The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|931444.3.peg.2213: Staphylococcus aureus subsp. aureus CIG1150

This feature in The SEED Viewer

NCBI Taxonomy Id: 931444

Current Assignment: Cysteine desulfurase (EC 2.8.1.7)
Translate Function Assignments



Context on contig AHVH01000034 from base 111913 to 123040 (11128 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2208 113115 111913 1203 -       2: 1 3   Acetate kinase (EC 2.7.2.1) gene_name|ackA, locus|SACIG1150_2202, protein_id|EHT48585.1, gi|377724469
2209 114150 113203 948 - 87     1: 5   Adenine-specific methyltransferase (EC 2.1.1.72) locus|SACIG1150_2203, protein_id|EHT48586.1, gi|377724470
2210 114767 114273 495 - 122         Thiol peroxidase Tpx (EC 1.11.1.24) gene_name|tpx, locus|SACIG1150_2204, protein_id|EHT48587.1, gi|377724471
2211 115635 114865 771 - 97         Transmembrane protein YfcA locus|SACIG1150_2205, protein_id|EHT48588.1, gi|377724472
2212 116902 115679 1224 - 43 17 1: 4   tRNA 4-thiouridine(8) synthase (EC 2.8.1.4) gene_name|thiI, locus|SACIG1150_2206, protein_id|EHT48589.1, gi|377724473
2213 118068 116902 1167 - -1   1: 2   Cysteine desulfurase (EC 2.8.1.7) locus|SACIG1150_2207, protein_id|EHT48590.1, gi|377724474
2214 120108 118414 1695 - 345 4     Septation ring formation regulator EzrA gene_name|ezrA, locus|SACIG1150_2209, protein_id|EHT48592.1, gi|377724476
2215 120245 120709 465 + 136         L-methionine (R)-S-oxide reductase (EC 1.8.4.14) locus|SACIG1150_2210, protein_id|EHT48593.1, gi|377724477
2216 120953 121555 603 + 243         SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent gene_name|rpsD, locus|SACIG1150_2211, protein_id|EHT48594.1, gi|377724478
2217 122514 121771 744 - 215         Glycerophosphoryl diester phosphodiesterase (EC 3.1.4.46) locus|SACIG1150_2212, protein_id|EHT48595.1, gi|377724479
2218 122594 123040 447 + 79         Organic hydroperoxide resistance protein locus|SACIG1150_2213, protein_id|EHT48596.1, gi|377724480

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
DNA/RNA_S_modification Cysteine desulfurase (EC 2.8.1.7)


  Protein Sequence

>fig|931444.3.peg.2213 Cysteine desulfurase (EC 2.8.1.7)
MINEREVFILIYLDNAATTKAFEEVLDTYLKVNQSMYYNPNSPHKAGLQANQLLQQAKAQ
INAMINSKTNYDVVFTSGATESNNLALKGIAYRKFDTAKEIITSVLEHPSVLEVVRYLEA
HEGFKVKYVDVKKDGSINLEHFKELVSDKVGLVTCMYVNNVTGQIQPIPQMAKVIKNYPK
AHFHVDAVQAFGKISMDLNNIDSISLSGHKFNGLKGQGVLLVNHIQNVEPTVHGGGQEYG
VRSGTVNLPNDIAMVKAMKIANENFEALNAFVTELNNDVRQFLNKYHGVYINSSTSGSPF
VLNISFPGVKGEVLVNAFSKYDIMISTTSACSSKRNKLNEVLAAMGLSDKSIEGSIRLSF
GATTTKEDIARFKEIFIIIYEEIKELLK

MD5 = e9e4f1ad9183b5e834f95c46e4de4863


  DNA Sequence

>fig|931444.3.peg.2213 Cysteine desulfurase (EC 2.8.1.7)
atgattaatgaaagagaagtgtttattttgatatatctagataatgcggcaacgacgaaa
gcatttgaagaagtgttagatacttatttaaaagtaaatcaatcaatgtattataatccg
aatagtccgcataaagctggtttgcaggcaaatcaattactacaacaagcaaaagcccaa
attaatgcaatgattaattcaaaaacaaattatgatgttgtattcactagtggtgcaact
gaatccaataatcttgctttaaaaggtattgcctatcgtaaatttgatacagcgaaggaa
ataattacatccgtgttagagcatccgtccgtattagaggttgtaagatatttggaagca
cacgaaggatttaaagttaaatatgttgatgtaaagaaagatggcagtattaacttagaa
cacttcaaagaattagtgtcagacaaagtcggtttagtaacatgtatgtatgtaaataat
gtaactggacaaatacagcctattccacaaatggctaaagttataaaaaattatcctaag
gcacattttcatgtagatgcggttcaagcattcggcaaaatttcaatggatctcaataac
atagatagtattagtttaagtggacacaagtttaatggtttaaaaggacaaggcgtctta
cttgtaaatcacattcaaaatgttgaaccaactgtccatggtggtggtcaagaatatggc
gttagaagtggaacagttaatttgccaaatgatattgcaatggttaaagcgatgaagata
gctaatgaaaactttgaagcattgaatgcatttgttactgagttaaataatgacgtccgt
caatttttaaataaatatcatggagtttatattaattcttcaacttcaggttcaccattc
gttttaaatattagttttcctggcgtaaaaggtgaagtattagttaatgctttttcaaaa
tatgacattatgatatctacgacgagtgcttgttcatctaaacgtaataaattaaatgaa
gtattggctgcaatgggattatcagacaaatctattgaaggtagtataagattatcattt
ggggctactacaactaaagaagatatagcaaggtttaaagaaatatttatcatcatttat
gaggaaattaaggagttgctaaaataa


  DNA with Flanking Sequence

>fig|931444.3.peg.2213 Cysteine desulfurase (EC 2.8.1.7)
aggactatagcaatgttgataagagcttaaatgaagctgaacgattatttaaaaataatc
gctataagcgtgcgattgaaattgcagagcaagctcttgaaagtgttgagccaggtgtca
ctaaacatattgaagaagaagttattaagcaatagaaactagtatgtagttatacttaaa
taatatgagcactctgtcaaattggactgatgagtttaataattgaagttagccaacgat
acgttgtctagcttctttttttatatggataaatgaaagggacaataaatataaatagca
attgtttaaagataaacgtaatcaaatgtgttgttttaattaatataagtagtgaaaaaa
gcataatcacacagctgtttaaatagagtgaaatagtctaattcttatttaataagtaga
aataagattattttgcgctataacctttattttttgtcggataatagtataatgcttgag
taaaacaattttaacgattgatgattaatgaaagagaagtgtttattttgatatatctag
ataatgcggcaacgacgaaagcatttgaagaagtgttagatacttatttaaaagtaaatc
aatcaatgtattataatccgaatagtccgcataaagctggtttgcaggcaaatcaattac
tacaacaagcaaaagcccaaattaatgcaatgattaattcaaaaacaaattatgatgttg
tattcactagtggtgcaactgaatccaataatcttgctttaaaaggtattgcctatcgta
aatttgatacagcgaaggaaataattacatccgtgttagagcatccgtccgtattagagg
ttgtaagatatttggaagcacacgaaggatttaaagttaaatatgttgatgtaaagaaag
atggcagtattaacttagaacacttcaaagaattagtgtcagacaaagtcggtttagtaa
catgtatgtatgtaaataatgtaactggacaaatacagcctattccacaaatggctaaag
ttataaaaaattatcctaaggcacattttcatgtagatgcggttcaagcattcggcaaaa
tttcaatggatctcaataacatagatagtattagtttaagtggacacaagtttaatggtt
taaaaggacaaggcgtcttacttgtaaatcacattcaaaatgttgaaccaactgtccatg
gtggtggtcaagaatatggcgttagaagtggaacagttaatttgccaaatgatattgcaa
tggttaaagcgatgaagatagctaatgaaaactttgaagcattgaatgcatttgttactg
agttaaataatgacgtccgtcaatttttaaataaatatcatggagtttatattaattctt
caacttcaggttcaccattcgttttaaatattagttttcctggcgtaaaaggtgaagtat
tagttaatgctttttcaaaatatgacattatgatatctacgacgagtgcttgttcatcta
aacgtaataaattaaatgaagtattggctgcaatgggattatcagacaaatctattgaag
gtagtataagattatcatttggggctactacaactaaagaagatatagcaaggtttaaag
aaatatttatcatcatttatgaggaaattaaggagttgctaaaataatgaagtatgatca
cttgcttgttagatacggggagttaacattaaagggttcaaatagaaaaaaatttgtaaa
tcaattaagaaataatgtaaataagtcattaaaaggacttgatgggtttgtcgttaaagg
caaacgagatcgtatgtatattgaacttgaagaccatgcagatataaatgaaataacata
tcgattatcaaaaattttcggtattaaatctattagtccagtattaaaagtagaaaaaac
aatagaggcaatgagtgcagcggcaattaaatttgcgcagcaatttgaagaaaacagcac
atttaaaattgatgtgaagcgtgccgataaaaatttcccaatggatacgtatgaattaca
acgtgaattgggtggtaccgtattgaaacaaattgaaaatgtttctgttaatgtcaaacg
tccagatcatgaaattcgagtggaagttagattagatgcaatttatatgtatgaagaagt
tgttccg


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
17 fig|931444.3.peg.2212 tRNA 4-thiouridine(8) synthase (EC 2.8.1.4)
4 fig|931444.3.peg.2214 Septation ring formation regulator EzrA


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search