The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93062.19.peg.874: Staphylococcus aureus subsp. aureus COL

This feature in The SEED Viewer

NCBI Taxonomy Id: 93062

Current Assignment: Hypothetical SAV0788 homolog in superantigen-encoding pathogenicity islands SaPI
Translate Function Assignments



Context on contig NC_002951 from base 903491 to 913856 (10366 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
866 904711 903491 1221 -       1: 1   Integrase, superantigen-encoding pathogenicity islands SaPI locus|SACOL0885, protein_id|YP_185756.1, gi|57650158, geneID|3238598
867 905528 904800 729 - 88     1: 1   Superantigen enterotoxin SEK gene_name|sek, locus|SACOL0886, protein_id|YP_185757.1, gi|57650159, geneID|3238540
868 906280 905552 729 - 23     1: 1   Superantigen enterotoxin SEL gene_name|sei, locus|SACOL0887, protein_id|YP_185758.1, gi|57650160, geneID|3237308
869 906781 906350 432 - 69         ORF039 locus|SACOL0888, protein_id|YP_185759.1, gi|57650161, geneID|3236109
870 907256 906798 459 - 16         Phage protein locus|SACOL0889, protein_id|YP_185760.1, gi|57650162, geneID|3237133
871 907600 907268 333 - 11     1: 1   CI-like repressor, superantigen-encoding pathogenicity islands SaPI locus|SACOL0890, protein_id|YP_185761.1, gi|57650163, geneID|3236162
872 908191 908045 147 - 444         hypothetical protein  
873 908312 908479 168 + 120     1: 1   Hypothetical SAV0787 homolog in superantigen-encoding pathogenicity islands SaPI locus|SACOL0893, protein_id|YP_185764.1, gi|57650166, geneID|3237979
874 908472 908681 210 + -8     1: 1   Hypothetical SAV0788 homolog in superantigen-encoding pathogenicity islands SaPI locus|SACOL0894, protein_id|YP_185765.1, gi|57650167, geneID|3236164
875 908684 909004 321 + 2     1: 1   Hypothetical SAV0789 homolog in superantigen-encoding pathogenicity islands SaPI locus|SACOL0895, protein_id|YP_185766.1, gi|57650168, geneID|3236166
876 909068 909937 870 + 63     1: 1   Hypothetical SAV0790 homolog in superantigen-encoding pathogenicity islands SaPI locus|SACOL0896, protein_id|YP_185767.1, gi|57650169, geneID|3236165
877 909954 911411 1458 + 16     1: 1   Hypothetical SAV0791 homolog in superantigen-encoding pathogenicity islands SaPI locus|SACOL0897, protein_id|YP_185768.1, gi|57650170, geneID|3237134
878 911655 912074 420 + 243     1: 1   Hypothetical SAV0792 homolog in superantigen-encoding pathogenicity islands SaPI locus|SACOL0898, protein_id|YP_185769.1, gi|57650171, geneID|3236093
879 912357 912998 642 + 282     1: 1   Hypothetical SAV0794 homolog in superantigen-encoding pathogenicity islands SaPI locus|SACOL0900, protein_id|YP_185771.1, gi|57651590, geneID|3237768
880 913515 913856 342 + 516     1: 1   Hypothetical SAV0795 homolog in superantigen-encoding pathogenicity islands SaPI locus|SACOL0901, protein_id|YP_185772.1, gi|57651591, geneID|3237769

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Staphylococcal_pathogenicity_islands_SaPI SvetaG Hypothetical SAV0788 homolog in superantigen-encoding pathogenicity islands SaPI


  Protein Sequence

>fig|93062.19.peg.874 Hypothetical SAV0788 homolog in superantigen-encoding pathogenicity islands SaPI
MNNEQKEVIEHLVYQLELSVMNNLESYEHTEYVNGIEVVSEISREKHLELIMKWCAQELK
NNFQLEKGE

MD5 = 7b12b40944bebb2ffb3c6f998dce6414


  DNA Sequence

>fig|93062.19.peg.874 Hypothetical SAV0788 homolog in superantigen-encoding pathogenicity islands SaPI
atgaataatgaacaaaaagaagtaatagaacacttggtttatcaacttgagttaagtgtc
atgaataatttggaaagttacgaacacacagaatatgttaatggtattgaagtggtttca
gagatcagtcgtgaaaagcacttagaattgataatgaaatggtgcgcacaagaattaaag
aataattttcaattagagaaaggagaataa


  DNA with Flanking Sequence

>fig|93062.19.peg.874 Hypothetical SAV0788 homolog in superantigen-encoding pathogenicity islands SaPI
aaataacctagatattttttttaccaataacgttcccagaaaagaacgtaaaaacatctt
aaaaggaggtgaattaaatgtctagaacaaaattgcatgatgtaccagctaaagaaaata
caattacagaaccaaagcaagttgtagtgaatcctttgtttgcgaaacctaatgcactag
ctagtatttttggaatttcatatagttcggtgaatcgcattttaaaagaatgggaaaaag
attctaaaggtgttgatgatttatattactcgttatcatcaacaatgattgttataagta
ttccacgattcgaggagtacatgaaggcacgtcataaaaaatggatgtaggaggcaaggc
aatgaaaatgtatttagcttatatctgcttagtttcattgttaacaattttattactagc
aatatctaacatgtatgtcgcttttagcgtttatgcttggctaataactttaggatgtaa
tttaacaggaggattagaaaatgaataatgaacaaaaagaagtaatagaacacttggttt
atcaacttgagttaagtgtcatgaataatttggaaagttacgaacacacagaatatgtta
atggtattgaagtggtttcagagatcagtcgtgaaaagcacttagaattgataatgaaat
ggtgcgcacaagaattaaagaataattttcaattagagaaaggagaataaaaatgaattg
ggaaattaaagatttaatgtgtgacattgaagtgataaaacaaaaaattaatgatgtagc
taccaaacatgcttggtttgttgaagatagatttgtaaaaaatgaattagaaacaaaacg
ggaacatattaatttttctgctagctatttagaacatcgtatacaaaatgaacatacagt
tgagttattacatgtgtacttaaaagaattcagtgaacttatacaaaaatttcatgaaat
agaaaaagcgtcatcagagaactttgacgaggaatcagatgacgcaaagaattcaataaa
agtagcagagtaatttagaaattacacattcttattataacatctttactctgttgtttc
attagaggtgcaaaaaatgaatgaaattaaattgaaatatgatacgcaagtttcggtggt
acattatgaaagtttagactcacgttcatttaagagcttttcaatgcctaaatggagtaa
gttggttaat


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|SACOL0894 Staphylococcus aureus subsp. aureus COL     pathogenicity island protein
fig|452948.4.peg.2817 Staphylococcus aureus 930918-3 FIG   Hypothetical SAV0788 homolog in superantigen-encoding pathogenicity islands SaPI
fig|553567.3.peg.2539 Staphylococcus aureus A5948 FIG   Hypothetical SAV0788 homolog in superantigen-encoding pathogenicity islands SaPI
fig|553594.3.peg.2848 Staphylococcus aureus A9765 FIG   Hypothetical SAV0788 homolog in superantigen-encoding pathogenicity islands SaPI
fig|585151.3.peg.2256 Staphylococcus aureus subsp. aureus C427 FIG   Hypothetical SAV0788 homolog in superantigen-encoding pathogenicity islands SaPI
fig|644279.4.peg.442 Staphylococcus aureus subsp. aureus 132 FIG   Hypothetical SAV0788 homolog in superantigen-encoding pathogenicity islands SaPI
fig|680649.3.peg.533 Staphylococcus aureus subsp. aureus MR1 FIG   Hypothetical SAV0788 homolog in superantigen-encoding pathogenicity islands SaPI
fig|93062.4.peg.1839 Staphylococcus aureus subsp. aureus COL FIG   Hypothetical SAV0788 homolog in superantigen-encoding pathogenicity islands SaPI
gb|AAL04139.1 Staphylococcus aureus     unknown
gb|AAL67618.1 Staphylococcus aureus     orf19
gb|AAW36447.1 Staphylococcus aureus subsp. aureus COL     pathogenicity island protein
gb|AF410775_15 Staphylococcus aureus     unknown
gb|EEV82098.1 Staphylococcus aureus A5948     pathogenicity island protein
gi|15625521 Staphylococcus aureus NCBI   unknown
gi|18266768 Staphylococcus aureus NCBI   orf19
gi|257859243 Staphylococcus aureus A5948 NCBI   pathogenicity island protein
gi|258453033 Staphylococcus aureus A5948 NCBI   pathogenicity island protein
gi|57284353 Staphylococcus aureus subsp. aureus COL NCBI   pathogenicity island protein
gi|57650167 Staphylococcus aureus subsp. aureus COL NCBI   pathogenicity island protein
img|637151662 Staphylococcus aureus aureus COL IMG   pathogenicity island protein
kegg|sac:SACOL0894 Staphylococcus aureus subsp. aureus COL KEGG   pathogenicity island protein
ref|YP_185765.1 Staphylococcus aureus subsp. aureus COL RefSeq   pathogenicity island protein
ref|ZP_05701026.1 Staphylococcus aureus A5948 RefSeq   pathogenicity island protein
tr|Q5HHJ2 Staphylococcus aureus (strain COL) TrEMBL   Pathogenicity island protein
tr|Q93CD3 Staphylococcus aureus TrEMBL   Orf19


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search