The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|97393.1.peg.708: Ferroplasma acidarmanus

This feature in The SEED Viewer

NCBI Taxonomy Id: 97393

Current Assignment: Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
Translate Function Assignments



Context on contig NZ_AABC03000003 from base 73032 to 85559 (12528 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
703 73032 75071 2040 +           Aerobic carbon monoxide dehydrogenase molybdopterin-binding subunit-like protein  
704 75158 75772 615 + 86     1: 3   hypothetical protein  
705 76548 75685 864 - -88         Mobile element protein  
706 77456 76698 759 - 149     1: 3   Ribonuclease Z (EC 3.1.26.11)  
707 77612 78994 1383 + 155     2: 10 7   Uncharacterized MFS-type transporter  
708 79110 80315 1206 + 115     8: 11 15 19 9 12 20 18 17 ff
ilit(
6751404)
isu
isu
isu
Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)  
709 80589 80320 270 - 4     1: 14   Acylphosphate phosphohydrolase (EC 3.6.1.7)  
710 81271 80624 648 - 34         Bacterio-opsin activator domain-containing protein  
711 81394 82827 1434 + 122     6: 2 5 7 4 1 6 ff
icw(1)
icw(1)
icw(1)
icw(1)
Cytochrome bd-II ubiquinol oxidase subunit 1 (EC 7.1.1.3)  
712 82828 83922 1095 + 0     5: 2 5 4 1 6 ff
icw(1)
icw(1)
icw(1)
icw(1)
Cytochrome bd-II ubiquinol oxidase subunit 2 (EC 7.1.1.3)  
713 85020 83938 1083 - 15     2: 13 16 ff
ilit(
19448108)
isu
isu
GTP-binding protein RBG1/RBG2  
714 85559 85017 543 - -4     1: 8   eRF1 methyltransferase catalytic subunit MTQ2  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Threonine_degradation OlgaV Threonine dehydratase, catabolic (EC 4.3.1.19)
YggSProC belyacoubi Threonine dehydratase, catabolic (EC 4.3.1.19)
Glycine_and_Serine_Utilization OlgaZ Threonine dehydratase, catabolic (EC 4.3.1.19)
Branched-Chain_Amino_Acid_Biosynthesis SvetaG Threonine dehydratase, catabolic (EC 4.3.1.19)
RidA_family_in_981_representative_prokaryotes Niehaus_Tom_user Threonine dehydratase, catabolic (EC 4.3.1.19)
RidA_family_in_981_representative_prokaryotes Niehaus_Tom_user L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
AdiR Ernst_Dustin_user Threonine dehydratase, catabolic (EC 4.3.1.19)
GB_RidA_family_in_981_representative_prokaryotes Beaudoin_Guillaume_user Threonine dehydratase, catabolic (EC 4.3.1.19)
GB_RidA_family_in_981_representative_prokaryotes Beaudoin_Guillaume_user L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
COG2945 Niehaus_Tom_user Threonine dehydratase, catabolic (EC 4.3.1.19)
COG2945 Niehaus_Tom_user L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)


  Protein Sequence

>fig|97393.1.peg.708 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
MLSYDRIVRAGNEIKGKIHRTPLFHSTTFSNMFSCDVYFKMENFQKTGSFKSRGAMVKFS
TLTAEQKKNGVITASAGNHAQGVAFAASYYGVDAKIVMPETTPPAKVNAVQSYGGTVILK
GNSYDEAHEYAVQVSVDEKREFIEAYNDEDVIAGQGTIGLEILEDVKPDIVIVPIGGGGL
ISGISFAIKSKNKDIKIIGVESEKANAMELSIKEGKIVPYTSNDTIADGIAVKYPGNITF
ELVKKYVDGVVTVSDENIAYALFKLLEREKVLVEPSGAAGLAALFENKIDVKGKKVVIVL
SGGNVNFLLLSNIIYRALEMENKLLRLEFNLPDHPGIMEKIVNAISSSGANIYHAEVDNL
NKDTPIGYQYLLFTINILDKSRIDELLGSLDKLGYKYRIIG

MD5 = d47f78e9d88d92d3a9ae08164c0e92a6


  DNA Sequence

>fig|97393.1.peg.708 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
atgttaagttatgatagaatagtcagagcaggaaatgagataaaggggaagatacataga
acgccattattccattcaacaacattcagcaatatgttttcatgtgacgtttactttaaa
atggagaattttcagaagacggggtctttcaaatccagaggagctatggtaaaattttca
acgttgaccgctgaacagaaaaaaaatggagtaataaccgccagtgcaggaaatcacgca
cagggagtggcttttgcggcttcctattatggcgttgatgcaaaaattgtcatgcctgaa
acaacaccgcctgccaaggtaaacgctgtccaatcctatggcggcacagttatactaaag
ggcaatagctacgacgaagcacatgaatatgcggtacaggtttcagtggacgagaaaagg
gaatttattgaagcttataacgatgaggatgttattgccgggcaggggacaataggcctt
gaaattttagaagatgtgaaaccggacattgtaatagtgccaataggtggtggagggctt
atttcagggatatcatttgcaattaaatcaaaaaacaaggatataaaaataataggggta
gagtccgaaaaggcaaatgccatggaattatctataaaggaaggcaaaatagttccatac
accagcaacgatacaattgctgatggaatcgccgtaaaatatccgggaaatataacattt
gaactggtaaagaaatatgtggatggagttgttacagtatcggatgagaatattgcatat
gcactattcaagctgcttgaaagggaaaaagtgcttgtggagccttccggcgcagctggc
cttgcagcattatttgaaaataaaattgatgttaagggcaagaaagttgttattgtactt
tcaggagggaacgtaaacttcctactgctgtcaaacataatatacagggcgcttgaaatg
gaaaacaagttgcttcgccttgaattcaatctgcctgaccacccgggtataatggaaaaa
atagtaaatgccatatcatcttccggagccaatatataccatgctgaggtggataattta
aacaaggatacgcctataggataccagtatctcctattcacaataaacatccttgacaaa
tcgagaatagatgaattgctcgggagcctcgataaacttggctataaataccggataata
ggatag


  DNA with Flanking Sequence

>fig|97393.1.peg.708 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
ttacgttcctgataggtcagcatttataacagatggaatcctcatatttgcactgtttct
aatattttatataactgaagcaataggaccaggttctactgattttgtttacccggtaga
acttttccccacggaagacagggcaagtgcacagggattcgggacatcagttagccgtat
cggggctattcttggcattacaacgttcccgtttattgtttcaatctatggcttcagcac
cagccttttcttcttcaccggtttatctgtaattggcttgcttgctaccatattccttgc
tactgaaacaaagggaaaaacacttgagcaggttaatgaaatagaggagggaaaaattag
caaatttaaagccggggcaaaataattttaaaattttttgtaatttaaacattaagctaa
aagccataatacgttaatttatatattttccattcaggtttcattcaaagcatatatatg
tatcaacgcaatccaaatctatgttaagttatgatagaatagtcagagcaggaaatgaga
taaaggggaagatacatagaacgccattattccattcaacaacattcagcaatatgtttt
catgtgacgtttactttaaaatggagaattttcagaagacggggtctttcaaatccagag
gagctatggtaaaattttcaacgttgaccgctgaacagaaaaaaaatggagtaataaccg
ccagtgcaggaaatcacgcacagggagtggcttttgcggcttcctattatggcgttgatg
caaaaattgtcatgcctgaaacaacaccgcctgccaaggtaaacgctgtccaatcctatg
gcggcacagttatactaaagggcaatagctacgacgaagcacatgaatatgcggtacagg
tttcagtggacgagaaaagggaatttattgaagcttataacgatgaggatgttattgccg
ggcaggggacaataggccttgaaattttagaagatgtgaaaccggacattgtaatagtgc
caataggtggtggagggcttatttcagggatatcatttgcaattaaatcaaaaaacaagg
atataaaaataataggggtagagtccgaaaaggcaaatgccatggaattatctataaagg
aaggcaaaatagttccatacaccagcaacgatacaattgctgatggaatcgccgtaaaat
atccgggaaatataacatttgaactggtaaagaaatatgtggatggagttgttacagtat
cggatgagaatattgcatatgcactattcaagctgcttgaaagggaaaaagtgcttgtgg
agccttccggcgcagctggccttgcagcattatttgaaaataaaattgatgttaagggca
agaaagttgttattgtactttcaggagggaacgtaaacttcctactgctgtcaaacataa
tatacagggcgcttgaaatggaaaacaagttgcttcgccttgaattcaatctgcctgacc
acccgggtataatggaaaaaatagtaaatgccatatcatcttccggagccaatatatacc
atgctgaggtggataatttaaacaaggatacgcctataggataccagtatctcctattca
caataaacatccttgacaaatcgagaatagatgaattgctcgggagcctcgataaacttg
gctataaataccggataataggataggcaattaatcccttattatttcaaaagaatcaaa
attagcatcatcggctggcatggattcaacagatgataattctgctaaggggatttttct
gcaatagccatccataattgatatcatttcctcatcccctgaaaacacagcagaaacaga
gccatcctgattatttttaacccagccctttatgcccagctctactgcctttttcttcac
atgtgccctgaagccaattccctgtacagtgccatgaaatacaaatttaactgttgacat
aatggatcatcatacttttcaataaatttttttctcatagcttattttcaatgtattccc
ctacaattttacggagtgtctttcttaatatttccgacagtgctgcggttgaaatgtcta
actgttccgctatttcagtcaggctcagcttccgttccgggtcaaagtatccttcgtcgt
atagcctgactatgatctctgcttccctgtgtgttatgccgaaatt


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
gi|257076088 Ferroplasma acidarmanus fer1 NCBI   threonine dehydratase
img|638393831 Ferroplasma acidarmanus Fer1 IMG   Threonine dehydratase II
ref|ZP_05570449.1 Ferroplasma acidarmanus fer1 RefSeq   threonine dehydratase


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value
CDD::30381 969.200;12-300
CDD::30844 970.100;20-302
CDD::40387 945.100;14-303
evidence_code ff
evidence_code ilit(6751404);fig|99287.1.peg.3134
evidence_code isu;Branched-Chain_Amino_Acid_Biosynthesis
evidence_code isu;Glycine_and_Serine_Utilization
evidence_code isu;Threonine_degradation
GO GO:0004794 threonine ammonia-lyase activity
IPR::IPR000634_interpro_download 0.0;42-55
IPR::IPR001926_interpro_download 318.0;14-303
IPR::IPR002912_interpro_download 225.1;110-333
IPR::IPR002912_interpro_download 24.2;325-395
IPR::IPR005789_interpro_download 327.6;4-353
IPR::IPR005789_interpro_download 400.3;29-352
IPR::IPR005789_interpro_download 662.2;21-399
isoelectric_point 6.28
molecular_weight 43842
PANTHER::PTHR10314_interpro_download 400.3;29-352
PFAM::PF00291 908.170;14-303
PFAM::PF00291_interpro_download 318.0;14-303
PFAM::PF01842 0.0;325-395
PFAM::PF01842_interpro_download 225.1;110-333
PFAM::PF01842_interpro_download 24.2;325-395
PROSITE::PS00165_interpro_download 0.0;42-55
similar_to_human yes
SSF::SSF53686_interpro_download 327.6;4-353
TIGRFAMs::TIGR01127_interpro_download 400.3;29-352
TIGRFAMs::TIGR01127_interpro_download 662.2;21-399


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search