The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93062.19.peg.78: Staphylococcus aureus subsp. aureus COL

This feature in The SEED Viewer

NCBI Taxonomy Id: 93062

Current Assignment: hypothetical protein
Translate Function Assignments



Context on contig NC_002951 from base 84291 to 97707 (13417 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
72 84291 87443 3153 +           Superfamily I DNA/RNA helicase protein locus|SACOL0076, protein_id|YP_184981.1, gi|57652440, geneID|3236882
73 87500 87982 483 + 56         FIG01108341: hypothetical protein locus|SACOL0077, protein_id|YP_184982.1, gi|57652441, geneID|3236867
74 88187 89173 987 + 204     1: 1   Phosphatidylinositol-specific phospholipase C (EC 4.6.1.13) gene_name|plc, locus|SACOL0078, protein_id|YP_184983.1, gi|57652442, geneID|3236868
75 89394 90164 771 + 220         FIG01107885: hypothetical protein locus|SACOL0079, protein_id|YP_184984.1, gi|57652443, geneID|3236869
76 90216 90986 771 + 51         FIG01107885: hypothetical protein locus|SACOL0080, protein_id|YP_184985.1, gi|57652444, geneID|3236870
77 91050 91214 165 + 63         FIG01107885: hypothetical protein locus|SACOL0081, protein_id|YP_184986.1, gi|57652445, geneID|3236871
78 91230 91823 594 + 15         hypothetical protein locus|SACOL0082, protein_id|YP_184987.1, gi|57652446, geneID|3236872
79 91890 92657 768 + 66         FIG01107885: hypothetical protein locus|SACOL0083, protein_id|YP_184988.1, gi|57652447, geneID|3236873
80 92751 94988 2238 + 93         Transcriptional regulator, AraC family locus|SACOL0084, protein_id|YP_184989.1, gi|57652448, geneID|3236874
81 95139 96317 1179 + 150         Catalyzes the cleavage of p-aminobenzoyl-glutamate to p-aminobenzoate and glutamate, subunit A locus|SACOL0085, protein_id|YP_184990.1, gi|57652449, geneID|3236859
82 96319 97707 1389 + 1         putative transporter locus|SACOL0086, protein_id|YP_184991.1, gi|57652450, geneID|3236860

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93062.19.peg.78 hypothetical protein
MTKFDKNDKGTWIIGSEMATQNKGEALKVKGMVLYMNRNTKTTKGYYYVNAIKNDKDGRP
QENEKRYPVKMVDNKIIPTKEIKDKNIKKEIENFKFFVQYGNFKDLSKYKDGDISYNPEV
PSYSAKYQLTNDDYNVKQLRKRYDIPTNKAPKLLLKGTGNLKGSSVGYKDIEFTFVEKKE
ENIYFSDGLIFKPSEDK

MD5 = e18d94e4b3ea8a7854aedac04be9ecce


  DNA Sequence

>fig|93062.19.peg.78 hypothetical protein
atgacgaaatttgataaaaatgataaaggtacatggattattggttctgaaatggcaact
caaaataagggggaagctctgaaagttaaaggtatggtcttgtatatgaatagaaatacc
aaaacaacaaaaggatattattatgtaaatgcaataaagaatgataaagacggaagaccc
caagagaatgaaaaaaggtacccagttaaaatggtcgataataaaatcattccaacaaaa
gaaattaaagataaaaacataaaaaaagaaatcgaaaactttaagttctttgttcaatat
ggaaactttaaagatttgtcgaagtataaagacggagatatttcatataatccagaggtg
ccgagttattcggctaaatatcaattaactaatgatgattacaatgtaaagcaattacgt
aaaagatatgacataccaacaaataaagcaccgaagttgttgttgaagggtacagggaat
ttaaaaggttcatcagttggatataaagacattgaatttacgtttgtagagaaaaaagaa
gagaacatttactttagtgatgggttaatttttaaaccaagtgaggataaataa


  DNA with Flanking Sequence

>fig|93062.19.peg.78 hypothetical protein
atatatcatataatccagaggtgccgagttattcagctcaatatcaattaactaatgatg
attataatgtaaaacaattacgtaaaagatatgacataccaacaaataaagcgccgaagc
tgttgttgaaaggtacagggaatttaaaaggttcatcagttggatataaaaaaattgaat
ttacttttttagagaataaaaatgaaaatatttactttactgatagtctacatcttgaac
cgagcgaggataaataatcatcttttaaccagaatatgaaatcaatctaggacaacctaa
taaaaggagagagttgtaagatgatgaaacgattaaacaaattagtgttaggcattattt
ttctgtttttagtcattagtatcactgctggttgtggcataggtaaagaagcgaaaataa
agaaaagttttgagaagacattgagtatgtatccgattaaaaatctagaggatttatacg
aataaagaaggttattcgtgatgacgaaatttgataaaaatgataaaggtacatggatta
ttggttctgaaatggcaactcaaaataagggggaagctctgaaagttaaaggtatggtct
tgtatatgaatagaaataccaaaacaacaaaaggatattattatgtaaatgcaataaaga
atgataaagacggaagaccccaagagaatgaaaaaaggtacccagttaaaatggtcgata
ataaaatcattccaacaaaagaaattaaagataaaaacataaaaaaagaaatcgaaaact
ttaagttctttgttcaatatggaaactttaaagatttgtcgaagtataaagacggagata
tttcatataatccagaggtgccgagttattcggctaaatatcaattaactaatgatgatt
acaatgtaaagcaattacgtaaaagatatgacataccaacaaataaagcaccgaagttgt
tgttgaagggtacagggaatttaaaaggttcatcagttggatataaagacattgaattta
cgtttgtagagaaaaaagaagagaacatttactttagtgatgggttaatttttaaaccaa
gtgaggataaataatcatgactcgatcaaaatatgaaatcaatccaggaaagataataag
aagaataggattgtgaaattatgaaacgattaaacaaattggtattgtatattagttttt
tgatattagtcattagtttcactgctggttgtggcataggtaaagaagcggaagttaaga
aaagctttgaaaaaacattgagtatgtatccgattaaaaatctagaggatttatacgata
aagaaggttatcgtgatgacgaatttgataaaaatgataaaggtacatggattattggtt
ctgaaatggttgttcaacctaaaggggaacgtatgaaatcaaaaggtatggttctatata
tgaatagaaacactaagactacaaccgggaagtatatagtgagtgaaacacttcatgatg
aagatggtagacctaagagtaaagataaagaatatcccgttaaaatggtagacaataaaa
tcattccaactaaaggtatcaaagacgaaaatat


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search