The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on localhost
The SEED


FIG search

Protein fig|93062.19.peg.862: Staphylococcus aureus subsp. aureus COL

This feature in The SEED Viewer

NCBI Taxonomy Id: 93062

Current Assignment: Thioredoxin
Translate Function Assignments



Context on contig NC_002951 from base 895226 to 905528 (10303 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
851 895226 895942 717 +       5: 18 12 15 17 11   3-dehydroquinate dehydratase I (EC 4.2.1.10) gene_name|aroD, locus|SACOL0873, protein_id|YP_185745.1, gi|57650147, geneID|3238019
852 896025 896564 540 + 82     2: 16 21   Putative nitroreductase family protein SACOL0874 locus|SACOL0874, protein_id|YP_185746.1, gi|57650148, geneID|3238367
853 897034 896714 321 - 149     4: 5 7 6 1   Thioredoxin locus|SACOL0875, protein_id|YP_185747.1, gi|57650149, geneID|3238350
854 897178 897534 357 + 143     4: 8 1 14 20   FIG138056: a glutathione-dependent thiol reductase locus|SACOL0876, protein_id|YP_185748.1, gi|57650150, geneID|3238606
855 897692 898072 381 + 157     4: 10 13 1 9   Glycine cleavage system H protein gene_name|gcvH, locus|SACOL0877, protein_id|YP_185749.1, gi|57650151, geneID|3238420
856 898136 898249 114 + 63         FIG01108291: hypothetical protein  
857 898251 899129 879 + 1         FIG01108697: hypothetical protein locus|SACOL0879, protein_id|YP_185750.1, gi|57650152, geneID|3238470
858 899395 899153 243 - 23         hypothetical protein  
860 899334 899480 147 + -62         hypothetical protein  
861 899862 900257 396 + 381     1: 1   Toprim domain protein locus|SACOL0880, protein_id|YP_185751.1, gi|57650153, geneID|3238130
862 900250 900546 297 + -8   4: 5 7 6 1   Thioredoxin locus|SACOL0881, protein_id|YP_185752.1, gi|57650154, geneID|3238521
863 900796 901821 1026 + 249 5 2: 4 2   Methionine ABC transporter ATP-binding protein locus|SACOL0882, protein_id|YP_185753.1, gi|57650155, geneID|3238499
864 901814 902509 696 + -8 4 3: 4 2 19   Methionine ABC transporter, permease protein MetI locus|SACOL0883, protein_id|YP_185754.1, gi|57650156, geneID|3238371
865 902527 903348 822 + 17     3: 3 4 2   Methionine ABC transporter substrate-binding protein locus|SACOL0884, protein_id|YP_185755.1, gi|57650157, geneID|3238301
866 904711 903491 1221 - 142     1: 3   Integrase, superantigen-encoding pathogenicity islands SaPI locus|SACOL0885, protein_id|YP_185756.1, gi|57650158, geneID|3238598
867 905528 904800 729 - 88     1: 3   Superantigen enterotoxin SEK gene_name|sek, locus|SACOL0886, protein_id|YP_185757.1, gi|57650159, geneID|3238540

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
CBSS-315749.4.peg.3658 DanielaB Thioredoxin
ER_SOD Raterman_Erica_user Thioredoxin
Prolyl-tRNA_synthetase_associated_editing_enzymes howard.969 Thioredoxin
tRNA_synthetase_relationships howard.969 Thioredoxin


  Protein Sequence

>fig|93062.19.peg.862 Thioredoxin
MNNSLDIKDVTTFYEEDKHLIFGYTPTCGTCKVSERMLDIANEILQLPLLKIDLNFYPQF
CKDMQIMSTPILLLMNKDKEVKRIYAFKSVTDLLENLK

MD5 = 27054444719c68250c0981f36b7ffcb0


  DNA Sequence

>fig|93062.19.peg.862 Thioredoxin
atgaataattcattagacatcaaagatgtaactacattttatgaggaagacaaacattta
atctttggttatacaccaacgtgtggtacttgtaaggtttcagaaagaatgttagacatt
gctaatgaaatattgcagttaccattattgaaaatagatttaaacttttatcctcagttt
tgtaaagatatgcaaatcatgtctacgccgattttattgttgatgaataaagataaagaa
gtaaaacgaatttatgcatttaaatcggtgactgatttgttagaaaatttaaaatag


  DNA with Flanking Sequence

>fig|93062.19.peg.862 Thioredoxin
cattgagtttgtaattattatattaagctagtttaaattttttgtgatttatgttttatt
cataccaattttgtgaaatgatacagtgacagatgtttattgattttaaagggtgatgat
gatggctattgtaaataaagtgataattgttgaaggaaaatctgataaaaaaagggtgca
acaggttattgcagaaccagtcaatattatttgtactcatggaacaatgagtatagataa
gcttgatgatatgatagaatcactgtatgataaacaagtttttgtattagccgattctga
tgacgaaggagatcgaattagaaattggtttaaacgttatttgagtgaaagtgaacatat
atttattgataaaacttactgtcaagttgcgaattgccccaaacaatatttggcgcatgt
actttcaaaacatggctttacttgtaagaaagaaacacctcttttaccgaatataaataa
tgaaaggttagttttagtaaatgaataattcattagacatcaaagatgtaactacatttt
atgaggaagacaaacatttaatctttggttatacaccaacgtgtggtacttgtaaggttt
cagaaagaatgttagacattgctaatgaaatattgcagttaccattattgaaaatagatt
taaacttttatcctcagttttgtaaagatatgcaaatcatgtctacgccgattttattgt
tgatgaataaagataaagaagtaaaacgaatttatgcatttaaatcggtgactgatttgt
tagaaaatttaaaatagttattgacgaaattttactaaggtgttaggattaatacaaatt
aaatgatgcgtaaactcttatcgagagtggtggagggatgtgccctacgaagcccggcaa
ccgtcttatatagaaatggtgccaattcacataaagttttaacttttgaagatgagagaa
acaatactactattgctttctcaatttttctatcgatattgagaaagcattttttatttt
attaagcaacacagggaggaatcaacgtgattgaattaaaagaagttgttaaagaatatc
ggactaaaaataaagaagtccttgctgtagatcacgttaatttatcgattcgagcaggat
cgatttatggcgtcattggtttttctggagcaggaaaaagtactttgattcgaatgttta
atcatttagaagcgcctacatcaggtgaagttattatagatggagaccatataggtcaat
tgtccaaaaatggattaagagcaaaaagacaaaaagt


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT01SA0835 Staphylococcus aureus N315     9870WM:DIFRO
cmr|NT02SA0834 Staphylococcus aureus Mu50     thioredoxin
cmr|NT03SA0867 Staphylococcus aureus MW2     thioredoxin, putative
cmr|NT05SA0753 Staphylococcus aureus NCTC 8325     thioredoxin
cmr|NT09SA0785 Staphylococcus aureus subsp. aureus MSSA476     thioredoxin
cmr|SACOL0881 Staphylococcus aureus subsp. aureus COL     thioredoxin, putative
cmr|SAUSA300_0795 Staphylococcus aureus subsp. aureus USA300-FPR3757     putative thioredoxin
dbj|BAB42007.1 Staphylococcus aureus subsp. aureus N315     SAS023
dbj|BAB56998.1 Staphylococcus aureus subsp. aureus Mu50     similar to thioredoxin
dbj|BAB94654.1 Staphylococcus aureus subsp. aureus MW2     MW0789
dbj|BAF67051.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
dbj|BAF77715.1 Staphylococcus aureus subsp. aureus Mu3     hypothetical protein
emb|CAG42552.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   putative thioredoxin
fig|158878.1.peg.836 Staphylococcus aureus subsp. aureus Mu50 FIG   Thioredoxin
fig|158878.14.peg.861 Staphylococcus aureus subsp. aureus Mu50 FIG   Thioredoxin
fig|158879.1.peg.790 Staphylococcus aureus subsp. aureus N315 FIG   Thioredoxin
fig|158879.11.peg.822 Staphylococcus aureus subsp. aureus N315 FIG   Thioredoxin
fig|196620.1.peg.789 Staphylococcus aureus subsp. aureus MW2 FIG   Thioredoxin
fig|196620.5.peg.832 Staphylococcus aureus subsp. aureus MW2 FIG   Thioredoxin
fig|282459.1.peg.771 Staphylococcus aureus subsp. aureus MSSA476 FIG   Thioredoxin
fig|282459.5.peg.811 Staphylococcus aureus subsp. aureus MSSA476 FIG   Thioredoxin
fig|359786.13.peg.906 Staphylococcus aureus subsp. aureus JH9 FIG   Thioredoxin
fig|359786.3.peg.2174 Staphylococcus aureus subsp. aureus JH9 FIG   Thioredoxin
fig|359787.11.peg.894 Staphylococcus aureus subsp. aureus JH1 FIG   Thioredoxin
fig|359787.3.peg.2518 Staphylococcus aureus subsp. aureus JH1 FIG   Thioredoxin
fig|367830.3.peg.2467 Staphylococcus aureus subsp. aureus USA300 FIG   Thioredoxin
fig|418127.4.peg.779 Staphylococcus aureus subsp. aureus Mu3 FIG   Thioredoxin
fig|418127.6.peg.852 Staphylococcus aureus subsp. aureus Mu3 FIG   Thioredoxin
fig|426430.6.peg.761 Staphylococcus aureus subsp. aureus str. Newman FIG   Thioredoxin
fig|426430.8.peg.847 Staphylococcus aureus subsp. aureus str. Newman FIG   Thioredoxin
fig|450394.6.peg.34 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   Thioredoxin
fig|451515.3.peg.882 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Thioredoxin
fig|451516.9.peg.888 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Thioredoxin
fig|452948.4.peg.2604 Staphylococcus aureus 930918-3 FIG   Thioredoxin
fig|455227.3.peg.2519 Staphylococcus aureus D30 FIG   Thioredoxin
fig|505321.3.peg.2418 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Thioredoxin
fig|546342.3.peg.370 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Thioredoxin
fig|546343.3.peg.1239 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Thioredoxin
fig|548475.3.peg.1134 Staphylococcus aureus subsp. aureus TCH70 FIG   Thioredoxin
fig|553565.3.peg.663 Staphylococcus aureus A5937 FIG   Thioredoxin
fig|553567.3.peg.1645 Staphylococcus aureus A5948 FIG   Thioredoxin
fig|553568.3.peg.1860 Staphylococcus aureus A6224 FIG   Thioredoxin
fig|553571.3.peg.752 Staphylococcus aureus A6300 FIG   Thioredoxin
fig|553573.3.peg.122 Staphylococcus aureus A8115 FIG   Thioredoxin
fig|553574.3.peg.1975 Staphylococcus aureus A8117 FIG   Thioredoxin
fig|553577.3.peg.1340 Staphylococcus aureus A8796 FIG   Thioredoxin
fig|553580.3.peg.1682 Staphylococcus aureus A8819 FIG   Thioredoxin
fig|553581.3.peg.2319 Staphylococcus aureus A9299 FIG   Thioredoxin
fig|553588.3.peg.1798 Staphylococcus aureus A9719 FIG   Thioredoxin
fig|553590.4.peg.2221 Staphylococcus aureus A9754 FIG   Thioredoxin
fig|553592.3.peg.2507 Staphylococcus aureus A9763 FIG   Thioredoxin
fig|553594.3.peg.2417 Staphylococcus aureus A9765 FIG   Thioredoxin
fig|553596.3.peg.1774 Staphylococcus aureus A9781 FIG   Thioredoxin
fig|553601.3.peg.2617 Staphylococcus aureus A10102 FIG   Thioredoxin
fig|585152.3.peg.748 Staphylococcus aureus subsp. aureus D139 FIG   Thioredoxin
fig|585891.3.peg.860 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Thioredoxin
fig|644279.4.peg.911 Staphylococcus aureus subsp. aureus 132 FIG   Thioredoxin
fig|680649.3.peg.1942 Staphylococcus aureus subsp. aureus MR1 FIG   Thioredoxin
fig|681288.4.peg.783 Staphylococcus aureus subsp. aureus ED98 FIG   Thioredoxin
fig|703339.3.peg.807 Staphylococcus aureus 04-02981 FIG   Thioredoxin
fig|762962.3.peg.1165 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   Thioredoxin
fig|93061.3.peg.818 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Thioredoxin
fig|93061.5.peg.764 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Thioredoxin
fig|93062.4.peg.1826 Staphylococcus aureus subsp. aureus COL FIG   Thioredoxin
gb|AAW36434.1 Staphylococcus aureus subsp. aureus COL     thioredoxin, putative
gb|ABD22458.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     putative thioredoxin
gb|ABD29967.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABQ48638.1 Staphylococcus aureus subsp. aureus JH9     hypothetical protein SaurJH9_0837
gb|ABR51709.1 Staphylococcus aureus subsp. aureus JH1     conserved hypothetical protein
gb|ABX28867.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     possible thioredoxin
gb|EES55149.1 Staphylococcus aureus subsp. aureus TCH70     thioredoxin
gb|EES93417.1 Staphylococcus aureus subsp. aureus USA300_TCH959     thioredoxin
gb|EEV27179.1 Staphylococcus aureus A9781     conserved hypothetical protein
gb|EEV63455.1 Staphylococcus aureus A9763     conserved hypothetical protein
gb|EEV66830.1 Staphylococcus aureus A9719     conserved hypothetical protein
gb|EEV71747.1 Staphylococcus aureus A9299     conserved hypothetical protein
gb|EEV76329.1 Staphylococcus aureus A8115     conserved hypothetical protein
gb|EEV78238.1 Staphylococcus aureus A6300     thioredoxin
gb|EEV79944.1 Staphylococcus aureus A6224     thioredoxin
gb|EEV83187.1 Staphylococcus aureus A5948     hypothetical protein SAGG_00215
gb|EEV86558.1 Staphylococcus aureus A5937     conserved hypothetical protein
gb|EEW43989.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_0781
gb|EEW46130.1 Staphylococcus aureus D30     hypothetical protein SAD30_1489
gi|13700710 Staphylococcus aureus subsp. aureus N315 NCBI   SAS023
gi|14246605 Staphylococcus aureus subsp. aureus Mu50 NCBI   similar to thioredoxin
gi|147740340 Staphylococcus aureus subsp. aureus JH9 NCBI   hypothetical protein SaurJH9_0837
gi|148267271 Staphylococcus aureus subsp. aureus JH9 NCBI   hypothetical protein SaurJH9_0837
gi|149945773 Staphylococcus aureus subsp. aureus JH1 NCBI   conserved hypothetical protein
gi|150373791 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|150393321 Staphylococcus aureus subsp. aureus JH1 NCBI   hypothetical protein SaurJH1_0853
gi|151220991 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_0779
gi|156721298 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein
gi|156979163 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_0832
gi|15923826 Staphylococcus aureus subsp. aureus Mu50 NCBI   hypothetical protein SAV0836
gi|15926496 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SAS023
gi|160367896 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   possible thioredoxin
gi|161509087 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_0846
gi|21203955 Staphylococcus aureus subsp. aureus MW2 NCBI   MW0789
gi|21282518 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein MW0789
gi|221137387 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   hypothetical protein SauraJK_01881
gi|221141213 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   hypothetical protein SauraJ_06183
gi|251802492 Staphylococcus aureus subsp. aureus TCH70 NCBI   thioredoxin
gi|251813802 Staphylococcus aureus subsp. aureus TCH70 NCBI   thioredoxin
gi|253316866 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   hypothetical protein SauraC_12119
gi|253724688 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   thioredoxin
gi|253731445 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   thioredoxin
gi|255005624 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   hypothetical protein SauraM_04115
gi|257788839 Staphylococcus aureus A9781 NCBI   conserved hypothetical protein
gi|257794867 Staphylococcus aureus A9781 NCBI   conserved hypothetical protein
gi|257838976 Staphylococcus aureus A9763 NCBI   conserved hypothetical protein
gi|257842406 Staphylococcus aureus A9719 NCBI   conserved hypothetical protein
gi|257847750 Staphylococcus aureus A9299 NCBI   conserved hypothetical protein
gi|257852408 Staphylococcus aureus A8115 NCBI   conserved hypothetical protein
gi|257855300 Staphylococcus aureus A6300 NCBI   thioredoxin
gi|257857045 Staphylococcus aureus A6224 NCBI   thioredoxin
gi|257860355 Staphylococcus aureus A5948 NCBI   hypothetical protein SAGG_00215
gi|257863802 Staphylococcus aureus A5937 NCBI   conserved hypothetical protein
gi|258418183 Staphylococcus aureus A9763 NCBI   conserved hypothetical protein
gi|258421480 Staphylococcus aureus A9719 NCBI   conserved hypothetical protein
gi|258439178 Staphylococcus aureus A9299 NCBI   conserved hypothetical protein
gi|258440894 Staphylococcus aureus A8115 NCBI   conserved hypothetical protein
gi|258445724 Staphylococcus aureus A6300 NCBI   thioredoxin
gi|258449537 Staphylococcus aureus A6224 NCBI   thioredoxin
gi|258452140 Staphylococcus aureus A5948 NCBI   hypothetical protein SAGG_00215
gi|258453937 Staphylococcus aureus A5937 NCBI   conserved hypothetical protein
gi|259158902 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_0781
gi|259161530 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_1489
gi|49244126 Staphylococcus aureus subsp. aureus MSSA476 NCBI   putative thioredoxin
gi|49485683 Staphylococcus aureus subsp. aureus MSSA476 NCBI   hypothetical protein SAS0777
gi|57284340 Staphylococcus aureus subsp. aureus COL NCBI   thioredoxin, putative
gi|57650154 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL0881
gi|87127944 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   putative thioredoxin
gi|87161970 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   hypothetical protein SAUSA300_0795
gi|87202157 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88194599 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_00841
img|637092407 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637099350 Staphylococcus aureus aureus Mu50 IMG   similar to thioredoxin
img|637151649 Staphylococcus aureus aureus COL IMG   thioredoxin, putative
img|637157005 Staphylococcus aureus aureus MSSA476 IMG   putative thioredoxin
img|637298550 Staphylococcus aureus aureus MW2 IMG   hypothetical protein
img|637887447 Staphylococcus aureus aureus USA300 IMG   putative thioredoxin
img|637893486 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|639108124 Staphylococcus aureus aureus JH1 IMG   thioredoxin, putative
img|640565187 Staphylococcus aureus aureus JH9 IMG   hypothetical protein
img|640778940 Staphylococcus aureus aureus JH1 IMG   hypothetical protein
img|640795157 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|640903573 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
img|641308815 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   possible thioredoxin
img|641770900 Staphylococcus aureus aureus USA300_TCH959 IMG   possible thioredoxin
kegg|saa:SAUSA300_0795 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   hypothetical protein
kegg|sac:SACOL0881 Staphylococcus aureus subsp. aureus COL KEGG   hypothetical protein
kegg|sae:NWMN_0779 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sah:SaurJH1_0853 Staphylococcus aureus subsp. aureus JH1 KEGG   hypothetical protein
kegg|saj:SaurJH9_0837 Staphylococcus aureus subsp. aureus JH9 KEGG   hypothetical protein
kegg|sam:MW0789 Staphylococcus aureus subsp. aureus MW2 KEGG   hypothetical protein
kegg|sao:SAOUHSC_00841 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sas:SAS0777   KEGG   hypothetical protein
kegg|sau:SAS023   KEGG   hypothetical protein
kegg|sav:SAV0836   KEGG   hypothetical protein
kegg|saw:SAHV_0832 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
kegg|sax:USA300HOU_0846 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   hypothetical protein
ref|NP_371360.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   hypothetical protein SAV0836
ref|NP_374029.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SAS023
ref|NP_645606.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   hypothetical protein MW0789
ref|YP_001246214.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   hypothetical protein SaurJH9_0837
ref|YP_001315996.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   hypothetical protein SaurJH1_0853
ref|YP_001331813.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_0779
ref|YP_001441422.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_0832
ref|YP_001574746.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   hypothetical protein USA300HOU_0846
ref|YP_042904.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   hypothetical protein SAS0777
ref|YP_185752.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL0881
ref|YP_493495.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   hypothetical protein SAUSA300_0795
ref|YP_499395.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_00841
ref|ZP_03562193.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   hypothetical protein SauraJK_01881
ref|ZP_03565706.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   hypothetical protein SauraJ_06183
ref|ZP_04828275.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   thioredoxin
ref|ZP_04840079.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   hypothetical protein SauraC_12119
ref|ZP_04865610.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   thioredoxin
ref|ZP_05144225.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   hypothetical protein SauraM_04115
ref|ZP_05643846.1 Staphylococcus aureus A9781 RefSeq   conserved hypothetical protein
ref|ZP_05682448.1 Staphylococcus aureus A9763 RefSeq   conserved hypothetical protein
ref|ZP_05684405.1 Staphylococcus aureus A9719 RefSeq   conserved hypothetical protein
ref|ZP_05690222.1 Staphylococcus aureus A9299 RefSeq   conserved hypothetical protein
ref|ZP_05690729.1 Staphylococcus aureus A8115 RefSeq   conserved hypothetical protein
ref|ZP_05693901.1 Staphylococcus aureus A6300 RefSeq   thioredoxin
ref|ZP_05697639.1 Staphylococcus aureus A6224 RefSeq   thioredoxin
ref|ZP_05700156.1 Staphylococcus aureus A5948 RefSeq   hypothetical protein SAGG_00215
ref|ZP_05701909.1 Staphylococcus aureus A5937 RefSeq   conserved hypothetical protein
tr|A5IR15 Staphylococcus aureus (strain JH9) TrEMBL   Putative uncharacterized protein
tr|A6QFB9 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein
tr|A6TZU1 Staphylococcus aureus (strain JH1) TrEMBL   Putative uncharacterized protein
tr|A7X023 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Putative uncharacterized protein
tr|A8Z1E4 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Possible thioredoxin
tr|C5N3R8 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   Thioredoxin
tr|C5QHK9 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   Thioredoxin
tr|Q2FII3 Staphylococcus aureus (strain USA300) TrEMBL   Putative thioredoxin
tr|Q2FZZ3 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q5HHK5 Staphylococcus aureus (strain COL) TrEMBL   Thioredoxin, putative
tr|Q6GB19 Staphylococcus aureus (strain MSSA476) TrEMBL   Putative thioredoxin
tr|Q7A1E4 Staphylococcus aureus (strain MW2) TrEMBL   MW0789 protein
tr|Q7A6M3 Staphylococcus aureus (strain N315) TrEMBL   SAS023 protein
tr|Q99VG9 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   Similar to thioredoxin


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
5 fig|93062.19.peg.863 Methionine ABC transporter ATP-binding protein
4 fig|93062.19.peg.864 Methionine ABC transporter, permease protein MetI


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search