The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93062.19.peg.883: Staphylococcus aureus subsp. aureus COL

This feature in The SEED Viewer

NCBI Taxonomy Id: 93062

Current Assignment: Hypothetical SAV0798 homolog in superantigen-encoding pathogenicity islands SaPI
Translate Function Assignments



Context on contig NC_002951 from base 909068 to 920915 (11848 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
876 909068 909937 870 +       1: 1   Hypothetical SAV0790 homolog in superantigen-encoding pathogenicity islands SaPI locus|SACOL0896, protein_id|YP_185767.1, gi|57650169, geneID|3236165
877 909954 911411 1458 + 16     1: 1   Hypothetical SAV0791 homolog in superantigen-encoding pathogenicity islands SaPI locus|SACOL0897, protein_id|YP_185768.1, gi|57650170, geneID|3237134
878 911655 912074 420 + 243     1: 1   Hypothetical SAV0792 homolog in superantigen-encoding pathogenicity islands SaPI locus|SACOL0898, protein_id|YP_185769.1, gi|57650171, geneID|3236093
879 912357 912998 642 + 282     1: 1   Hypothetical SAV0794 homolog in superantigen-encoding pathogenicity islands SaPI locus|SACOL0900, protein_id|YP_185771.1, gi|57651590, geneID|3237768
880 913515 913856 342 + 516     1: 1   Hypothetical SAV0795 homolog in superantigen-encoding pathogenicity islands SaPI locus|SACOL0901, protein_id|YP_185772.1, gi|57651591, geneID|3237769
881 913868 914446 579 + 11     1: 1   Hypothetical SAV0796 homolog in superantigen-encoding pathogenicity islands SaPI locus|SACOL0902, protein_id|YP_185773.1, gi|57651592, geneID|3237770
882 914464 914682 219 + 17     1: 1   Hypothetical SAV0797 homolog in superantigen-encoding pathogenicity islands SaPI locus|SACOL0903, protein_id|YP_185774.1, gi|57651593, geneID|3237771
883 914733 915260 528 + 50     1: 1   Hypothetical SAV0798 homolog in superantigen-encoding pathogenicity islands SaPI locus|SACOL0904, protein_id|YP_185775.1, gi|57651594, geneID|3237772
884 915263 915604 342 + 2     1: 1   Hypothetical SAV0799 homolog in superantigen-encoding pathogenicity islands SaPI locus|SACOL0905, protein_id|YP_185776.1, gi|57651595, geneID|3237774
885 915601 916170 570 + -4     1: 1   Putative terminase, superantigen-encoding pathogenicity islands SaPI locus|SACOL0906, protein_id|YP_185777.1, gi|57651596, geneID|3237775
886 916478 917278 801 + 307     1: 1   Superantigen enterotoxin SEB gene_name|seb, locus|SACOL0907, protein_id|YP_185778.1, gi|57651597, geneID|3237776
887 917913 917356 558 - 77     1: 1   Secreted protein Ear, superantigen-encoding pathogenicity islands SaPI locus|SACOL0908, protein_id|YP_185779.1, gi|57651598, geneID|3237777
888 918621 918806 186 + 707         Phage protein locus|SACOL0911, protein_id|YP_185782.1, gi|57651601, geneID|3237755
889 919637 919831 195 + 830         Uncharacterized UPF0337 protein locus|SACOL0912, protein_id|YP_185783.1, gi|57651602, geneID|3237756
890 920915 920064 852 - 232         FIG01108027: hypothetical protein locus|SACOL0913, protein_id|YP_185784.1, gi|57651603, geneID|3237757

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Staphylococcal_pathogenicity_islands_SaPI SvetaG Hypothetical SAV0798 homolog in superantigen-encoding pathogenicity islands SaPI


  Protein Sequence

>fig|93062.19.peg.883 Hypothetical SAV0798 homolog in superantigen-encoding pathogenicity islands SaPI
MKLLKTKNCLYYRNGDNKLSEYQLLTQFNPAFINKKIKMCEFQIESMYHMSASTTTCDEI
MGVVSVSYPIEKLVIKIIETKAGLQNYKNRSINNMALLKKVLNHYTEKEQKQVVKYMRSN
GRYKPYNVIERLQVDLYQASIKQRSERQKQRNTAIENSKIARVNAYHQSSYVKVV

MD5 = c6a55bf23d73062ca3e7aadba46d59b4


  DNA Sequence

>fig|93062.19.peg.883 Hypothetical SAV0798 homolog in superantigen-encoding pathogenicity islands SaPI
atgaaactgcttaaaacgaagaattgtttatattatcgtaatggcgacaataaactatct
gagtatcaactattaacgcaatttaacccagcatttattaataaaaaaattaagatgtgt
gaattccaaattgaaagtatgtaccatatgagtgcgtcgaccacaacatgtgatgaaata
atgggggtcgtgtctgtctcatatccgattgaaaaattagttatcaaaattattgaaaca
aaagcagggttacaaaactataaaaatagatctataaataatatggcgttgttgaaaaag
gtactaaatcattatacagaaaaagagcagaagcaagttgtaaaatatatgcgttcaaat
ggacgatataagccctacaacgtcattgaacgcttacaagttgatttgtatcaagcaagt
attaaacaacgttcagaacgtcaaaaacaaagaaatacagcaattgaaaacagtaagatt
gcacgagtaaatgcatatcaccaatcttcatatgtaaaagtggtgtaa


  DNA with Flanking Sequence

>fig|93062.19.peg.883 Hypothetical SAV0798 homolog in superantigen-encoding pathogenicity islands SaPI
taatgagatcattgatgaaatagaagatattaatgatagatatgaagatgagcatcagca
atatgcgagtatttatagtcaagaacaattatatgatgataaagaggctagggaagcatt
gaatggctactttagagaaaatatatttacatcatatattaatggtaatgatttgccata
cgaacacaataacaagttgtttttaaaacgttaaaaagaaagggtaattaaatggaaaca
aaatgcgagttaaataatactaaaaaggtcgcaaatgcatttggtttaaatgaagaagat
acaaatctattaataaatgcagttgatttggatattaaaaacaatatgcaggagatttca
agtgagttacaacaatcagaacagtctaagcaaaagcaattaggtacaacgctacaaaat
ttagctaagcaaaacaggattattaaatagcaatgattgcctatccaattcgggtaggct
ctgtttataggggtgaataaatgaaactgcttaaaacgaagaattgtttatattatcgta
atggcgacaataaactatctgagtatcaactattaacgcaatttaacccagcatttatta
ataaaaaaattaagatgtgtgaattccaaattgaaagtatgtaccatatgagtgcgtcga
ccacaacatgtgatgaaataatgggggtcgtgtctgtctcatatccgattgaaaaattag
ttatcaaaattattgaaacaaaagcagggttacaaaactataaaaatagatctataaata
atatggcgttgttgaaaaaggtactaaatcattatacagaaaaagagcagaagcaagttg
taaaatatatgcgttcaaatggacgatataagccctacaacgtcattgaacgcttacaag
ttgatttgtatcaagcaagtattaaacaacgttcagaacgtcaaaaacaaagaaatacag
caattgaaaacagtaagattgcacgagtaaatgcatatcaccaatcttcatatgtaaaag
tggtgtaacaatggataaaaagcaaataaaagacttcgtttgtgattatcataagcgaac
tagaagtgatgtgttgatagatgatgaaataaataccgatgaattcttttcaataggtga
tgaaaattccaatgaatggatggcagacgataacattgatgatcatattgtaaagaatca
cttagaaatcattgttgaccgagtagctaatgataaagagttttatattttcgattcttt
aatacaaggacgtagttttaaagatattagtaatgtcttagagtgttcagaacaatctgt
aagattatggtatgaaaccttattagataaaattgtggaggtgatagaatgagtgagtta
acggcaaaacaagcgcgttttgtgaatgagtatataagaacacttaatgtaacacaaagt
gccataaaagcaggctatagcgcaaatagcgcacatgtgacagggtgtaggttattgaag
aagccacacatcaagcaatatatacaag


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT01SA2003 Staphylococcus aureus N315     conserved hypothetical protein
cmr|NT02SA0799 Staphylococcus aureus Mu50     conserved hypothetical protein
cmr|NT02SA2015 Staphylococcus aureus Mu50     conserved hypothetical protein
cmr|SACOL0904 Staphylococcus aureus subsp. aureus COL     pathogenicity island protein
dbj|BAB43102.1 Staphylococcus aureus subsp. aureus N315     hypothetical protein
dbj|BAB56960.1 Staphylococcus aureus subsp. aureus Mu50     hypothetical protein
dbj|BAB58177.1 Staphylococcus aureus subsp. aureus Mu50     hypothetical protein
dbj|BAF77677.1 Staphylococcus aureus subsp. aureus Mu3     hypothetical protein
dbj|BAF78883.1 Staphylococcus aureus subsp. aureus Mu3     hypothetical protein
fig|158878.1.peg.2015 Staphylococcus aureus subsp. aureus Mu50 FIG   Hypothetical SAV0798 homolog in superantigen-encoding pathogenicity islands SaPI
fig|158878.1.peg.798 Staphylococcus aureus subsp. aureus Mu50 FIG   Hypothetical SAV0798 homolog in superantigen-encoding pathogenicity islands SaPI
fig|158878.14.peg.2088 Staphylococcus aureus subsp. aureus Mu50 FIG   Hypothetical SAV0798 homolog in superantigen-encoding pathogenicity islands SaPI
fig|158878.14.peg.819 Staphylococcus aureus subsp. aureus Mu50 FIG   Hypothetical SAV0798 homolog in superantigen-encoding pathogenicity islands SaPI
fig|158879.1.peg.1885 Staphylococcus aureus subsp. aureus N315 FIG   Hypothetical SAV0798 homolog in superantigen-encoding pathogenicity islands SaPI
fig|158879.11.peg.1972 Staphylococcus aureus subsp. aureus N315 FIG   Hypothetical SAV0798 homolog in superantigen-encoding pathogenicity islands SaPI
fig|418127.4.peg.1854 Staphylococcus aureus subsp. aureus Mu3 FIG   Hypothetical SAV0798 homolog in superantigen-encoding pathogenicity islands SaPI
fig|418127.4.peg.746 Staphylococcus aureus subsp. aureus Mu3 FIG   Hypothetical SAV0798 homolog in superantigen-encoding pathogenicity islands SaPI
fig|418127.6.peg.2057 Staphylococcus aureus subsp. aureus Mu3 FIG   Hypothetical SAV0798 homolog in superantigen-encoding pathogenicity islands SaPI
fig|418127.6.peg.812 Staphylococcus aureus subsp. aureus Mu3 FIG   Hypothetical SAV0798 homolog in superantigen-encoding pathogenicity islands SaPI
fig|548470.3.peg.2064 Staphylococcus aureus subsp. aureus MN8 FIG   Hypothetical SAV0798 homolog in superantigen-encoding pathogenicity islands SaPI
fig|553594.3.peg.2828 Staphylococcus aureus A9765 FIG   Hypothetical SAV0798 homolog in superantigen-encoding pathogenicity islands SaPI
fig|585147.3.peg.1562 Staphylococcus aureus subsp. aureus A017934/97 FIG   Hypothetical SAV0798 homolog in superantigen-encoding pathogenicity islands SaPI
fig|585148.3.peg.1550 Staphylococcus aureus subsp. aureus Btn1260 FIG   Hypothetical SAV0798 homolog in superantigen-encoding pathogenicity islands SaPI
fig|585150.3.peg.2637 Staphylococcus aureus subsp. aureus C160 FIG   Hypothetical SAV0798 homolog in superantigen-encoding pathogenicity islands SaPI
fig|585154.3.peg.2064 Staphylococcus aureus subsp. aureus EMRSA16 FIG   Hypothetical SAV0798 homolog in superantigen-encoding pathogenicity islands SaPI
fig|585891.3.peg.2085 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Hypothetical SAV0798 homolog in superantigen-encoding pathogenicity islands SaPI
fig|585891.3.peg.818 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Hypothetical SAV0798 homolog in superantigen-encoding pathogenicity islands SaPI
fig|644279.4.peg.451 Staphylococcus aureus subsp. aureus 132 FIG   Hypothetical SAV0798 homolog in superantigen-encoding pathogenicity islands SaPI
fig|93062.4.peg.1849 Staphylococcus aureus subsp. aureus COL FIG   Hypothetical SAV0798 homolog in superantigen-encoding pathogenicity islands SaPI
gb|AAL04129.1 Staphylococcus aureus     unknown
gb|AAW37874.1 Staphylococcus aureus subsp. aureus COL     pathogenicity island protein
gb|ABJ97291.1 Staphylococcus aureus     hypothetical protein
gb|AF410775_5 Staphylococcus aureus     unknown
gb|EEI95759.1 Staphylococcus aureus subsp. aureus MN8     conserved hypothetical protein
gi|116282478 Staphylococcus aureus NCBI   hypothetical protein
gi|13701809 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein
gi|14246567 Staphylococcus aureus subsp. aureus Mu50 NCBI   hypothetical protein
gi|14247788 Staphylococcus aureus subsp. aureus Mu50 NCBI   hypothetical protein
gi|15625511 Staphylococcus aureus NCBI   unknown
gi|156721260 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein
gi|156722466 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein
gi|156979125 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_0794
gi|156980331 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_2000
gi|15923788 Staphylococcus aureus subsp. aureus Mu50 NCBI   hypothetical protein SAV0798
gi|15925005 Staphylococcus aureus subsp. aureus Mu50 NCBI   hypothetical protein SAV2015
gi|15927590 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA1822
gi|227246000 Staphylococcus aureus subsp. aureus MN8 NCBI   conserved hypothetical protein
gi|227557672 Staphylococcus aureus subsp. aureus MN8 NCBI   conserved hypothetical protein
gi|255005588 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   hypothetical protein SauraM_03935
gi|255006803 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   hypothetical protein SauraM_10055
gi|57285780 Staphylococcus aureus subsp. aureus COL NCBI   pathogenicity island protein
gi|57651594 Staphylococcus aureus subsp. aureus COL NCBI   pathogenicity island protein
img|637093539 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637099312 Staphylococcus aureus aureus Mu50 IMG   hypothetical protein
img|637100559 Staphylococcus aureus aureus Mu50 IMG   hypothetical protein
img|637151672 Staphylococcus aureus aureus COL IMG   pathogenicity island protein
img|640903535 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
img|640904784 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
kegg|sac:SACOL0904 Staphylococcus aureus subsp. aureus COL KEGG   pathogenicity island protein
kegg|sau:SA1822   KEGG   hypothetical protein
kegg|sav:SAV0798   KEGG   hypothetical protein
kegg|sav:SAV2015   KEGG   hypothetical protein
kegg|saw:SAHV_0794 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
kegg|saw:SAHV_2000 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
ref|NP_371322.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   hypothetical protein SAV0798
ref|NP_372539.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   hypothetical protein SAV2015
ref|NP_375123.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA1822
ref|YP_001441384.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_0794
ref|YP_001442590.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_2000
ref|YP_185775.1 Staphylococcus aureus subsp. aureus COL RefSeq   pathogenicity island protein
ref|ZP_03987719.1 Staphylococcus aureus subsp. aureus MN8 RefSeq   conserved hypothetical protein
ref|ZP_05144189.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   hypothetical protein SauraM_03935
ref|ZP_05145404.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   hypothetical protein SauraM_10055
tr|A7WZW4 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Putative uncharacterized protein
tr|C2K6H9 Staphylococcus aureus subsp. aureus MN8 TrEMBL   Putative uncharacterized protein
tr|Q5HHI2 Staphylococcus aureus (strain COL) TrEMBL   Pathogenicity island protein
tr|Q7A4K5 Staphylococcus aureus (strain N315) TrEMBL   Putative uncharacterized protein SA1822
tr|Q7BBY7 Staphylococcus aureus TrEMBL   Putative uncharacterized protein
tr|Q99SN1 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search