svr_fids_for_md5

Output the FIG IDs and functional assignments of all features that produce a specific protein. This script takes as input a single protein sequence on the command-line or a FASTA file. It outputs a tab-delimited file connecting each specified protein to its features.

------ Example:

    svr_find_protein MENIIARRYAKAIASRADINDFYQNLCILNFAFVLPKFKNIIESNEIKKERKMEFLDSFFDIKNSSFQNFLRLLIENSRLECIPQIVKELERQKAFKENIFVGIVYSKEKLSQENLKDLEVKLNKKFDANIKLNNKISQDDSVKIELEELGYELSFSMKALQNKLNEYILKII

or

    svr_find_protein < prots.fasta > fids.tbl
------

Command-Line Options

-n

If specified and the protein is provided as a parameter (instead of a FASTA file provided as input), then the name to be given to the protein in the output file.

Output Format

The standard output is a tab-delimited file with four columns: (1) the protein ID, (2) the FIG ID of a gene that produces the protein, (3) the name of the genome containing the gene, and (4) the functional assignment of the gene. There will frequently be multiple features for a single protein.

POD ERRORS

Hey! The above document had some coding errors, which are explained below:

Around line 55:

=back without =over