The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93062.19.peg.868: Staphylococcus aureus subsp. aureus COL

This feature in The SEED Viewer

NCBI Taxonomy Id: 93062

Current Assignment: Superantigen enterotoxin SEL
Translate Function Assignments



Context on contig NC_002951 from base 900796 to 911411 (10616 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
863 900796 901821 1026 +       2: 3 2   Methionine ABC transporter ATP-binding protein locus|SACOL0882, protein_id|YP_185753.1, gi|57650155, geneID|3238499
864 901814 902509 696 + -8     3: 3 2 4   Methionine ABC transporter, permease protein MetI locus|SACOL0883, protein_id|YP_185754.1, gi|57650156, geneID|3238371
865 902527 903348 822 + 17     3: 1 3 2   Methionine ABC transporter substrate-binding protein locus|SACOL0884, protein_id|YP_185755.1, gi|57650157, geneID|3238301
866 904711 903491 1221 - 142     1: 1   Integrase, superantigen-encoding pathogenicity islands SaPI locus|SACOL0885, protein_id|YP_185756.1, gi|57650158, geneID|3238598
867 905528 904800 729 - 88 7 1: 1   Superantigen enterotoxin SEK gene_name|sek, locus|SACOL0886, protein_id|YP_185757.1, gi|57650159, geneID|3238540
868 906280 905552 729 - 23   1: 1   Superantigen enterotoxin SEL gene_name|sei, locus|SACOL0887, protein_id|YP_185758.1, gi|57650160, geneID|3237308
869 906781 906350 432 - 69         ORF039 locus|SACOL0888, protein_id|YP_185759.1, gi|57650161, geneID|3236109
870 907256 906798 459 - 16         Phage protein locus|SACOL0889, protein_id|YP_185760.1, gi|57650162, geneID|3237133
871 907600 907268 333 - 11     1: 1   CI-like repressor, superantigen-encoding pathogenicity islands SaPI locus|SACOL0890, protein_id|YP_185761.1, gi|57650163, geneID|3236162
872 908191 908045 147 - 444         hypothetical protein  
873 908312 908479 168 + 120     1: 1   Hypothetical SAV0787 homolog in superantigen-encoding pathogenicity islands SaPI locus|SACOL0893, protein_id|YP_185764.1, gi|57650166, geneID|3237979
874 908472 908681 210 + -8     1: 1   Hypothetical SAV0788 homolog in superantigen-encoding pathogenicity islands SaPI locus|SACOL0894, protein_id|YP_185765.1, gi|57650167, geneID|3236164
875 908684 909004 321 + 2     1: 1   Hypothetical SAV0789 homolog in superantigen-encoding pathogenicity islands SaPI locus|SACOL0895, protein_id|YP_185766.1, gi|57650168, geneID|3236166
876 909068 909937 870 + 63     1: 1   Hypothetical SAV0790 homolog in superantigen-encoding pathogenicity islands SaPI locus|SACOL0896, protein_id|YP_185767.1, gi|57650169, geneID|3236165
877 909954 911411 1458 + 16     1: 1   Hypothetical SAV0791 homolog in superantigen-encoding pathogenicity islands SaPI locus|SACOL0897, protein_id|YP_185768.1, gi|57650170, geneID|3237134

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Staphylococcal_pathogenicity_islands_SaPI SvetaG Superantigen enterotoxin SEL


  Protein Sequence

>fig|93062.19.peg.868 Superantigen enterotoxin SEL
MNKIFRILTVSLFFFTFLIKNNLAYADVGVINLRNFYANYEPEKLQGVSSGNFSTSHQLE
YIDGKYTLYSQFHNEYEAKRLKDHKVDIFGISYSGLCNTKYMYGGITLANQNLDKPRNIP
INLWVNGKQNTISTDKVSTQKKEVTAQEIDIKLRKYLQNEYNIYGFNKTKKGQEYGYQSK
FNSGFNKGKITFHLNNEPSFTYDLFYTGTGQAESFLKIYDDNKTIDTENFHLDVEISYEK
TE

MD5 = 5edeaaf83e0ed6d6f947f85182c954e1


  DNA Sequence

>fig|93062.19.peg.868 Superantigen enterotoxin SEL
atgaataaaatatttagaatactcactgttagcttgtttttcttcacatttttaataaaa
aacaatctagcatatgctgatgtaggggtaatcaaccttagaaacttttatgctaattat
gaacctgaaaagcttcaaggagttagttctggaaatttttctacttctcatcaattagag
tatattgatggaaaatacactttatattcacagtttcataatgaatatgaagcgaagaga
ttaaaagatcataaagtagatatctttggaataagttactcaggtctttgtaatacaaaa
tatatgtatggtggaattacgttggcgaatcaaaatttagataaacctagaaatatacct
attaatctctgggtcaatggtaagcaaaatactatatctacagacaaagtttctactcaa
aaaaaagaggtaactgctcaagagattgatattaagttacgaaaatacctacaaaacgaa
tacaatatatatggttttaataaaacaaaaaaaggtcaggaatatggatatcagtcaaaa
tttaattctgggtttaacaaaggaaaaattactttccatttaaataatgaaccttctttt
acatacgatttgttttacaccggaactggtcaagcagagagttttttaaaaatttacgat
gataataaaactatagatacagagaattttcatttggatgtagagatttcatatgagaag
actgaataa


  DNA with Flanking Sequence

>fig|93062.19.peg.868 Superantigen enterotoxin SEL
tgagaaaattattaggtttagcattagcaagtacgttaattttaggcgcttgtggtagca
acgacggagataagaaagaagaaagcaagagctatactacaaatgatatcgttaaaggtt
ttaaagataataaattaaatgttatcaatgaaaaagaaatgacacgtgaagactttgggc
ttgctccaatgaagacggacgaagctaaaatgtttgttgttcaagatgataaaaatgcta
gagtaatgaaatttaaaaatagtgatgatctaaaacaaactaaaaaatattacgatgaat
taggtaaagaaagtgcagctttctattcacatacccattctaaaggtaagtttttaatac
aaatgaacggtgatatcgatgatgctactttcaataaatacaagaattctatggataaaa
cattaaagtgatgggaaaagttgtattgtgattaaaaatgcctatatggcgttgtaatat
aaaaaaaaggagccatcaaaatgaataaaatatttagaatactcactgttagcttgtttt
tcttcacatttttaataaaaaacaatctagcatatgctgatgtaggggtaatcaacctta
gaaacttttatgctaattatgaacctgaaaagcttcaaggagttagttctggaaattttt
ctacttctcatcaattagagtatattgatggaaaatacactttatattcacagtttcata
atgaatatgaagcgaagagattaaaagatcataaagtagatatctttggaataagttact
caggtctttgtaatacaaaatatatgtatggtggaattacgttggcgaatcaaaatttag
ataaacctagaaatatacctattaatctctgggtcaatggtaagcaaaatactatatcta
cagacaaagtttctactcaaaaaaaagaggtaactgctcaagagattgatattaagttac
gaaaatacctacaaaacgaatacaatatatatggttttaataaaacaaaaaaaggtcagg
aatatggatatcagtcaaaatttaattctgggtttaacaaaggaaaaattactttccatt
taaataatgaaccttcttttacatacgatttgttttacaccggaactggtcaagcagaga
gttttttaaaaatttacgatgataataaaactatagatacagagaattttcatttggatg
tagagatttcatatgagaagactgaataaatataatttaaggagaaaaggcaatgaaaaa
attaataagcatcttattaataaatataataattttaggtgtctctaatagtgccagcgc
tcaaggtgatataggaattgataatctcaggaatttttatacaaaaaaagacttcgtaga
tttaaaagatgtaaaagacaatgatactcctatagctaatcaactacaattttcaaatga
atcttatgatttaatttcagaatcaaaagattttaataaatttagtaatttcaagggaaa
aaaacttgatgtttttggtattagttataatggccagtgtaacactaaatacatatatgg
cggagtcacagctactaacgaatatctagataaatctagaaatatacctataaatatatg
gattaatggaaatcacaaaactatttctaccaataaagtttcgacaaataaaaaatttgt
taccgctcaagagattgatgtcaaattaagaaagtaccttcaagaagaa


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0005576       C:extracellular region
GO:0009405       P:pathogenesis
cmr|SACOL0887 Staphylococcus aureus subsp. aureus COL     staphylococcal enterotoxin type I
fig|452948.4.peg.2598 Staphylococcus aureus 930918-3 FIG   Superantigen enterotoxin SEL
fig|553594.3.peg.2423 Staphylococcus aureus A9765 FIG   Superantigen enterotoxin SEL
fig|93062.4.peg.1832 Staphylococcus aureus subsp. aureus COL FIG   Superantigen enterotoxin SEL
gb|AAL04146.1 Staphylococcus aureus     Seq
gb|AAW36440.1 Staphylococcus aureus subsp. aureus COL     staphylococcal enterotoxin type I
gb|AF410775_22 Staphylococcus aureus     Seq
gb|EEW43995.1 Staphylococcus aureus 930918-3     staphylococcal enterotoxin type I
gi|15625528 Staphylococcus aureus NCBI   Seq
gi|259158908 Staphylococcus aureus 930918-3 NCBI   staphylococcal enterotoxin type I
gi|57284346 Staphylococcus aureus subsp. aureus COL NCBI   staphylococcal enterotoxin type I
gi|57650160 Staphylococcus aureus subsp. aureus COL NCBI   staphylococcal enterotoxin type I
img|637151655 Staphylococcus aureus aureus COL IMG   staphylococcal enterotoxin type I
kegg|sac:SACOL0887 Staphylococcus aureus subsp. aureus COL KEGG   staphylococcal enterotoxin type I
ref|YP_185758.1 Staphylococcus aureus subsp. aureus COL RefSeq   staphylococcal enterotoxin type I
tr|Q5HHJ9 Staphylococcus aureus (strain COL) TrEMBL   Staphylococcal enterotoxin type I
tr|Q93CC6 Staphylococcus aureus TrEMBL   Seq


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
7 fig|93062.19.peg.867 Superantigen enterotoxin SEK


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search