The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93062.19.peg.372: Staphylococcus aureus subsp. aureus COL

This feature in The SEED Viewer

NCBI Taxonomy Id: 93062

Current Assignment: Phage protein
Translate Function Assignments



Context on contig NC_002951 from base 389456 to 400749 (11294 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
367 389456 391039 1584 +           Phage phi 11 orf44 protein homolog locus|SACOL0381, protein_id|YP_185273.1, gi|57652570, geneID|3236639
368 391039 391329 291 + -1         Phage protein locus|SACOL0382, protein_id|YP_185274.1, gi|57652571, geneID|3236640
369 391345 393255 1911 + 15     1: 1   Putative major teichoic acid biosynthesis protein C locus|SACOL0383, protein_id|YP_185275.1, gi|57652572, geneID|3236641
370 393255 394721 1467 + -1         Phage protein locus|SACOL0384, protein_id|YP_185276.1, gi|57652573, geneID|3236642
371 394721 395110 390 + -1         Phage phi 11 orf46 protein homolog locus|SACOL0385, protein_id|YP_185277.1, gi|57652574, geneID|3236643
372 395103 395267 165 + -8         Phage protein locus|SACOL0386, protein_id|YP_185278.1, gi|57652575, geneID|3236644
373 395292 395612 321 + 24         Phage protein locus|SACOL0387, protein_id|YP_185279.1, gi|57652576, geneID|3236645
374 395748 396050 303 + 135         Phage holin locus|SACOL0388, protein_id|YP_185280.1, gi|57652577, geneID|3236631
375 396062 397516 1455 + 11         Phage N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) locus|SACOL0389, protein_id|YP_185281.1, gi|57652578, geneID|3236632
376 398286 398408 123 + 769         Lipase precursor (EC 3.1.1.3) locus|SACOL0390, protein_id|YP_185282.1, gi|57652579, geneID|3236633
377 399477 398650 828 - 241         FIG01108623: hypothetical protein locus|SACOL0391, protein_id|YP_185283.1, gi|57652580, geneID|3236634
378 400749 399550 1200 - 72         Probable NADH-dependent flavin oxidoreductase in cluster with COG2110 locus|SACOL0392, protein_id|YP_185284.1, gi|57652581, geneID|3236635

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93062.19.peg.372 Phage protein
MPKLISPTFEDIKTWYQLKEYSKEDIAWYVDMEVIDKEEYAIITGEKYPENLES

MD5 = bc96cac8b6c41ff9d5af09ac14518855


  DNA Sequence

>fig|93062.19.peg.372 Phage protein
atgcctaaattaatttcaccaacattcgaagatattaaaacatggtatcaattgaaagaa
tatagtaaagaagatatagcgtggtatgtagatatggaagttatagataaagaggaatat
gcaattattacaggagaaaagtatccagaaaatctagagtcatag


  DNA with Flanking Sequence

>fig|93062.19.peg.372 Phage protein
ctagtcgtacatctttaactatatcaaacgatgtctatttcgacttaggaagtcaaagag
gctctggtgcgaacgcaaatagagggacaattaacaaaattataggagtgagaaaataat
gcaaatattagttaacaagcgtaatgagataatttcatacgctatcattggcggctttga
agaaggtattgatattgaaaatttaccagaaaatttctctcaagtttttagacctaaagc
ctttaaatattcaaatggggaaatagtttttaacgaagattattcagaagaaaaagatga
cttgcatcaacagattgacagtgaagaacaaaacacagtcgcttctgatgacatcttacg
aaaaatggttgctagtatgcagaaacaagttgttcaaagtacaaagttatcgatgcaagt
taataagcaaaatgcactaatggcaaaacaacttgtgacacttaataaaaaattagaaga
ggttaaaggagagactgaaaatgcctaaattaatttcaccaacattcgaagatattaaaa
catggtatcaattgaaagaatatagtaaagaagatatagcgtggtatgtagatatggaag
ttatagataaagaggaatatgcaattattacaggagaaaagtatccagaaaatctagagt
cataggttataatcttatggctttttaatttgaataaagtgggtggtgtaatgtttggat
ttaccaaacgacacgaacaagattggcgtttaacgcgattagaagaaaatgataagacta
tgtttgaaaaattcgacagaatagaagacagtctgagaacgcaagaaaaaatttatgaca
agttagatagaaatttcgaagaactaaggcgtgacaaagaagaagatgaaaaaaataaag
agaaaaatgctaaaaatattagagacatcaagatgtggattctaggattaatagggacga
ttctaagtacatttgttatagccttgttaaaaactatttttggcatttaaaggaggtgat
caccatgcttaagggaattttaggatatagcttttggtcgtgtttctggtttggtaagtg
taagtaatatttaagagtcagtgcttcggcactggctttttattttggaaaaaaggagca
aacaaatggatgcaaaagtaataac


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|SACOL0386 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein TIGR01669
fig|93062.4.peg.845 Staphylococcus aureus subsp. aureus COL FIG   Phage protein
gb|AAW38855.1 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein TIGR01669
gi|57286761 Staphylococcus aureus subsp. aureus COL NCBI   conserved hypothetical protein TIGR01669
gi|57652575 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL0386
img|637151161 Staphylococcus aureus aureus COL IMG   hypothetical protein
kegg|sac:SACOL0386 Staphylococcus aureus subsp. aureus COL KEGG   hypothetical protein
ref|YP_185278.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL0386
tr|Q5HIX9 Staphylococcus aureus (strain COL) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search