTDCSQSVHGIPEDTQRQGYKCL         
fig|208963.12.peg.1412   Pseudomonas aeruginosa UCBPP-PA14       LDLRGEHCPYNAIATLETLATMQPGE−−RLEVVTDCSQSVHGIPEDTQRQGYKCL         
fig|379731.4.peg.820   Pseudomonas stutzeri A1501       LDLRGEHCPYNAIATLETLATMQPGQ−−LLEVVTDCSQSVHGIPEDATAKGYNCL         
fig|379731.5.peg.820   Pseudomonas stutzeri A1501       LDLRGEHCPYNAIATLETLATMQPGQ−−LLEVVTDCSQSVHGIPEDATAKGYNCL         
fig|228410.1.peg.1944   Nitrosomonas europaea ATCC 19718       LDLRGEHCPYNAIATLEALADMTAGQ−−VLEVITDCAQSVNGIPEDARAKGYDCL         
fig|395494.3.peg.1751   Gallionella ferruginea ES-2     YHLDLMGETCPYVAIATLEAMAQLQPGE−−ILEIVTRCSQSINNVPPDAVNHGFQVL         
fig|458817.3.peg.500   Shewanella halifaxensis HAW-EB4     YNLEIYGEPCPYPAVATLEAMQSLKPGE−−VLEVITDCSQSINNIPNDAKNHGYEVL         
fig|398579.7.peg.462   Shewanella pealeana ATCC 700345     YNLEIYGEPCPYPAVATLEAMQSLKAGE−−VLEVITDCSQSINNIPNDAKNHGYEVL         
fig|314608.4.peg.1810   Shewanella benthica KT99     YNLEIFGESCPYPAVATLEAMESLKKGE−−ILEVVTDCGQSINNIPPDAKNHGYTVL         
fig|407148.6.peg.1414   Campylobacter jejuni subsp. jejuni 81116     YSLNLQGEACPYPAIATLDVLPKLQSGE−−ILEVLCDCPQSINSIPQDAKNRGFKVL         
fig|683082.3.peg.1146   Campylobacter jejuni subsp. jejuni 1336     YSLNLQGEACPYPAIATLDVLPKLQSGE−−ILEVLCDCPQSINSIPQDAKNRGFKVL         
fig|360109.7.peg.1845   Campylobacter jejuni subsp. doylei 269.97     YSLNLQGEACPYPAIATLDVLPQLQSGE−−ILEVLCDCPQSINSIPQDAKNRGFKVL         
fig|683083.3.peg.1088   Campylobacter jejuni subsp. jejuni 414     YSLNLQGEACPYPAIATLDVLPQLKSGE−−ILEVLCDCPQSINSIPQDAKNRGFKVL         
fig|306264.1.peg.260   Campylobacter upsaliensis RM3195     YSLNLEGEACPYPAIATLDALDELKSGE−−ILEVLCDCPQSIHSIPNDVKNRGSKVL         
fig|887287.3.peg.865   Campylobacter coli 84-2     YTLNLEGEACPYPAIATLDALPQLKSGE−−ILEVLCDCPQSINSIPQDAKNRGFKIL         
fig|306263.5.peg.367   Campylobacter lari RM2100     YSLNLEGEACPYPAIATIDALKELKSGE−−VLEILCDCPQSINSIPQDAKNRGFEIL         
fig|1295400.3.peg.1285   Campylobacter jejuni subsp. jejuni ICDCCJ07004     YSLNLQGEACPYPAIATLDVLPKLKSGE−−ILEVLCDCPQSINSIPQDAKNRGFKVL         
fig|885273.3.peg.959   Campylobacter jejuni subsp. jejuni P110B     YSLNLQGEACPYPAIATLDVLPKLKSGE−−ILEVLCDCPQSINSIPQDAKNRGFKVL         
fig|885274.3.peg.521   Campylobacter jejuni subsp. jejuni H22082     YSLNLQGEACPYPAIATLDVLPKLKSGE−−ILEVLCDCPQSINSIPQDAKNRGFKVL         
fig|1293289.3.peg.1440   Campylobacter jejuni str. NCCP No. 15742     YSLNLQGEACPYPAIATLDVLPKLKSGE−−ILEVLCDCPQSINSIPQDVKNRGFKVL         
fig|360112.4.peg.201   Campylobacter jejuni subsp. jejuni HB93-13     YSLNLQGEACPYPAIATLDVLPKLKSGE−−ILEVLCDCPQSINSIPQDVKNRGFKVL         
fig|718271.4.peg.1569   Campylobacter jejuni subsp. jejuni S3     YSLNLQGEACPYPAIATLDVLPKLKSGE−−ILEVLCDCPQSINSIPQDVKNRGFKVL         
fig|889213.3.peg.1148   Campylobacter jejuni subsp. jejuni 129-258     YSLNLQGEACPYPAIATLDVLPKLKSGE−−ILEVLCDCPQSINSIPQDVKNRGFKVL         
fig|478547.3.peg.1581   Campylobacter jejuni subsp. jejuni CG8421     YSLNLQGEACPYPAIATLDVLPKLKSGE−−ILEVLCDCPQSINSIPQDVKNRGFKVL         
fig|360106.6.peg.579   Campylobacter fetus subsp. fetus 82-40     YTLDIQGEACPMPAVATLEVLPTMKRGE−−VLEVLCDCPQAINSIPVDAKNRGFEVL         
fig|235279.1.peg.1299   Helicobacter hepaticus ATCC 51449      RLDLQGEPCPYPAVRTLEVLPELKSGE−−ILEVLSDCPQSINNIPIDAKNHGYEVL         
fig|217.1.peg.1254   Helicobacter mustelae 43772     YHINLLGEPCPYPAIKTMEALQKLQKGE−−ILQIISDCPQSIHAIPLDAKNYGYDVL         
fig|572480.3.peg.3093   Arcobacter nitrofigilis DSM 7299     YRIDMQGEPCPYPAVKTLEAMKELKEGE−−ILEIISDCPQSIHNIPQDAKNHGYKVL         
fig|326298.3.peg.1120   Thiomicrospira denitrificans ATCC 33889     HRLDMHGEPCPYPAIKTLEALRSIGDDD−−ILEIISDCPQSINNIPIDVRNHGFKVL         
fig|439483.4.peg.1825   Campylobacterales bacterium GD 1     HRLDMHGEPCPYPAIKTLEALRSLNDDD−−ILEIISDCPQSINNIPIDVRNHGFKVL         
fig|929558.5.peg.111   Sulfurimonas sp. GD1     HRLDMHGEPCPYPAIKTLEALRSLNDDD−−ILEIISDCPQSINNIPIDVRNHGFKVL         
fig|367737.6.peg.2250   Arcobacter butzleri RM4018     YRIDMQGEPCPYPAINTLEAMKELKDGE−−ILEVISDCPQSINNIPADAKNHGYKVL         
fig|944546.4.peg.2144   Arcobacter butzleri ED-1     YRIDMQGEPCPYPAINTLEAMKELKDGE−−ILEVISDCPQSINNIPADAKNHGYKVL         
fig|402882.10.peg.187   Shewanella baltica OS185     YQLDMVGEPCPYPAVATLEAMPKLKPGE−−ILEVISDCPQSINNIPLDAKNHGYKVL         
fig|693973.4.peg.1943   Shewanella baltica OS678     YQLDMVGEPCPYPAVATLEAMPKLKPGE−−ILEVISDCPQSINNIPLDAKNHGYKVL         
fig|211586.9.peg.101   Shewanella oneidensis MR-1     YQLDMVGEPCPYPAVATLEAMPTLKPGE−−ILEVISDCPQSINNIPLDAKNHGYKVL         
fig|60480.19.peg.114   Shewanella sp. MR-4     YQLDMVGEPCPYPAVATLEAMPTLKPGE−−ILEVISDCPQSINNIPLDAKNHGYKVL         
fig|60481.13.peg.116   Shewanella sp. MR-7     YQLDMVGEPCPYPAVATLEAMPTLKPGE−−ILEVISDCPQSINNIPLDAKNHGYKVL         
fig|399741.7.peg.527   Serratia proteamaculans 568     YRLDMLGEPCPYPAVATLEAMPQLKPGE−−ILEVISDCPQSINNIPLDARNHGYKVL         
fig|1162294.5.peg.3121   Serratia marcescens LCT-SM213     YRLDMLGEPCPYPAVATLEAMPQLKPGE−−ILEVISDCPQSINNIPLDARNHGYKVL         
fig|1218513.3.peg.1381   Serratia marcescens W2.3     YRLDMLGEPCPYPAVATLEAMPQLKPGE−−ILEVISDCPQSINNIPLDARNHGYKVL         
fig|615.1.peg.4397   Serratia marcescens Db11     YRLDMLGEPCPYPAVATLEAMPQLKPGE−−ILEVISDCPQSINNIPLDARNHGYKVL         
fig|1206776.3.peg.454   Serratia plymuthica A30     YRLDMLGEPCPYPAVATLEAMPQLKPGE−−ILEVISDCPQSINNIPLDARNHGYKVL         
fig|682634.3.peg.4480   Serratia odorifera 4Rx13     YRLDMLGEPCPYPAVATLEAMPQLKPGE−−ILEVISDCPQSINNIPLDARNHGYKVL         
fig|667129.3.peg.73   Serratia odorifera DSM 4582     YRLDMLGEPCPYPAVATLEAMPQLKPGE−−VLEVISDCPQSINNIPLDARNHGYQVL         
fig|335283.5.peg.1213   Nitrosomonas eutropha C91      RLDMIGEPCPYPAVATLEAMPQLRPGQ−−ILEVISDCPQSINNIPIDARNHGYEVL         
fig|335283.9.peg.1269   Nitrosomonas eutropha C91      RLDMIGEPCPYPAVATLEAMPQLRPGQ−−ILEVISDCPQSINNIPIDARNHGYEVL         
fig|527004.3.peg.3175   Yersinia rohdei ATCC 43380     YRLDMVGEPCPYPAVATLEAMPQLQPGE−−ILEVISDCPQSINNIPLDARNYGYKVL         
fig|527005.3.peg.3294   Yersinia ruckeri ATCC 29473     YRLDMVGEPCPYPAVATLEAMPQLRPGE−−ILEVISDCPQSINNIPLDARNYGYKVL         
fig|520999.6.peg.172   Providencia alcalifaciens DSM 30120     YRLDMVGEPCPYPAVATLEAMPSLKPGE−−ILEVVSDCPQSINNIPLDAKNYGYKVL         
fig|500637.6.peg.415   Providencia rustigianii DSM 4541     YRLDMVGEPCPYPAVATLEAMPSLKPGE−−ILEVVSDCPQSINNIPLDAKNYGYKVL         
fig|500637.6.peg.6675   Providencia rustigianii DSM 4541     YRLDMVGEPCPYPAVATLEAMPSLKPGE−−ILEVVSDCPQSINNIPLDAKNYGYKVL         
fig|349966.3.peg.2953   Yersinia frederiksenii ATCC 33641     YRLDMVGEPCPYPAVATLEAMPQLKPGE−−ILEVISDCPQSINNIPLDARNYGYTVL         
fig|1194086.3.peg.3875   Yersinia enterocolitica subsp. enterocolitica WA-314     YRLDMVGEPCPYPAVATLEAMPQLKPGE−−ILEVISDCPQSINNIPLDARNYGYTVL         
fig|1286086.3.peg.2234   Yersinia pseudotuberculosis B-6863     YRLDMVGEPCPYPAVATLEAMPQLKPGE−−ILEVISDCPQSINNIPLDARNYGYTVL         
fig|502800.3.peg.3848   Yersinia pseudotuberculosis YPIII     YRLDMVGEPCPYPAVATLEAMPQLKPGE−−ILEVISDCPQSINNIPLDARNYGYTVL         
fig|547046.3.peg.2438   Yersinia pestis biovar Orientalis str. PEXU2     YRLDMVGEPCPYPAVATLEAMPQLKPGE−−ILEVISDCPQSINNIPLDARNYGYTVL         
fig|273123.10.peg.510   Yersinia pseudotuberculosis IP 32953     YRLDMVGEPCPYPAVATLEAMPQLKPGE−−ILEVISDCPQSINNIPLDARNYGYTVL         
fig|349967.3.peg.1226   Yersinia mollaretii ATCC 43969     YRLDMVGEPCPYPAVATLEAMPQLKPGE−−ILEVISDCPQSINNIPLDARNYGYTVL         
fig|527012.3.peg.3142   Yersinia kristensenii ATCC 33638     YRLDMVGEPCPYPAVATLEAMPQLKPGE−−ILEVISDCPQSINNIPLDARNYGYTVL         
fig|349968.5.peg.2728   Yersinia bercovieri ATCC 43970     YRLDMVGEPCPYPAVATLEAMPQLKLGE−−ILEVISDCPQSINNIPLDARNYGYTVL         
fig|272629.3.peg.1543   Mannheimia haemolytica PHL213     YTLDTLGEPCPYPAITMLETMPQLQKGE−−ILELLSDCSQSINNIPIDTKNHGYTLL         
fig|669262.3.peg.1477   Mannheimia haemolytica serotype A2 str. BOVINE