The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93062.19.peg.471: Staphylococcus aureus subsp. aureus COL

This feature in The SEED Viewer

NCBI Taxonomy Id: 93062

Current Assignment: FIG01107840: hypothetical protein
Translate Function Assignments



Context on contig NC_002951 from base 478598 to 490046 (11449 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
466 478598 479809 1212 +       3: 1 3 2   Type I restriction-modification system, specificity subunit S locus|SACOL0477, protein_id|YP_185367.1, gi|57651318, geneID|3236963
467 480192 480869 678 + 382         Exotoxin 8 locus|SACOL0478, protein_id|YP_185368.1, gi|57651319, geneID|3236964
468 480891 482399 1509 + 21         Hypothetical protein within Pathogenicity island SaPIn2 locus|SACOL0479, protein_id|YP_185369.1, gi|57651320, geneID|3236965
469 482811 482503 309 - 103         FIG01108371: hypothetical protein locus|SACOL0480, protein_id|YP_185370.1, gi|57651321, geneID|3236966
470 483149 483949 801 + 337         Tandem lipoprotein within Pathogenicity island locus|SACOL0481, protein_id|YP_185371.1, gi|57651322, geneID|3236967
471 483981 484772 792 + 31         FIG01107840: hypothetical protein locus|SACOL0482, protein_id|YP_185372.1, gi|57651323, geneID|3236968
472 484842 485618 777 + 69         FIG01107840: hypothetical protein locus|SACOL0483, protein_id|YP_185373.1, gi|57651324, geneID|3236969
473 485794 486609 816 + 175         Tandem lipoprotein within Pathogenicity island locus|SACOL0484, protein_id|YP_185374.1, gi|57651325, geneID|3236970
474 486628 487413 786 + 18         FIG01107840: hypothetical protein locus|SACOL0485, protein_id|YP_185375.1, gi|57651326, geneID|3236971
475 487593 488408 816 + 179         Tandem lipoprotein within Pathogenicity island locus|SACOL0486, protein_id|YP_185376.1, gi|57651327, geneID|3236972
476 488398 489726 1329 + -11         FIG01107856: hypothetical protein locus|SACOL0487, protein_id|YP_185377.1, gi|57651328, geneID|3236973
477 489723 490046 324 + -4         FIG01107979: hypothetical protein locus|SACOL0488, protein_id|YP_185378.1, gi|57651329, geneID|3236974

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93062.19.peg.471 FIG01107840: hypothetical protein
MEYLKRLALLISVIILTIFIMGCDSQSDTAENPKEGSKEAQIKKSFSKTLDMYPIKNLED
FYDKEGYRDGEFKKDDKGTWLIRSEIVKQPKGKVMKTRGMQLYINRNTETAKGFFVLKEI
SENNNRVNKDKEEKYEVKMVGNKIIPTEQINDEKIKKEIENFKFFVQYGNFKNFEKYNNG
EFSYNPEAPIYSAKYQLHNDDYNVRQLRKRYDISTKETPKLLLKGGGDLKNSSVGQNDIE
FTFVERKGENIYFNDSVEFIPSK

MD5 = 30a7aa1e73aa598de4e6ffd5d7a84d96


  DNA Sequence

>fig|93062.19.peg.471 FIG01107840: hypothetical protein
atggaatatctaaaaaggcttgcattgttaataagtgttattattttgaccatttttata
atgggttgtgatagtcaaagcgatactgcagaaaatccaaaagaaggttcaaaagaagca
caaattaaaaagagtttttcgaaaacgttagatatgtatccaattaagaatctcgaggat
ttttatgacaaagaaggatatcgagatggcgaatttaaaaaagatgataaaggtacttgg
ctaattagatccgaaatagttaaacagccaaagggcaaagtgatgaaaacaagaggtatg
caattatatattaatagaaataccgaaacagccaaaggtttctttgttttgaaagaaata
agtgaaaataataatcgtgtaaataaagataaggaggaaaaatacgaagtgaaaatggta
ggaaataaaattattcctactgaacaaattaatgacgagaaaataaaaaaagaaattgaa
aacttcaagttttttgtgcaatatggaaactttaaaaatttcgaaaaatacaacaatggt
gagttttcatataatcctgaagcaccaatttattcggctaaatatcaattacacaacgat
gattacaatgtaaggcaactacgtaaaagatatgacatttcaacaaaagaaacaccgaag
ttacttttgaaaggtggaggagatttaaaaaattcctcagttggtcaaaacgatattgaa
tttacttttgttgaaagaaaaggtgagaatatttattttaacgatagtgttgaattcata
ccaagtaagtaa


  DNA with Flanking Sequence

>fig|93062.19.peg.471 FIG01107840: hypothetical protein
tagaaatactcgaacggctaagggatattattttgttaagaaattttatgaaaaggataa
attacctgatagaaaaaattataaagttgaaatgaaaaataataaaattatcttattaga
caaggtagaagatccaaatctaaaaaagagaatagaaaactttaaatttttcggacaata
tgcaaattttaaggatttggaaaattacaacaatggcgacgtgtcaataaattggaatgt
tccaagttatgacgtggaatataaaatgagcaataaagatgaaaatgttaaacaattaag
aagtcgttataacattcctactgataaagctccaatgttaaaaatgcatattgacgggga
cttaaaaggtagttctgttggatataaaaggttagaaatagatttttcaaaagaaggtag
ggatatttcagtcattgattatttaagttataagccagcgaaaaaatagtactgataatt
aaatattagggtgtgaaggaatggaatatctaaaaaggcttgcattgttaataagtgtta
ttattttgaccatttttataatgggttgtgatagtcaaagcgatactgcagaaaatccaa
aagaaggttcaaaagaagcacaaattaaaaagagtttttcgaaaacgttagatatgtatc
caattaagaatctcgaggatttttatgacaaagaaggatatcgagatggcgaatttaaaa
aagatgataaaggtacttggctaattagatccgaaatagttaaacagccaaagggcaaag
tgatgaaaacaagaggtatgcaattatatattaatagaaataccgaaacagccaaaggtt
tctttgttttgaaagaaataagtgaaaataataatcgtgtaaataaagataaggaggaaa
aatacgaagtgaaaatggtaggaaataaaattattcctactgaacaaattaatgacgaga
aaataaaaaaagaaattgaaaacttcaagttttttgtgcaatatggaaactttaaaaatt
tcgaaaaatacaacaatggtgagttttcatataatcctgaagcaccaatttattcggcta
aatatcaattacacaacgatgattacaatgtaaggcaactacgtaaaagatatgacattt
caacaaaagaaacaccgaagttacttttgaaaggtggaggagatttaaaaaattcctcag
ttggtcaaaacgatattgaatttacttttgttgaaagaaaaggtgagaatatttatttta
acgatagtgttgaattcataccaagtaagtaaagttaaattaaaatgtgtggttagatga
aatgatcaaatatcaaaaaatgtgcaaagagatgtgacaagatgaagtgttttcagaaat
tatacatatttatattaattttaatcgtattaatggcaggatgcgaaagtaataagatca
ctggagattcgaaagaaacacagatcaaaaagagctttgcgaaaacattagatgtatacc
ctacgaaaaatctagaagatttttatgacaaagaaggatatcgagatggcgaatttaaaa
agggtgacaaagggaagtgggttattagatctgaaatgacaacagaactgaaaaatgaaa
atatggtatctaaaggtatggtcatacgtttaaatagaaatagtagaacatgcactggtg
aatattttgtcaggatagttaaagaagacagtgagggcaaggtatatagtgatgaacgaa
aatatccagtgaaaatggaaaataataaaatcattacattaaaaccaatcga


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0005886       C:plasma membrane
cmr|SACOL0482 Staphylococcus aureus subsp. aureus COL     staphylococcus tandem lipoprotein
dbj|BAF66680.1 Staphylococcus aureus subsp. aureus str. Newman     staphylococcal tandem lipoprotein
fig|426430.6.peg.407 Staphylococcus aureus subsp. aureus str. Newman FIG   FIG01107840: hypothetical protein
fig|426430.8.peg.449 Staphylococcus aureus subsp. aureus str. Newman FIG   FIG01107840: hypothetical protein
fig|93062.4.peg.939 Staphylococcus aureus subsp. aureus COL FIG   FIG01107840: hypothetical protein
gb|AAW37603.1 Staphylococcus aureus subsp. aureus COL     staphylococcus tandem lipoprotein
gi|150373420 Staphylococcus aureus subsp. aureus str. Newman NCBI   staphylococcal tandem lipoprotein
gi|151220620 Staphylococcus aureus subsp. aureus str. Newman NCBI   staphylococcal tandem lipoprotein
gi|57285509 Staphylococcus aureus subsp. aureus COL NCBI   staphylococcus tandem lipoprotein
gi|57651323 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL0482
gi|81695229 organism not parsed/found in ncbi nr NCBI   RecName: Full=Uncharacterized lipoprotein SACOL0482; Flags: Precursor
img|637151255 Staphylococcus aureus aureus COL IMG   staphylococcus tandem lipoprotein
img|640794768 Staphylococcus aureus aureus Newman IMG   staphylococcal tandem lipoprotein
kegg|sac:SACOL0482 Staphylococcus aureus subsp. aureus COL KEGG   hypothetical protein
kegg|sae:NWMN_0408 Staphylococcus aureus subsp. aureus Newman KEGG   staphylococcal tandem lipoprotein
ref|YP_001331442.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   staphylococcal tandem lipoprotein
ref|YP_185372.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL0482
sp|Q5HIN5 Staphylococcus aureus (strain COL) SwissProt   RecName: Full=Uncharacterized lipoprotein SACOL0482; Flags: Precursor
sp|Y482_STAAC organism not parsed/found in ncbi nr SwissProt   RecName: Full=Uncharacterized lipoprotein SACOL0482; Flags: Precursor
tr|A6QE98 Staphylococcus aureus (strain Newman) TrEMBL   Staphylococcal tandem lipoprotein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search