The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93062.19.peg.396: Staphylococcus aureus subsp. aureus COL

This feature in The SEED Viewer

NCBI Taxonomy Id: 93062

Current Assignment: Putative membrane protein YeiH
Translate Function Assignments



Context on contig NC_002951 from base 411374 to 423718 (12345 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
390 411374 412729 1356 +       1: 6   Multi antimicrobial extrusion protein (Na(+)/drug antiporter), MATE family of MDR efflux pumps locus|SACOL0405, protein_id|YP_185297.1, gi|57652594, geneID|3236526
391 412833 413273 441 + 103         FIG01108359: hypothetical protein locus|SACOL0406, protein_id|YP_185298.1, gi|57652595, geneID|3236527
392 414714 413356 1359 - 82         Glycerol-3-phosphate transporter gene_name|glpT, locus|SACOL0407, protein_id|YP_185299.1, gi|57652596, geneID|3236528
393 415022 415882 861 + 307     1: 4   Glyoxalase family protein locus|SACOL0408, protein_id|YP_185300.1, gi|57652597, geneID|3236529
394 415962 417023 1062 + 79         Bacterial luciferase family protein locus|SACOL0409, protein_id|YP_185301.1, gi|57652598, geneID|3236530
395 417037 417603 567 + 13     1: 5   FMN reductase (EC 1.5.1.29) locus|SACOL0410, protein_id|YP_185302.1, gi|57652599, geneID|3236531
396 418658 417663 996 - 59         Putative membrane protein YeiH locus|SACOL0411, protein_id|YP_185303.1, gi|57652600, geneID|3236516
397 418657 419052 396 + -2         FIG01107884: hypothetical protein locus|SACOL0412, protein_id|YP_185304.1, gi|57652601, geneID|3236517
398 419132 419677 546 + 79     2: 3 2   Ribosomal-protein-L7p-serine acetyltransferase locus|SACOL0413, protein_id|YP_185305.1, gi|57652602, geneID|3236518
399 419945 420799 855 + 267     1: 1   Ferrous iron transport periplasmic protein EfeO, contains peptidase-M75 domain and (frequently) cupredoxin-like domain locus|SACOL0414, protein_id|YP_185306.1, gi|57652603, geneID|3236519
400 420796 422025 1230 + -4     1: 1   Ferrous iron transport peroxidase EfeB locus|SACOL0415, protein_id|YP_185307.1, gi|57652604, geneID|3236520
401 422006 423718 1713 + -20     1: 1   Ferrous iron transport permease EfeU locus|SACOL0416, protein_id|YP_185308.1, gi|57652605, geneID|3236521

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93062.19.peg.396 Putative membrane protein YeiH
MASLKNKHFMIGLSLTFIVALFSFLAAKLPILDKVGALTIAILIAILYRHFRGYPEQYSS
GITFSSKYLLRFAIILYGLKLNIFDIIGQGSKLLAIDVGVVIFSIVMMLFVNKLLHGDKN
IALLLGVGTGVCGAAAIAAVAPIFKSREKDTAISIGIIALIGTIFSLIYTAIYAIFSMTT
NVYGAWSGVSLHEIAHVVLAGGFGGSDALKIALLGKLGRVFLLIPLTIVLILIMRFRSSE
SSSKGRISIPYFLIGFVIMALVNTYVTIPSALLNILNTVSTICLLMAMVALGLNVAFKDL
KNRALKPLMTIIITSICLSSLAFIVVHWLYS

MD5 = c08ab27c5004f6f5c6de902cfa687d14


  DNA Sequence

>fig|93062.19.peg.396 Putative membrane protein YeiH
atggcatcattgaaaaataagcattttatgattgggctatcactaacatttatagtcgca
ttatttagctttttagcagctaaattgccaatcctagataaggttggcgcattaactatc
gcgatattaatcgctattctatatcgtcactttagaggatatcctgaacaatatagctca
ggtattacgttttcatctaaatatttattaagatttgcaatcatcctatatggacttaaa
ctcaatatattcgatattatcggtcaaggtagtaaactattagccatcgatgtaggtgtc
gttattttcagtattgtaatgatgctctttgtcaacaaactgttgcatggtgacaaaaac
atcgcattattactaggtgtcggcacaggcgtttgtggtgctgctgctattgccgcagtc
gctccaatattcaaatcacgtgaaaaggatacagctattagtatcggtatcatcgcattg
attggtacgatattttcacttatatatacagctatctacgctatcttttcaatgacgaca
aatgtttatggcgcttggtctggtgttagtcttcatgaaattgcacacgttgtcttagct
ggtggctttggtggtagtgatgcacttaaaattgcacttcttggtaaacttggtagagta
ttcttactgattccattaaccatcgtacttattttaattatgcgtttccgttcatcagaa
tcatctagcaagggtcgaataagcattccatactttttaattggatttgtcattatggcc
ttagtgaatacatatgtaactattccgtcagcattgctaaatattttaaatactgtatca
acaatttgcttattaatggccatggttgctttagggttaaatgttgcatttaaagatctt
aaaaatcgcgcacttaaaccgcttatgacaatcattattacctcaatatgcttgtcatca
cttgcctttatcgtcgttcattggctatatagttaa


  DNA with Flanking Sequence

>fig|93062.19.peg.396 Putative membrane protein YeiH
ttgttcattcactttcattccaaacataccatcacatcctcattcatttttcatataatt
ctgtaaattatcattataataacatattaatgttacgcattgtatcttaaatttgttgtc
cttccccaacttgcattgcttgtagaatttcttttcgaaattctctatgttggggccccg
ccaacttgcattgcttgtagaatttcttttcgaaattctctatgttggggccccgccaac
ttgcattgtctgtagaaattacggacccaatttctctatgttggggcccatccccaactt
gcacattattgtaagctgacttttcgtcagcttctttgttggggccccgccaataagcgt
tgtagtgcctattactttgattgatgtccaagtttcctatcacacaacttaatttaatca
ctactttattattcattccaaatttatatttaaaaatacgacaaaacagtgctaaaatgc
tattaaaggaggcactgctcatggcatcattgaaaaataagcattttatgattgggctat
cactaacatttatagtcgcattatttagctttttagcagctaaattgccaatcctagata
aggttggcgcattaactatcgcgatattaatcgctattctatatcgtcactttagaggat
atcctgaacaatatagctcaggtattacgttttcatctaaatatttattaagatttgcaa
tcatcctatatggacttaaactcaatatattcgatattatcggtcaaggtagtaaactat
tagccatcgatgtaggtgtcgttattttcagtattgtaatgatgctctttgtcaacaaac
tgttgcatggtgacaaaaacatcgcattattactaggtgtcggcacaggcgtttgtggtg
ctgctgctattgccgcagtcgctccaatattcaaatcacgtgaaaaggatacagctatta
gtatcggtatcatcgcattgattggtacgatattttcacttatatatacagctatctacg
ctatcttttcaatgacgacaaatgtttatggcgcttggtctggtgttagtcttcatgaaa
ttgcacacgttgtcttagctggtggctttggtggtagtgatgcacttaaaattgcacttc
ttggtaaacttggtagagtattcttactgattccattaaccatcgtacttattttaatta
tgcgtttccgttcatcagaatcatctagcaagggtcgaataagcattccatactttttaa
ttggatttgtcattatggccttagtgaatacatatgtaactattccgtcagcattgctaa
atattttaaatactgtatcaacaatttgcttattaatggccatggttgctttagggttaa
atgttgcatttaaagatcttaaaaatcgcgcacttaaaccgcttatgacaatcattatta
cctcaatatgcttgtcatcacttgcctttatcgtcgttcattggctatatagttaatatg
aaaagacgctcaaacacttacaaatttagtgtgccgagcgtcttatttttatactttaaa
agtcgtattggttgttttcttcttcaaacacttgttgttgtactttggcagttcgcattg
tggattgtgccaacgcttttaaccgaaatacaacatcatcattgacaatttgttgatttg
aaaaatctttctcttcaataaatacatacgtttgcatcgtatgtgctttcatgtaactca
atattggttttaaatgcatttcaggaattaaataatgtttactagaacctgctgtcgcta
caagtcctattaccttgtcacgaaacgcattgactggaagtagatcaaacacatttttca
aagcaccagggatggaagcttgaaaaattggaaaaccaataaaaatcacatcagcctgca
ttaacgacgtcgttaatttatatacatctcctgtagtatctagataattctttccaacgc
taaattctaattcaag


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0005886       C:plasma membrane
GO:0016021       C:integral to membrane
cmr|NT05SA0286 Staphylococcus aureus NCTC 8325     hypothetical membrane protein
cmr|SACOL0411 Staphylococcus aureus subsp. aureus COL     membrane protein, putative
cmr|SAUSA300_0341 Staphylococcus aureus subsp. aureus USA300-FPR3757     putative membrane protein
dbj|BAF66605.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
fig|367830.3.peg.240 Staphylococcus aureus subsp. aureus USA300 FIG   Putative membrane protein YeiH
fig|426430.6.peg.335 Staphylococcus aureus subsp. aureus str. Newman FIG   Putative membrane protein YeiH
fig|426430.8.peg.366 Staphylococcus aureus subsp. aureus str. Newman FIG   Putative membrane protein YeiH
fig|451515.3.peg.404 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Putative membrane protein YeiH
fig|451516.9.peg.394 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Putative membrane protein YeiH
fig|452948.4.peg.2319 Staphylococcus aureus 930918-3 FIG   Putative membrane protein YeiH
fig|455227.3.peg.914 Staphylococcus aureus D30 FIG   Putative membrane protein YeiH
fig|553567.3.peg.2573 Staphylococcus aureus A5948 FIG   Putative membrane protein YeiH
fig|553590.4.peg.2046 Staphylococcus aureus A9754 FIG   Putative membrane protein YeiH
fig|644279.4.peg.408 Staphylococcus aureus subsp. aureus 132 FIG   Putative membrane protein YeiH
fig|93061.3.peg.324 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Putative membrane protein YeiH
fig|93061.5.peg.293 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Putative membrane protein YeiH
fig|93062.4.peg.870 Staphylococcus aureus subsp. aureus COL FIG   Putative membrane protein YeiH
gb|AAW38880.1 Staphylococcus aureus subsp. aureus COL     membrane protein, putative
gb|ABD21783.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     putative membrane protein
gb|ABD29490.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABX28391.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     hypothetical membrane protein
gb|EEV82131.1 Staphylococcus aureus A5948     conserved hypothetical protein
gb|EEW47540.1 Staphylococcus aureus D30     hypothetical protein SAD30_0752
gi|150373345 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|151220545 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_0333
gi|160367420 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical membrane protein
gi|161508611 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_0361
gi|257859276 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|258453066 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|259162978 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_0752
gi|57286786 Staphylococcus aureus subsp. aureus COL NCBI   membrane protein, putative
gi|57652600 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL0411
gi|81695289 organism not parsed/found in ncbi nr NCBI   RecName: Full=UPF0324 membrane protein SACOL0411
gi|87127269 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   putative membrane protein
gi|87161295 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   hypothetical protein SAUSA300_0341
gi|87201680 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88194122 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_00322
img|637151186 Staphylococcus aureus aureus COL IMG   hypothetical protein
img|637886996 Staphylococcus aureus aureus USA300 IMG   hypothetical protein
img|637892985 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|640794693 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|641308319 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   hypothetical membrane protein
img|641773022 Staphylococcus aureus aureus USA300_TCH959 IMG   hypothetical membrane protein
kegg|saa:SAUSA300_0341 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   hypothetical protein
kegg|sac:SACOL0411 Staphylococcus aureus subsp. aureus COL KEGG   hypothetical protein
kegg|sae:NWMN_0333 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sao:SAOUHSC_00322 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sax:USA300HOU_0361 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   hypothetical protein
ref|YP_001331367.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_0333
ref|YP_001574270.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   hypothetical protein USA300HOU_0361
ref|YP_185303.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL0411
ref|YP_493055.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   hypothetical protein SAUSA300_0341
ref|YP_498911.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_00322
ref|ZP_05701059.1 Staphylococcus aureus A5948 RefSeq   conserved hypothetical protein
sp|Q5HIV4 Staphylococcus aureus (strain COL) SwissProt   RecName: Full=UPF0324 membrane protein SACOL0411
sp|Y411_STAAC organism not parsed/found in ncbi nr SwissProt   RecName: Full=UPF0324 membrane protein SACOL0411
tr|A6QE23 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein
tr|A8YZG5 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Hypothetical membrane protein
tr|Q2FJS3 Staphylococcus aureus (strain USA300) TrEMBL   Putative membrane protein
tr|Q2G134 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search