The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93062.19.peg.369: Staphylococcus aureus subsp. aureus COL

This feature in The SEED Viewer

NCBI Taxonomy Id: 93062

Current Assignment: Putative major teichoic acid biosynthesis protein C
Translate Function Assignments



Context on contig NC_002951 from base 382423 to 397516 (15094 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
365 382423 388623 6201 +       1: 1   Phage tail length tape-measure protein locus|SACOL0379, protein_id|YP_185271.1, gi|57652568, geneID|3236652
366 388623 389447 825 + -1         Phage A118 gp17 protein homolog locus|SACOL0380, protein_id|YP_185272.1, gi|57652569, geneID|3236638
367 389456 391039 1584 + 8         Phage phi 11 orf44 protein homolog locus|SACOL0381, protein_id|YP_185273.1, gi|57652570, geneID|3236639
368 391039 391329 291 + -1         Phage protein locus|SACOL0382, protein_id|YP_185274.1, gi|57652571, geneID|3236640
369 391345 393255 1911 + 15     1: 2   Putative major teichoic acid biosynthesis protein C locus|SACOL0383, protein_id|YP_185275.1, gi|57652572, geneID|3236641
370 393255 394721 1467 + -1         Phage protein locus|SACOL0384, protein_id|YP_185276.1, gi|57652573, geneID|3236642
371 394721 395110 390 + -1         Phage phi 11 orf46 protein homolog locus|SACOL0385, protein_id|YP_185277.1, gi|57652574, geneID|3236643
372 395103 395267 165 + -8         Phage protein locus|SACOL0386, protein_id|YP_185278.1, gi|57652575, geneID|3236644
373 395292 395612 321 + 24         Phage protein locus|SACOL0387, protein_id|YP_185279.1, gi|57652576, geneID|3236645
374 395748 396050 303 + 135         Phage holin locus|SACOL0388, protein_id|YP_185280.1, gi|57652577, geneID|3236631
375 396062 397516 1455 + 11         Phage N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) locus|SACOL0389, protein_id|YP_185281.1, gi|57652578, geneID|3236632

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Teichoic_and_lipoteichoic_acids_biosynthesis OlgaV Putative major teichoic acid biosynthesis protein C


  Protein Sequence

>fig|93062.19.peg.369 Putative major teichoic acid biosynthesis protein C
MENLYLIKDLGALAGRDYRAKEIQNLQRIEQFALGLTTEFKLHQKAKTMQHFAEQIYYNG
RSQAAVNKSLQSQINALVVAPRNNSANEIVQARVNVNGETFDTLKEHLDDWETKTQINKE
ETIRELNKTKQEILDIEYRFEPDKQEFLFVTELAPLTNAVMQSFWFDNRTGIVYMTQARN
NGYMLSRLRPNGQFIDSSLIVGGGHGTHNGYRYIDDELWIYSFILNGNNENTLVRFKYTP
NVEISYGKYGMQDVFTGHPEKPYITPVINEKENKILYRIERPRSQWELENSMNYIEIRSL
DDVDKNIDKVLHKISIPMRLTNETQPMQGVTFDEKYLYWYTGDSNPNNRNYLTAFDLETG
EEAYQVNADYGGTLDSFPGEFAEAEGLQIYYDKDSGKKALMLGVTVGGDGNRTHRIFMIG
QRGILEILHSRGVPFIMSDTGGRVKPLPMRPDKLKNLGMLTEPGLYYLYTDHTVQIDDFP
LPREWRDAGWFLEVKPPQTGGDVIQILTRNSYARNMMTFERVLSGRTGDISDWNYVPKNS
GKWERVPSFITKMSDINIVGMSFYLTTDDTKRFTDFPTERKGVAGWNLYVEASNTGGFVH
RLVRNSVTASAEILLKNYDSKISSGPWTLHEGRIIS

MD5 = f44ea094584c14adddf98d10b0fff586


  DNA Sequence

>fig|93062.19.peg.369 Putative major teichoic acid biosynthesis protein C
atggaaaatttgtatttaataaaggatttgggagctttagcaggtcgagattatagagct
aaagaaattcaaaacctgcaaagaatagagcaatttgcgcttggcttgacaacagagttt
aagttgcatcagaaagctaaaacaatgcaacacttcgctgagcaaatttattataatggt
agatcgcaagcagcagtaaacaaatctttacaaagtcaaattaacgcacttgttgtggca
ccacgtaataacagtgctaatgagattgttcaagctcgagttaatgtaaacggcgaaacc
tttgacacattaaaagaacatttagacgattgggaaaccaaaactcaaattaataaagag
gaaactataagagaattaaataagaccaaacaagaaattcttgatatcgagtatcgtttt
gaacctgataagcaagagtttttatttgtgacagaacttgcacctcttacaaatgcagta
atgcaatccttctggtttgataatagaacaggcatagtatacatgacacaagctagaaat
aatggctatatgctaagtcgtttaagacctaatggtcaatttatagacagctcattgatt
gtaggtgggggtcatggtacacataacggttatagatatattgatgatgagttatggatt
tatagttttatcttaaatggtaataatgagaatacattagttcgtttcaagtatacgcct
aatgtggaaattagctatggcaagtatggtatgcaagatgtatttacaggacacccagaa
aaaccctacatcacccctgtcataaatgaaaaagaaaataaaattctatacagaattgag
agacctagaagtcagtgggaacttgaaaactcaatgaattatatagagataagaagttta
gacgatgttgataaaaatattgataaagttttgcataaaatcagtatccctatgagacta
acaaacgaaacccaaccaatgcagggtgtgacttttgatgaaaaatacttgtattggtat
acaggagacagtaatccaaataatagaaactatttaacggctttcgatttagaaacagga
gaagaagcgtatcaggttaatgctgactatggtggaacactagattcatttcctggcgaa
tttgcggaagcagaaggtttgcaaatatactatgacaaagatagtggtaaaaaagctttg
atgctaggtgttactgtcggtggtgatggaaatagaacacatcgtattttcatgattggg
caaagaggtattttagaaatacttcactcaagaggcgttccttttatcatgagtgacaca
ggtggtagagttaaacctttaccaatgaggcctgataaacttaagaatcttgggatgtta
acagagccaggtctttactatttatacactgatcatacagttcaaatcgatgatttccca
ttaccaagagaatggcgtgatgcaggttggttcttggaagttaagccaccacaaactggc
ggtgatgtaattcagatattgacgcgtaatagttatgcaaggaatatgatgacttttgaa
agggtgctttctggaagaactggagacatttcggactggaattatgtgcctaaaaatagt
ggtaaatgggagagagtaccttcattcatcacaaaaatgtcagatattaacatagtaggc
atgtcgttttatttaactacggatgatacaaaacgttttacagattttccaactgaacgt
aaaggggtagctggttggaacttatatgtagaagcttcaaacacaggtggctttgttcat
aggctagttcgtaatagtgttacagcatctgctgagatactattgaaaaattatgatagt
aaaataagttcagggccatggactttacacgaagggagaattataagttaa


  DNA with Flanking Sequence

>fig|93062.19.peg.369 Putative major teichoic acid biosynthesis protein C
tttgtaaacgcaatagatgaagtgtctttcagcaatgaaataaaagatatggtacaaatt
caacaagcacttaacagacgagttattgcacaagataatagatataactatcaagcaaat
cgtataaatcatttatacactagtactttgaattctcctttcgagacaatggatataggg
agtgtattaatataatggcaacagaagaagttaaaatcaaagcgctacttgaaaacgata
aacagtactttccagctacacactggaaagctataaatgggataccttatgcaggcagta
gtgatattgatggattgcctcaagacggtatcatttcggtagatgataaaaataaattag
ataaattaaaaataggcgaagcaggaattattcaaaatagcattgtacagaaatccccaa
acggtaaattgtggaaaataacagttgacgatagtgggaaacttggtacagtgctatttt
attagaaaggaaggtgcattatggaaaatttgtatttaataaaggatttgggagctttag
caggtcgagattatagagctaaagaaattcaaaacctgcaaagaatagagcaatttgcgc
ttggcttgacaacagagtttaagttgcatcagaaagctaaaacaatgcaacacttcgctg
agcaaatttattataatggtagatcgcaagcagcagtaaacaaatctttacaaagtcaaa
ttaacgcacttgttgtggcaccacgtaataacagtgctaatgagattgttcaagctcgag
ttaatgtaaacggcgaaacctttgacacattaaaagaacatttagacgattgggaaacca
aaactcaaattaataaagaggaaactataagagaattaaataagaccaaacaagaaattc
ttgatatcgagtatcgttttgaacctgataagcaagagtttttatttgtgacagaacttg
cacctcttacaaatgcagtaatgcaatccttctggtttgataatagaacaggcatagtat
acatgacacaagctagaaataatggctatatgctaagtcgtttaagacctaatggtcaat
ttatagacagctcattgattgtaggtgggggtcatggtacacataacggttatagatata
ttgatgatgagttatggatttatagttttatcttaaatggtaataatgagaatacattag
ttcgtttcaagtatacgcctaatgtggaaattagctatggcaagtatggtatgcaagatg
tatttacaggacacccagaaaaaccctacatcacccctgtcataaatgaaaaagaaaata
aaattctatacagaattgagagacctagaagtcagtgggaacttgaaaactcaatgaatt
atatagagataagaagtttagacgatgttgataaaaatattgataaagttttgcataaaa
tcagtatccctatgagactaacaaacgaaacccaaccaatgcagggtgtgacttttgatg
aaaaatacttgtattggtatacaggagacagtaatccaaataatagaaactatttaacgg
ctttcgatttagaaacaggagaagaagcgtatcaggttaatgctgactatggtggaacac
tagattcatttcctggcgaatttgcggaagcagaaggtttgcaaatatactatgacaaag
atagtggtaaaaaagctttgatgctaggtgttactgtcggtggtgatggaaatagaacac
atcgtattttcatgattgggcaaagaggtattttagaaatacttcactcaagaggcgttc
cttttatcatgagtgacacaggtggtagagttaaacctttaccaatgaggcctgataaac
ttaagaatcttgggatgttaacagagccaggtctttactatttatacactgatcatacag
ttcaaatcgatgatttcccattaccaagagaatggcgtgatgcaggttggttcttggaag
ttaagccaccacaaactggcggtgatgtaattcagatattgacgcgtaatagttatgcaa
ggaatatgatgacttttgaaagggtgctttctggaagaactggagacatttcggactgga
attatgtgcctaaaaatagtggtaaatgggagagagtaccttcattcatcacaaaaatgt
cagatattaacatagtaggcatgtcgttttatttaactacggatgatacaaaacgtttta
cagattttccaactgaacgtaaaggggtagctggttggaacttatatgtagaagcttcaa
acacaggtggctttgttcataggctagttcgtaatagtgttacagcatctgctgagatac
tattgaaaaattatgatagtaaaataagttcagggccatggactttacacgaagggagaa
ttataagttaatgagtaatttagagaaatctgtagctataaatttagaaaacacagcgca
ttatgaaaatatttcaaatctagatataacttttagaacaggagagagtgattcttctgt
tcttctttttaatatcattaaaaataatcaaccgttattcctgagtgaagaaaatatcaa
agcacgaatagcgattcgaggtaaaggagttatggtggttgctccactagaaatattaga
tccatttaaaggcgtattaaaatttcaattacctaacgatgtaattaaacgagatggaag
ttatcaagctcaagtttcggttgcagaattagggaattcagacgtggtagttgtcgagag
aactatcacatttaacgttgaaaaaagcttgtttagcatgattccatctgaaacaaaatt
acactatattgttgaatttcaggaattagaaaaaactattatggatcgtgcgaaagcaat
ggacgaggctataaaaaatggtgaagattat


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|SACOL0383 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
fig|93062.4.peg.842 Staphylococcus aureus subsp. aureus COL FIG   Putative major teichoic acid biosynthesis protein C
gb|AAW38852.1 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
gi|57286758 Staphylococcus aureus subsp. aureus COL NCBI   conserved hypothetical protein
gi|57652572 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL0383
img|637151158 Staphylococcus aureus aureus COL IMG   hypothetical protein
kegg|sac:SACOL0383 Staphylococcus aureus subsp. aureus COL KEGG   hypothetical protein
ref|YP_185275.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL0383
tr|Q5HIY2 Staphylococcus aureus (strain COL) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search