The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93062.19.peg.473: Staphylococcus aureus subsp. aureus COL

This feature in The SEED Viewer

NCBI Taxonomy Id: 93062

Current Assignment: Tandem lipoprotein within Pathogenicity island
Translate Function Assignments



Context on contig NC_002951 from base 480192 to 492250 (12059 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
467 480192 480869 678 +   4     Exotoxin 8 locus|SACOL0478, protein_id|YP_185368.1, gi|57651319, geneID|3236964
468 480891 482399 1509 + 21         Hypothetical protein within Pathogenicity island SaPIn2 locus|SACOL0479, protein_id|YP_185369.1, gi|57651320, geneID|3236965
469 482811 482503 309 - 103         FIG01108371: hypothetical protein locus|SACOL0480, protein_id|YP_185370.1, gi|57651321, geneID|3236966
470 483149 483949 801 + 337         Tandem lipoprotein within Pathogenicity island locus|SACOL0481, protein_id|YP_185371.1, gi|57651322, geneID|3236967
471 483981 484772 792 + 31         FIG01107840: hypothetical protein locus|SACOL0482, protein_id|YP_185372.1, gi|57651323, geneID|3236968
472 484842 485618 777 + 69         FIG01107840: hypothetical protein locus|SACOL0483, protein_id|YP_185373.1, gi|57651324, geneID|3236969
473 485794 486609 816 + 175       Tandem lipoprotein within Pathogenicity island locus|SACOL0484, protein_id|YP_185374.1, gi|57651325, geneID|3236970
474 486628 487413 786 + 18         FIG01107840: hypothetical protein locus|SACOL0485, protein_id|YP_185375.1, gi|57651326, geneID|3236971
475 487593 488408 816 + 179         Tandem lipoprotein within Pathogenicity island locus|SACOL0486, protein_id|YP_185376.1, gi|57651327, geneID|3236972
476 488398 489726 1329 + -11 4     FIG01107856: hypothetical protein locus|SACOL0487, protein_id|YP_185377.1, gi|57651328, geneID|3236973
477 489723 490046 324 + -4         FIG01107979: hypothetical protein locus|SACOL0488, protein_id|YP_185378.1, gi|57651329, geneID|3236974
478 490146 490379 234 + 99         FIG01108405: hypothetical protein locus|SACOL0489, protein_id|YP_185379.1, gi|57651330, geneID|3236975
479 490929 490669 261 - 289         FIG01108079: hypothetical protein locus|SACOL0490, protein_id|YP_185380.1, gi|57651331, geneID|3236976
480 491048 492250 1203 + 118     2: 1 2   Putative metal chaperone, involved in Zn homeostasis, GTPase of COG0523 family locus|SACOL0491, protein_id|YP_185381.1, gi|57651332, geneID|3236977

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93062.19.peg.473 Tandem lipoprotein within Pathogenicity island
MMGYIKRMALYMSVFLLIIFIVGCRNMKDEQKKEEQTNKTDSKEEQIKKSFEKTLDMYPI
KNLEELYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHY
FVKTFYNKGKFPDRKNYKVEMKNNKIILLDKVEDTNLKKRIENFKFFGQYANLKELKNYN
NGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKK
LEIDFSKGGKSDLSVIDSLNFQPAKVDEDDE

MD5 = 86838ff23c6768338ecc8cf9b8263d93


  DNA Sequence

>fig|93062.19.peg.473 Tandem lipoprotein within Pathogenicity island
atgatggggtatataaaaagaatggctttatacatgagtgtatttcttttaatcattttt
attgttggatgtcgaaatatgaaagatgaacagaaaaaagaagaacaaacaaataaaaca
gattcaaaagaagaacaaatcaaaaagagttttgagaaaacattagatatgtatccaatt
aagaatctcgaggagttatacgacaaagaaggataccgagatggcgaatttaaaaagggt
gataaagggatgtggacgatatatacagatttcgccaaaagtaataaacaaggtggattg
agtaatgaaggtatggtcttatacttagatagaaatacacggactgcaaagggacattat
tttgttaagacattctataataagggcaaattcccagatagaaaaaattataaagttgaa
atgaaaaataataaaattatcttattagataaagtagaagatacaaatctaaaaaagaga
atagaaaactttaaattttttggacaatatgcaaaccttaaagaattgaaaaactacaac
aatggtgatgtctcaattaatgagaatgttccaagttatgacgcaaaatttaaaatgagc
aataaagatgaaaatgttaagcaattaagaagtcgttataatattcctactgataaagca
ccggtattaaaaatgcatattgatggtaatttgaaaggaagttctgtgggttataaaaag
ttggaaattgacttttcaaaaggtggaaaaagcgatttgtcagtaatagattctttgaat
ttccagccggcgaaggtagatgaagatgatgaatga


  DNA with Flanking Sequence

>fig|93062.19.peg.473 Tandem lipoprotein within Pathogenicity island
aattgaagaatttaaattcttcgtacaatacgggaatttcaaagaattggaaaactataa
agacggagaagtgacatataacccagaagcaccaatatactctgcacaatatcaattgaa
aaatagtgattataatgtagaacaactacgtaagcgatataatataacgacgaaaaaagc
gcctaaattattattgaagggttcaggtaatttaaaaggctcatcagttggatataaaaa
tattgaatttacctttgttgaaaataaggaagaaaatatttacttcacagatagtattaa
tttcaacccaagtgaggataaataagtatatttagtattacaaaaacgttagaaaaatta
ataataaagttaaattaacaaactgtattaaattcatatagtcagttttgtttgatgaca
tgatagtagaaaaattattattttaataggttgtatgaactatacaaatatttataaaaa
ttaaaacagagagatgtgaaatgatggggtatataaaaagaatggctttatacatgagtg
tatttcttttaatcatttttattgttggatgtcgaaatatgaaagatgaacagaaaaaag
aagaacaaacaaataaaacagattcaaaagaagaacaaatcaaaaagagttttgagaaaa
cattagatatgtatccaattaagaatctcgaggagttatacgacaaagaaggataccgag
atggcgaatttaaaaagggtgataaagggatgtggacgatatatacagatttcgccaaaa
gtaataaacaaggtggattgagtaatgaaggtatggtcttatacttagatagaaatacac
ggactgcaaagggacattattttgttaagacattctataataagggcaaattcccagata
gaaaaaattataaagttgaaatgaaaaataataaaattatcttattagataaagtagaag
atacaaatctaaaaaagagaatagaaaactttaaattttttggacaatatgcaaacctta
aagaattgaaaaactacaacaatggtgatgtctcaattaatgagaatgttccaagttatg
acgcaaaatttaaaatgagcaataaagatgaaaatgttaagcaattaagaagtcgttata
atattcctactgataaagcaccggtattaaaaatgcatattgatggtaatttgaaaggaa
gttctgtgggttataaaaagttggaaattgacttttcaaaaggtggaaaaagcgatttgt
cagtaatagattctttgaatttccagccggcgaaggtagatgaagatgatgaatgatgag
gatggtgtgtaacaatgaagtctataaaaaggattggattgtgcattagtttgttgattt
taatcatctttgttacatcttgtgatggtgataataagatcattggagattcaaaagaag
aacaaatcaaaaagagctttgcgaaaacgttagatatctaccctattaagaatctcgagg
atttatacgacaaagaaggatatcgagatggcgaatttaaaaaagatgataaaggtactt
ggctaattagatctgaaatgaaaatccaattaaaaggagaaaatctggaatctagaggag
cagttttagaaattaacagaaatactagaacggctaaagggcattatattgttagagaag
ttgttgaagatagcgatggaatgacacacaatcatacaaaaagatatcctgtgaaaatgg
aaaataataaaatgattccattaaaaccaatcgatgacgaaaaagtaaaaaaagaaatcg
aagaatttaacttctt


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0005886       C:plasma membrane
cmr|SACOL0484 Staphylococcus aureus subsp. aureus COL     Staphylococcus tandem lipoprotein
cmr|SAUSA300_0417 Staphylococcus aureus subsp. aureus USA300-FPR3757     staphylococcus tandem lipoprotein
dbj|BAF66682.1 Staphylococcus aureus subsp. aureus str. Newman     staphylococcal tandem lipoprotein
fig|367830.3.peg.2455 Staphylococcus aureus subsp. aureus USA300 FIG   Tandem lipoprotein within Pathogenicity island
fig|426430.6.peg.409 Staphylococcus aureus subsp. aureus str. Newman FIG   Tandem lipoprotein within Pathogenicity island
fig|452948.4.peg.1088 Staphylococcus aureus 930918-3 FIG   Tandem lipoprotein within Pathogenicity island
fig|455227.3.peg.1756 Staphylococcus aureus D30 FIG   Tandem lipoprotein within Pathogenicity island
fig|644279.4.peg.515 Staphylococcus aureus subsp. aureus 132 FIG   Tandem lipoprotein within Pathogenicity island
fig|93062.4.peg.941 Staphylococcus aureus subsp. aureus COL FIG   Tandem lipoprotein within Pathogenicity island
gb|AAW37605.1 Staphylococcus aureus subsp. aureus COL     Staphylococcus tandem lipoprotein
gb|ABD21622.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     staphylococcal tandem lipoprotein
gb|ABX28471.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     hypothetical protein USA300HOU_0445
gb|EEV82691.1 Staphylococcus aureus A5948     staphylococcal tandem lipoprotein
gi|150373422 Staphylococcus aureus subsp. aureus str. Newman NCBI   staphylococcal tandem lipoprotein
gi|151220622 Staphylococcus aureus subsp. aureus str. Newman NCBI   staphylococcal tandem lipoprotein
gi|160367500 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_0445
gi|161508691 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_0445
gi|257859851 Staphylococcus aureus A5948 NCBI   staphylococcal tandem lipoprotein
gi|258452451 Staphylococcus aureus A5948 NCBI   staphylococcal tandem lipoprotein
gi|57285511 Staphylococcus aureus subsp. aureus COL NCBI   Staphylococcus tandem lipoprotein
gi|57651325 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL0484
gi|87127108 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   staphylococcal tandem lipoprotein
gi|87161134 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   staphylococcal tandem lipoprotein
img|637151257 Staphylococcus aureus aureus COL IMG   Staphylococcus tandem lipoprotein
img|637887071 Staphylococcus aureus aureus USA300 IMG   staphylococcal tandem lipoprotein
img|640794770 Staphylococcus aureus aureus Newman IMG   staphylococcal tandem lipoprotein
img|641308399 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   hypothetical protein
kegg|saa:SAUSA300_0417 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   staphylococcal tandem lipoprotein
kegg|sac:SACOL0484 Staphylococcus aureus subsp. aureus COL KEGG   hypothetical protein
kegg|sae:NWMN_0410 Staphylococcus aureus subsp. aureus Newman KEGG   staphylococcal tandem lipoprotein
kegg|sax:USA300HOU_0445 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   hypothetical protein
ref|YP_001331444.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   staphylococcal tandem lipoprotein
ref|YP_001574350.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   hypothetical protein USA300HOU_0445
ref|YP_185374.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL0484
ref|YP_493130.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   staphylococcal tandem lipoprotein
ref|ZP_05700459.1 Staphylococcus aureus A5948 RefSeq   staphylococcal tandem lipoprotein
tr|A6QEA0 Staphylococcus aureus (strain Newman) TrEMBL   Staphylococcal tandem lipoprotein
tr|A8Z0U0 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
4 fig|93062.19.peg.467 Exotoxin 8
4 fig|93062.19.peg.476 FIG01107856: hypothetical protein


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search