The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93062.19.peg.374: Staphylococcus aureus subsp. aureus COL

This feature in The SEED Viewer

NCBI Taxonomy Id: 93062

Current Assignment: Phage holin
Translate Function Assignments



Context on contig NC_002951 from base 389456 to 400749 (11294 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
367 389456 391039 1584 +           Phage phi 11 orf44 protein homolog locus|SACOL0381, protein_id|YP_185273.1, gi|57652570, geneID|3236639
368 391039 391329 291 + -1         Phage protein locus|SACOL0382, protein_id|YP_185274.1, gi|57652571, geneID|3236640
369 391345 393255 1911 + 15     1: 1   Putative major teichoic acid biosynthesis protein C locus|SACOL0383, protein_id|YP_185275.1, gi|57652572, geneID|3236641
370 393255 394721 1467 + -1         Phage protein locus|SACOL0384, protein_id|YP_185276.1, gi|57652573, geneID|3236642
371 394721 395110 390 + -1         Phage phi 11 orf46 protein homolog locus|SACOL0385, protein_id|YP_185277.1, gi|57652574, geneID|3236643
372 395103 395267 165 + -8         Phage protein locus|SACOL0386, protein_id|YP_185278.1, gi|57652575, geneID|3236644
373 395292 395612 321 + 24         Phage protein locus|SACOL0387, protein_id|YP_185279.1, gi|57652576, geneID|3236645
374 395748 396050 303 + 135         Phage holin locus|SACOL0388, protein_id|YP_185280.1, gi|57652577, geneID|3236631
375 396062 397516 1455 + 11         Phage N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) locus|SACOL0389, protein_id|YP_185281.1, gi|57652578, geneID|3236632
376 398286 398408 123 + 769         Lipase precursor (EC 3.1.1.3) locus|SACOL0390, protein_id|YP_185282.1, gi|57652579, geneID|3236633
377 399477 398650 828 - 241         FIG01108623: hypothetical protein locus|SACOL0391, protein_id|YP_185283.1, gi|57652580, geneID|3236634
378 400749 399550 1200 - 72         Probable NADH-dependent flavin oxidoreductase in cluster with COG2110 locus|SACOL0392, protein_id|YP_185284.1, gi|57652581, geneID|3236635

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93062.19.peg.374 Phage holin
MDAKVITRYIVLILALVNQFLANKGISPIPVDEESVSSIILTVVALYTTYKDNPTSQEGK
WANQKLKKYKAESKYRKATGQAPIKEVMTPTNMNDTNDLG

MD5 = 74f70170d61b6593a79abbeb6a879df4


  DNA Sequence

>fig|93062.19.peg.374 Phage holin
atggatgcaaaagtaataacaagatacatcgtattgatcttagcattagtaaatcaattc
ttagcgaataaaggtataagtccgataccagtagatgaagaaagtgtttcatcgattatc
ttaacagttgttgctttatatactacatataaagataatccaacatctcaagaagggaaa
tgggcgaatcaaaaattaaagaaatataaagctgaaagtaaatatagaaaagcaacagga
caagcacctattaaagaagtaatgacacctacgaatatgaacgacacaaatgatttaggg
tag


  DNA with Flanking Sequence

>fig|93062.19.peg.374 Phage holin
cagaaaatctagagtcataggttataatcttatggctttttaatttgaataaagtgggtg
gtgtaatgtttggatttaccaaacgacacgaacaagattggcgtttaacgcgattagaag
aaaatgataagactatgtttgaaaaattcgacagaatagaagacagtctgagaacgcaag
aaaaaatttatgacaagttagatagaaatttcgaagaactaaggcgtgacaaagaagaag
atgaaaaaaataaagagaaaaatgctaaaaatattagagacatcaagatgtggattctag
gattaatagggacgattctaagtacatttgttatagccttgttaaaaactatttttggca
tttaaaggaggtgatcaccatgcttaagggaattttaggatatagcttttggtcgtgttt
ctggtttggtaagtgtaagtaatatttaagagtcagtgcttcggcactggctttttattt
tggaaaaaaggagcaaacaaatggatgcaaaagtaataacaagatacatcgtattgatct
tagcattagtaaatcaattcttagcgaataaaggtataagtccgataccagtagatgaag
aaagtgtttcatcgattatcttaacagttgttgctttatatactacatataaagataatc
caacatctcaagaagggaaatgggcgaatcaaaaattaaagaaatataaagctgaaagta
aatatagaaaagcaacaggacaagcacctattaaagaagtaatgacacctacgaatatga
acgacacaaatgatttagggtaggtggttgatatatgttaatgacaaaaaatcaagcaga
aaaatggtttgacaattcattagggaaacaattcaacccagatggttggtatggatttca
gtgttatgattacgccaatatgttctttatgttagcgacaggcgaaaggctgcaaggttt
atatgcttataatatcccgtttgataataaagcaaagattgaaaaatatggtcaaataat
taaaaactatgacagctttttaccgcaaaagttggacattgtcgttttcccgtcaaagta
tggtggcggagctggacacgttgaaattgttgagagcgcaaatttaaatactttcacatc
atttggtcaaaactggaacggtaaaggttggactaatggcgttgcgcaacctggttgggg
tcctgaaactgtgacaagacatgttcattattatgacaatccaatgtattttattaggtt
aaacttccctaacaacttaagcgttggcaataaagctaaaggt


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|SACOL0388 Staphylococcus aureus subsp. aureus COL     prophage L54a, holin, SPP1 family
cmr|SAUSA300_1384 Staphylococcus aureus subsp. aureus USA300-FPR3757     phiSLT ORF100b-like protein, holin
dbj|BAB21752.1 Staphylococcus phage phiSLT     holin
dbj|BAF66584.1 Staphylococcus aureus subsp. aureus str. Newman     phage holin
dbj|BAF68042.1 Staphylococcus aureus subsp. aureus str. Newman     phage holin
fig|130478.1.peg.59 Staphylococcus aureus temperate phage phiSLT FIG   Phage holin
fig|320835.3.peg.54 Bacteriophage 53 FIG   Phage holin
fig|320843.3.peg.61 Bacteriophage ROSA FIG   Phage holin
fig|367830.3.peg.1891 Staphylococcus aureus subsp. aureus USA300 FIG   Phage holin
fig|387905.2.peg.63 Siphoviridae Staphylococcus phage phiNM FIG   Phage holin
fig|387910.2.peg.67 Siphoviridae Staphylococcus aureus phage phiNM4 FIG   Phage holin
fig|426430.6.peg.1714 Staphylococcus aureus subsp. aureus str. Newman FIG   Phage holin
fig|426430.6.peg.313 Staphylococcus aureus subsp. aureus str. Newman FIG   Phage holin
fig|426430.8.peg.1912 Staphylococcus aureus subsp. aureus str. Newman FIG   Phage holin
fig|426430.8.peg.344 Staphylococcus aureus subsp. aureus str. Newman FIG   Phage holin
fig|445516.2.peg.65 Viruses Staphylococcus phage tp310-2 Viruses. FIG   Phage holin
fig|451515.3.peg.1514 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Phage holin
fig|451516.9.peg.1519 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Phage holin
fig|53369.2.peg.70 Siphoviridae Staphylococcus phage 80alpha FIG   Phage holin
fig|553590.4.peg.516 Staphylococcus aureus A9754 FIG   Phage holin
fig|553594.3.peg.771 Staphylococcus aureus A9765 FIG   Phage holin
fig|585153.3.peg.2457 Staphylococcus aureus subsp. aureus E1410 FIG   Phage holin
fig|93062.4.peg.847 Staphylococcus aureus subsp. aureus COL FIG   Phage holin
gb|AAW38857.1 Staphylococcus aureus subsp. aureus COL     prophage L54a, holin, SPP1 family
gb|AAX90874.1 Bacteriophage 53     ORF051
gb|AAX91542.1 Bacteriophage ROSA     ORF050
gb|ABD21333.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     phiSLT ORF100b-like protein, holin
gb|ABF71641.1 Staphylococcus phage 80alpha     holin
gb|ABF73093.1 Staphylococcus aureus phage phiNM1     holin
gb|ABF73292.1 Staphylococcus aureus phage phiNM4     holin
gb|ABS87527.1 Staphylococcus phage tp310-2     holin
gb|ABX29442.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     holin
gb|EEV11276.1 Staphylococcus aureus subsp. aureus E1410     prophage L54a
gi|103058698 Staphylococcus phage 80alpha NCBI   holin
gi|104641679 Staphylococcus aureus phage phiNM1 NCBI   holin
gi|104641984 Staphylococcus aureus phage phiNM4 NCBI   holin
gi|118430787 Staphylococcus phage phiNM NCBI   holin
gi|12697880 Staphylococcus phage phiSLT NCBI   holin
gi|12719450 Staphylococcus phage phiSLT NCBI   holin
gi|148717912 Staphylococcus phage 80alpha NCBI   holin
gi|150373324 Staphylococcus aureus subsp. aureus str. Newman NCBI   phage holin
gi|150374782 Staphylococcus aureus subsp. aureus str. Newman NCBI   phage holin
gi|151220524 Staphylococcus aureus subsp. aureus str. Newman NCBI   phage holin
gi|151221982 Staphylococcus aureus subsp. aureus str. Newman NCBI   phage holin
gi|154818100 Staphylococcus phage tp310-2 NCBI   holin
gi|156604014 Staphylococcus phage tp310-2 NCBI   holin
gi|160368471 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   holin
gi|161509662 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   holin
gi|257281135 Staphylococcus aureus subsp. aureus E1410 NCBI   prophage L54a
gi|257433962 Staphylococcus aureus subsp. aureus E1410 NCBI   prophage L54a
gi|57286763 Staphylococcus aureus subsp. aureus COL NCBI   prophage L54a, holin, SPP1 family
gi|57652577 Staphylococcus aureus subsp. aureus COL NCBI   prophage L54a, holin
gi|62635763 Bacteriophage 53 NCBI   ORF051
gi|62636431 Bacteriophage ROSA NCBI   ORF050
gi|66395413 Staphylococcus phage 53 NCBI   ORF051
gi|66396011 Staphylococcus phage ROSA NCBI   ORF050
gi|87126819 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   phiSLT ORF100b-like protein, holin
gi|87160845 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   phiSLT ORF100b-like protein, holin
img|637151163 Staphylococcus aureus aureus COL IMG   prophage L54a, holin, SPP1 family
img|637888036 Staphylococcus aureus aureus USA300 IMG   phiSLT ORF100b-like protein, holin
img|638286644 Staphylococcus aureus temperate phage phiSLT IMG   holin
img|638314094 Bacteriophage 53 IMG   ORF051
img|638314751 Bacteriophage ROSA IMG   ORF050
img|640794672 Staphylococcus aureus aureus Newman IMG   phage holin
img|640796187 Staphylococcus aureus aureus Newman IMG   phage holin
img|641203618 Staphylococcus aureus phage phiNM provirus IMG   holin
img|641208733 Staphylococcus phage 80alpha IMG   holin
img|641210037 Staphylococcus phage tp310-2 provirus IMG   holin
img|641309394 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   holin
img|641771046 Staphylococcus aureus aureus USA300_TCH959 IMG   holin
kegg|saa:SAUSA300_1384 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   phiSLT ORF100b-like protein, holin
kegg|sac:SACOL0388 Staphylococcus aureus subsp. aureus COL KEGG   prophage L54a, holin
kegg|sae:NWMN_0312 Staphylococcus aureus subsp. aureus Newman KEGG   phage holin
kegg|sae:NWMN_1770 Staphylococcus aureus subsp. aureus Newman KEGG   phage holin
kegg|sax:USA300HOU_1433 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   holin
ref|NP_075521.1 Staphylococcus phage phiSLT RefSeq   holin
ref|YP_001285384.1 Staphylococcus phage 80alpha RefSeq   holin
ref|YP_001331346.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   phage holin
ref|YP_001332804.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   phage holin
ref|YP_001429960.1 Staphylococcus phage tp310-2 RefSeq   holin
ref|YP_001575321.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   holin
ref|YP_185280.1 Staphylococcus aureus subsp. aureus COL RefSeq   prophage L54a, holin
ref|YP_239675.1 Staphylococcus phage 53 RefSeq   ORF051
ref|YP_240332.1 Staphylococcus phage ROSA RefSeq   ORF050
ref|YP_494081.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   phiSLT ORF100b-like protein, holin
ref|YP_874012.1 Staphylococcus phage phiNM RefSeq   holin
ref|ZP_05610316.1 Staphylococcus aureus subsp. aureus E1410 RefSeq   prophage L54a
tr|A0EWN4 Staphylococcus aureus phage phiNM1 TrEMBL   Holin
tr|A0EX83 Staphylococcus aureus phage phiNM4 TrEMBL   Holin
tr|A4ZFD6 Staphylococcus phage 80alpha TrEMBL   Holin
tr|A6QE02 Staphylococcus aureus (strain Newman) TrEMBL   Phage holin
tr|A7TWL0 Staphylococcus phage tp310-2 TrEMBL   Holin
tr|A8Z267 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Holin
tr|Q2FGU7 Staphylococcus aureus (strain USA300) TrEMBL   PhiSLT ORF100b-like protein, holin
tr|Q4ZBP4 Staphylococcus phage ROSA TrEMBL   ORF050
tr|Q4ZDK1 Staphylococcus phage 53 TrEMBL   ORF051
tr|Q5HIX7 Staphylococcus aureus (strain COL) TrEMBL   Prophage L54a, holin, SPP1 family
tr|Q9B0C4 Staphylococcus phage phiSLT TrEMBL   Holin


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search