The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|979211.3.peg.2267: Staphylococcus epidermidis NIHLM023

This feature in The SEED Viewer

NCBI Taxonomy Id: 979211

Current Assignment: Hypothetical protein SAV2327
Translate Function Assignments



Context on contig AKGU01000071 from base 24382 to 35905 (11524 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2262 25530 24382 1149 -           FIG01108370: hypothetical protein locus|HMPREF9983_11738, protein_id|EJE04412.1, gi|394259572
2263 25778 26713 936 + 247     1: 1   Formiminoglutamase (EC 3.5.3.8) gene_name|hutG, locus|HMPREF9983_11743, protein_id|EJE04413.1, gi|394259573
2264 27185 28303 1119 + 471         N-acetyl-L,L-diaminopimelate deacetylase homolog (EC 3.5.1.18) locus|HMPREF9983_11748, protein_id|EJE04414.1, gi|394259574
2265 28389 29270 882 + 85         Dehydrogenase locus|HMPREF9983_11753, protein_id|EJE04415.1, gi|394259575
2266 29552 30163 612 + 281         Nitrilotriacetate monooxygenase component B (EC 1.14.13.-) locus|HMPREF9983_11758, protein_id|EJE04416.1, gi|394259576
2267 30207 30806 600 + 43         Hypothetical protein SAV2327 locus|HMPREF9983_11763, protein_id|EJE04417.1, gi|394259577
2268 31101 32402 1302 + 294     1: 2   Methionine transporter MetT locus|HMPREF9983_11768, protein_id|EJE04418.1, gi|394259578
2269 32700 33212 513 + 297         Hypothetical protein SAV2325 locus|HMPREF9983_11773, protein_id|EJE04419.1, gi|394259579
2270 34118 33357 762 - 144         Transcriptional regulator GlvR, RpiR family locus|HMPREF9983_11778, protein_id|EJE04420.1, gi|394259580
2271 34316 35905 1590 + 197         PTS system, maltose and glucose-specific IIC component (EC 2.7.1.69) / PTS system, maltose and glucose-specific IIB component (EC 2.7.1.69) gene_name|glvC, locus|HMPREF9983_11783, protein_id|EJE04421.1, gi|394259581

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|979211.3.peg.2267 Hypothetical protein SAV2327
MKAYLYKFMPLLILVIGLIILYVINDYPTLLHVIVIIVFITSGLKNVYFVNNNIRNHIIW
MSPKLDRILGMLSGILYSGIYWVSFIKQQPLWIVILILVLTVGTAVLLETKLHITSLQLE
ERLSSERIKRKVISRHKAQRLKNIFFTVIVVVIISMLISLYLKLMVIFGIALAIFILASI
SVAIFEKYFTIYWKYVNYY

MD5 = 9ee70aa0cc4cf605d61ac50105ea050e


  DNA Sequence

>fig|979211.3.peg.2267 Hypothetical protein SAV2327
atgaaagcatatctatataaattcatgccgttgctcattttagttataggactgattatc
ttatacgttattaatgattatcccacattgttacatgtcatagtgattattgtttttata
acgagtggattgaaaaatgtatactttgttaataataatattagaaatcatatcatatgg
atgagccctaaactcgatcgtatccttggtatgctttcgggcatactatattctggcatt
tactgggttagctttataaagcaacagcctttatggatagtaatacttattctggtatta
acagtgggtactgcagttttattagaaacgaaattacatattacatcacttcaattagag
gagaggttatcatctgaacggataaaacgtaaagtaatttcaagacataaggcacaacgt
cttaagaatatattttttactgtgattgttgtagtaatcatttcaatgctcatatcatta
tatttaaagttaatggttatttttggaattgcattggcgatattcatccttgcatcaatc
agtgtggctatttttgaaaaatactttactatatattggaaatatgtaaactattattaa


  DNA with Flanking Sequence

>fig|979211.3.peg.2267 Hypothetical protein SAV2327
tacaccacctatgatcgcaattgctgttcaacgtacaaatggaaatagaaaagacacctc
aataaatatagaacaatcaggtgagtttgcagtgcatattactgatgaggctattgttaa
tgatgtgaatgaaactgctgccccgttagaatatggtgttaatgaacttaagagaacttc
tctaagcatgattgattctgatttaattaacgttccagcaatcaaagaagcaaaagtaag
gtttgagtgtaagcttcatcaaatagtacaattgggcaacaaagataacgggagtgattt
gataattggtgaaattgtcatgtaccatattgatgaagaagtttattttgaagatagtaa
aattgatgcaaatcaattaaatccggtagctaggttagctggaaatgattactctttgtt
aggtcaaacatttacagttaatcgtcctacttcataaagataaaaagatatttacaaata
tcattttaagggtgtcattgatgaaagcatatctatataaattcatgccgttgctcattt
tagttataggactgattatcttatacgttattaatgattatcccacattgttacatgtca
tagtgattattgtttttataacgagtggattgaaaaatgtatactttgttaataataata
ttagaaatcatatcatatggatgagccctaaactcgatcgtatccttggtatgctttcgg
gcatactatattctggcatttactgggttagctttataaagcaacagcctttatggatag
taatacttattctggtattaacagtgggtactgcagttttattagaaacgaaattacata
ttacatcacttcaattagaggagaggttatcatctgaacggataaaacgtaaagtaattt
caagacataaggcacaacgtcttaagaatatattttttactgtgattgttgtagtaatca
tttcaatgctcatatcattatatttaaagttaatggttatttttggaattgcattggcga
tattcatccttgcatcaatcagtgtggctatttttgaaaaatactttactatatattgga
aatatgtaaactattattaaaatatttaaaataataagtgttgacgttattgcaaatatc
ttgtaacgttaaacacaattcaataacttatcaagagaagtggagggactggcccaaaga
agcttcggcaacattgtatcatgtgccaattccagtaaccgagaaggttagaagataagg
ttaaacacgatgttaactgagactggggcatgattacgtgtcctggttttttatttttga
gttattgattaaatagataggaattttttagtataaaatctatcaatccattatacggga
aagtaggttagattatgaaagagatgaagaatggcaatgcttgggcattaattcctttat
tgttatttgtcttactatttctaggtgttggtattatttctggtgattttaccactatgc
cattaaatgttgctattacaattactgttattgttgccttactgatgaatcgcaaggaaa
cttttgcgaaaaaagtagaggtatttacaaaaggtgcagg


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search