The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93062.19.peg.2579: Staphylococcus aureus subsp. aureus COL

This feature in The SEED Viewer

NCBI Taxonomy Id: 93062

Current Assignment: Transcriptional regulator ArcR essential for anaerobic expression of the ADI pathway, Crp/Fnr family
Translate Function Assignments



Context on contig NC_002951 from base 2707752 to 2719687 (11936 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2574 2707752 2709176 1425 +       3: 9 7 10   Alkaline phosphatase (EC 3.1.3.1) locus|SACOL2648, protein_id|YP_187436.1, gi|57652366, geneID|3237051
2575 2709340 2709236 105 - 59         Doubtful CDS locus|SACOL2649, protein_id|YP_187437.1, gi|57652367, geneID|3237052
2576 2709914 2709459 456 - 118     1: 8   Transcriptional regulator, MarR family locus|SACOL2650, protein_id|YP_187438.1, gi|57652368, geneID|3237053
2577 2710920 2710159 762 - 244         Tributyrin esterase locus|SACOL2651, protein_id|YP_187439.1, gi|57652369, geneID|3237054
2578 2713777 2711036 2742 - 115     1: 5   Clumping factor ClfB, fibrinogen binding protein gene_name|clfB, locus|SACOL2652, protein_id|YP_187440.1, gi|57652370, geneID|3237041
2579 2714831 2714127 705 - 349   2: 1 2   Transcriptional regulator ArcR essential for anaerobic expression of the ADI pathway, Crp/Fnr family locus|SACOL2653, protein_id|YP_187441.1, gi|57652371, geneID|3237042
2580 2715871 2714930 942 - 98 6 3: 4 1 2   Carbamate kinase (EC 2.7.2.2) gene_name|arcC2, locus|SACOL2654, protein_id|YP_187442.1, gi|57652372, geneID|3237043
2581 2717318 2715888 1431 - 16     4: 4 1 2 6   Arginine/ornithine antiporter ArcD gene_name|arcD, locus|SACOL2655, protein_id|YP_187443.1, gi|57652373, geneID|3237044
2582 2718419 2717409 1011 - 90 4 4: 3 1 2 11   Ornithine carbamoyltransferase (EC 2.1.3.3) gene_name|arcB2, locus|SACOL2656, protein_id|YP_187444.1, gi|57652374, geneID|3237045
2583 2719687 2718452 1236 - 32 4 3: 3 1 2   Arginine deiminase (EC 3.5.3.6) gene_name|arcA, locus|SACOL2657, protein_id|YP_187445.1, gi|57652375, geneID|3237046

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Arginine_Deiminase_Pathway OlgaZ Transcriptional regulator ArcR essential for anaerobic expression of the ADI pathway, Crp/Fnr family
Arginine_and_Ornithine_Degradation OlgaZ Transcriptional regulator ArcR essential for anaerobic expression of the ADI pathway, Crp/Fnr family


  Protein Sequence

>fig|93062.19.peg.2579 Transcriptional regulator ArcR essential for anaerobic expression of the ADI pathway, Crp/Fnr family
MTENFILGRNNKLEHELKALADYINIPYSILQPYQSECFVRHYTKGQVIYFSPQESSNIY
FLIEGNIIREHYNQNGDVYRYFNKEQVLFPISNLFHPKEVNELCTALTDCTVLGLPRELM
AFLCKANDDIFLTLFALINDNEQQHMNYNMALTSKFAKDRIIKLICHLCQTVGYDQDEFY
EIKQFLTIQLMSDMAGISRETAGHIIHELKDEKLVVKDHKNWLVSKHLFNDVCV

MD5 = 55f365a8320768c9f5e3ca9a223bab6f


  DNA Sequence

>fig|93062.19.peg.2579 Transcriptional regulator ArcR essential for anaerobic expression of the ADI pathway, Crp/Fnr family
atgacagaaaactttattttgggtagaaataataaattagaacatgaactaaaggcatta
gcagattacattaatataccatatagtatattacaaccatatcaaagtgaatgttttgtc
agacattatacgaaaggccaagttatttatttttcgccacaagaaagtagcaatatttac
tttttaattgaaggtaacattattagagaacattacaatcaaaatggagatgtatatcgt
tattttaataaagagcaagtattatttccaatcagtaacttatttcatccgaaagaggtt
aacgaattgtgtacagcattaaccgattgtacagttcttggattgcctagagaattgatg
gcctttttgtgcaaagctaatgatgatatatttttgacactttttgcattaataaatgat
aatgagcagcaacacatgaactataacatggcattaacaagtaaatttgctaaagatcga
attatcaaattgatatgccatctatgtcagacagtaggatacgatcaagatgaattttat
gaaatcaaacagtttttaactattcaactcatgagtgatatggctgggatttcccgggaa
acagctggtcatattattcatgaacttaaagatgaaaaacttgttgttaaagatcataaa
aattggttagtaagcaaacatttattcaatgatgtatgtgtttaa


  DNA with Flanking Sequence

>fig|93062.19.peg.2579 Transcriptional regulator ArcR essential for anaerobic expression of the ADI pathway, Crp/Fnr family
gcagacggtaaaaatattgtcattgcatgcggtggtggcggtattccagttataaaaaaa
gaaaatacctatgaaggtgttgaagcggttatagataaagattttgctagtgagaaatta
gcaacgctgattgaagcagataccttaatgattcttacgaatgtagaaaatgtatttatt
aactttaatgaacctaatcaacaacaaatcgatgatattgatgtagcaacactgaaaaaa
tacgcggcacaaggtaagtttgtggaaggatcgatgttgccaaaaatagaagctgcgata
cgatttgttgaaagtggggaaaacaaaaaagttatcattaccaatttagagcaggcatac
gaagctttgattggtaataaaggtacacacattcacatgtagcactttatcacgcgacaa
aacattaaatatgtttctccgttgattcaaatgaaaaagttgtctgctgacactttgcaa
ggtttgaaggagtttaacttatgacagaaaactttattttgggtagaaataataaattag
aacatgaactaaaggcattagcagattacattaatataccatatagtatattacaaccat
atcaaagtgaatgttttgtcagacattatacgaaaggccaagttatttatttttcgccac
aagaaagtagcaatatttactttttaattgaaggtaacattattagagaacattacaatc
aaaatggagatgtatatcgttattttaataaagagcaagtattatttccaatcagtaact
tatttcatccgaaagaggttaacgaattgtgtacagcattaaccgattgtacagttcttg
gattgcctagagaattgatggcctttttgtgcaaagctaatgatgatatatttttgacac
tttttgcattaataaatgataatgagcagcaacacatgaactataacatggcattaacaa
gtaaatttgctaaagatcgaattatcaaattgatatgccatctatgtcagacagtaggat
acgatcaagatgaattttatgaaatcaaacagtttttaactattcaactcatgagtgata
tggctgggatttcccgggaaacagctggtcatattattcatgaacttaaagatgaaaaac
ttgttgttaaagatcataaaaattggttagtaagcaaacatttattcaatgatgtatgtg
tttaatatacaatgtaaaatgaataagttgaacatgaggtctaacgtacatttatacgtt
aggccttttttgctagcatgatgaataatttaaaatgttagttaaatttgattgttgaaa
ttacagtaaaatttaaggtgatgaaaaatttagaacttctaagtttttgaaaagtaaaaa
atttgtaatagtgtaaaaatagtatattgatttttgctagttaacagaaaattttaagtt
atataaataggaagaaaacaaattttacgtaatttttttcgaaaagcaattgatataatt
cttatttcattatacaatttagactaatctagaaattgaaatggagtaatatttttgaaa
aaaagaattgattatttgtcgaataagcagaataagtattcgattagacgttttacagta
ggtaccacatcagtaatagtaggggcaactatactatttgggataggcaatcatcaagca
caagcttcagaacaatcgaacgata


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003677       F:DNA binding
GO:0005737       C:cytoplasm
GO:0006350       P:transcription
GO:0006355       P:regulation of transcription, DNA-dependent
GO:0030552       F:cAMP binding
cmr|NT05SA2648 Staphylococcus aureus NCTC 8325     cyclic nucleotide-binding domain protein
cmr|SAUSA300_2566 Staphylococcus aureus subsp. aureus USA300-FPR3757     transcriptional regulator, Crp/Fnr family
dbj|BAF68802.1 Staphylococcus aureus subsp. aureus str. Newman     transcriptional regulator Crp/Fnr family protein
emb|CAD98185.1 Staphylococcus aureus EMBL   transcriptional regulator
fig|367830.3.peg.1991 Staphylococcus aureus subsp. aureus USA300 FIG   Transcriptional regulator ArcR essential for anaerobic expression of the ADI pathway, Crp/Fnr family
fig|426430.6.peg.2442 Staphylococcus aureus subsp. aureus str. Newman FIG   Transcriptional regulator ArcR essential for anaerobic expression of the ADI pathway, Crp/Fnr family
fig|426430.8.peg.2743 Staphylococcus aureus subsp. aureus str. Newman FIG   Transcriptional regulator ArcR essential for anaerobic expression of the ADI pathway, Crp/Fnr family
fig|450394.6.peg.1637 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   Transcriptional regulator ArcR essential for anaerobic expression of the ADI pathway, Crp/Fnr family
fig|451515.3.peg.2746 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Transcriptional regulator ArcR essential for anaerobic expression of the ADI pathway, Crp/Fnr family
fig|451516.9.peg.2740 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Transcriptional regulator ArcR essential for anaerobic expression of the ADI pathway, Crp/Fnr family
fig|452948.4.peg.1017 Staphylococcus aureus 930918-3 FIG   Transcriptional regulator ArcR essential for anaerobic expression of the ADI pathway, Crp/Fnr family
fig|455227.3.peg.1542 Staphylococcus aureus D30 FIG   Transcriptional regulator ArcR essential for anaerobic expression of the ADI pathway, Crp/Fnr family
fig|553590.4.peg.1802 Staphylococcus aureus A9754 FIG   Transcriptional regulator ArcR essential for anaerobic expression of the ADI pathway, Crp/Fnr family
fig|553594.3.peg.599 Staphylococcus aureus A9765 FIG   Transcriptional regulator ArcR essential for anaerobic expression of the ADI pathway, Crp/Fnr family
fig|644279.4.peg.2 Staphylococcus aureus subsp. aureus 132 FIG   Transcriptional regulator ArcR essential for anaerobic expression of the ADI pathway, Crp/Fnr family
fig|93061.3.peg.2807 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Transcriptional regulator ArcR essential for anaerobic expression of the ADI pathway, Crp/Fnr family
fig|93061.5.peg.2674 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Transcriptional regulator ArcR essential for anaerobic expression of the ADI pathway, Crp/Fnr family
gb|ABD22163.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     transcriptional regulator, Crp/Fnr family
gb|ABD31954.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABX30617.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     transcriptional regulator
gb|EES94637.1 Staphylococcus aureus subsp. aureus USA300_TCH959     Crp/FNR family transcriptional regulator
gb|EEW45171.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_0287
gb|EEW46968.1 Staphylococcus aureus D30     hypothetical protein SAD30_0520
gi|123003414 organism not parsed/found in ncbi nr NCBI   RecName: Full=HTH-type transcriptional regulator arcR
gi|123722339 organism not parsed/found in ncbi nr NCBI   RecName: Full=HTH-type transcriptional regulator arcR
gi|150375542 Staphylococcus aureus subsp. aureus str. Newman NCBI   transcriptional regulator Crp/Fnr family protein
gi|151222742 Staphylococcus aureus subsp. aureus str. Newman NCBI   transcriptional regulator Crp/Fnr family protein
gi|160369646 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   transcriptional regulator
gi|161510837 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   transcriptional regulator
gi|205686189 organism not parsed/found in ncbi nr NCBI   RecName: Full=HTH-type transcriptional regulator arcR
gi|205686190 organism not parsed/found in ncbi nr NCBI   RecName: Full=HTH-type transcriptional regulator arcR
gi|205688875 organism not parsed/found in ncbi nr NCBI   RecName: Full=HTH-type transcriptional regulator arcR
gi|253725908 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   Crp/FNR family transcriptional regulator
gi|253730318 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   Crp/FNR family transcriptional regulator
gi|259160140 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_0287
gi|259162397 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_0520
gi|31874424 Staphylococcus aureus NCBI   transcriptional regulator
gi|87127649 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   transcriptional regulator, Crp/Fnr family
gi|87161675 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   Crp/FNR family transcriptional regulator
gi|87204144 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88196586 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_02964
img|637889208 Staphylococcus aureus aureus USA300 IMG   transcriptional regulator, Crp/Fnr family
img|637895564 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|640796961 Staphylococcus aureus aureus Newman IMG   transcriptional regulator Crp/Fnr family protein
img|641310631 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   transcriptional regulator
img|641773395 Staphylococcus aureus aureus USA300_TCH959 IMG   transcriptional regulator
kegg|saa:SAUSA300_2566 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   Crp/FNR family transcriptional regulator
kegg|sae:NWMN_2530 Staphylococcus aureus subsp. aureus Newman KEGG   transcriptional regulator Crp/Fnr family protein
kegg|sao:SAOUHSC_02964 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sax:USA300HOU_2631 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   transcriptional regulator
ref|YP_001333564.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   transcriptional regulator Crp/Fnr family protein
ref|YP_001576496.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   transcriptional regulator
ref|YP_495200.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   Crp/FNR family transcriptional regulator
ref|YP_501415.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_02964
ref|ZP_04864483.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   Crp/FNR family transcriptional regulator
sp|A6QKC0 Staphylococcus aureus (strain Newman) SwissProt   HTH-type transcriptional regulator arcR
sp|A8Z5D0 Staphylococcus aureus (strain USA300 / TCH1516) SwissProt   HTH-type transcriptional regulator arcR
sp|ARCR_STAA3 organism not parsed/found in ncbi nr SwissProt   RecName: Full=HTH-type transcriptional regulator arcR
sp|ARCR_STAA8 organism not parsed/found in ncbi nr SwissProt   RecName: Full=HTH-type transcriptional regulator arcR
sp|ARCR_STAAC organism not parsed/found in ncbi nr SwissProt   RecName: Full=HTH-type transcriptional regulator arcR
sp|ARCR_STAAE organism not parsed/found in ncbi nr SwissProt   RecName: Full=HTH-type transcriptional regulator arcR
sp|ARCR_STAAT organism not parsed/found in ncbi nr SwissProt   RecName: Full=HTH-type transcriptional regulator arcR
sp|Q2FDM8 Staphylococcus aureus (strain USA300) SwissProt   HTH-type transcriptional regulator arcR
sp|Q2FUY1 Staphylococcus aureus (strain NCTC 8325) SwissProt   HTH-type transcriptional regulator arcR
sp|Q5HCR6 Staphylococcus aureus (strain COL) SwissProt   HTH-type transcriptional regulator arcR
tr|C5N0J1 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   Crp/FNR family transcriptional regulator


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
6 fig|93062.19.peg.2580 Carbamate kinase (EC 2.7.2.2)
4 fig|93062.19.peg.2582 Ornithine carbamoyltransferase (EC 2.1.3.3)
4 fig|93062.19.peg.2583 Arginine deiminase (EC 3.5.3.6)


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search