The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93062.19.peg.2479: Staphylococcus aureus subsp. aureus COL

This feature in The SEED Viewer

NCBI Taxonomy Id: 93062

Current Assignment: FIG01107948: hypothetical protein
Translate Function Assignments



Context on contig NC_002951 from base 2600008 to 2611037 (11030 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2472 2600628 2600008 621 -       2: 5 8   LPXTG specific sortase A gene_name|srtA, locus|SACOL2539, protein_id|YP_187332.1, gi|57651036, geneID|3238307
2473 2600822 2601313 492 + 193         Phosphinothricin N-acetyltransferase (EC 2.3.1.-) locus|SACOL2541, protein_id|YP_187333.1, gi|57651037, geneID|3238678
2474 2601630 2601743 114 + 316         hypothetical protein  
2475 2601921 2601751 171 - 7         Doubtful CDS locus|SACOL2542, protein_id|YP_187334.1, gi|57651038, geneID|3238679
2476 2602999 2602100 900 - 178     2: 2 1   L-serine dehydratase, alpha subunit (EC 4.3.1.17) gene_name|sdaAA, locus|SACOL2544, protein_id|YP_187336.1, gi|57651040, geneID|3238681
2477 2603693 2603013 681 - 13     2: 2 1   L-serine dehydratase, beta subunit (EC 4.3.1.17) gene_name|sdaAB, locus|SACOL2545, protein_id|YP_187337.1, gi|57651041, geneID|3238286
2478 2604739 2603696 1044 - 2         Transcriptional regulator pfoR locus|SACOL2546, protein_id|YP_187338.1, gi|57651042, geneID|3238287
2479 2605276 2605494 219 + 536         FIG01107948: hypothetical protein locus|SACOL2547, protein_id|YP_187339.1, gi|57651043, geneID|3238288
2480 2605686 2606612 927 + 191         FIG01108553: hypothetical protein locus|SACOL2548, protein_id|YP_187340.1, gi|57651044, geneID|3238308
2481 2607662 2606694 969 - 81         Esterase/lipase (EC 3.1.1.-) locus|SACOL2549, protein_id|YP_187341.1, gi|57651045, geneID|3238309
2482 2608148 2607795 354 - 132     4: 6 4 3 7   Thioredoxin locus|SACOL2550, protein_id|YP_187342.1, gi|57651046, geneID|3236046
2483 2608591 2608181 411 - 32         FIG01107953: hypothetical protein locus|SACOL2551, protein_id|YP_187343.1, gi|57651047, geneID|3238310
2484 2611037 2608971 2067 - 379         PTS system, glucose-specific IIC component / PTS system, glucose-specific IIB component (EC 2.7.1.69) / PTS system, glucose-specific IIA component locus|SACOL2552, protein_id|YP_187344.1, gi|57651048, geneID|3238311

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93062.19.peg.2479 FIG01107948: hypothetical protein
MEAIKVQLSHSVKVAISIYLALIFITFTSYLVIILYTSMTGHDVSHFVLDSQHSHHGSLT
QKHLSLPEISFK

MD5 = 3da4394714d6384208c833f2e559bdd7


  DNA Sequence

>fig|93062.19.peg.2479 FIG01107948: hypothetical protein
gtggaggcgataaaggtgcaattgagtcattccgttaaagttgcaatttctatctattta
gcacttatctttataacgttcacttcttatttagtcattattttatatacgagtatgact
ggacatgatgtatcacatttcgtgttagatagtcagcattctcatcatggatctcttacg
caaaaacatttgagtcttcctgaaatctcatttaaatag


  DNA with Flanking Sequence

>fig|93062.19.peg.2479 FIG01107948: hypothetical protein
agaccataaacatcgtacacccttaagaaaacgttttcaacttttatctgttatcaaatc
aaatatttaagtgaaatatttcatatttgtgaaagatttttaaaatggattgtttcaaaa
actacttatgttgtcgttaatatttactaattaactttttactctatatttcaaacagtt
gtgtgacagttttttgataactttttttacatctgaaagtaagtaatatttctaaaaact
tttaatatttatacactttatctttcgagctattttttttttgtttttgtgctgtgttta
taaaaccgcacactatattcaaaaataacttattacacatatatttgcaataagataatt
aaagtaggatattatttttagttttctgataggaatgatgatagtctataggttgaatct
ttacttttttttaaagctaaatttacatcaacttaacaatggttggttatactgaagatg
aaaatatttagtataacttagtggaggcgataaaggtgcaattgagtcattccgttaaag
ttgcaatttctatctatttagcacttatctttataacgttcacttcttatttagtcatta
ttttatatacgagtatgactggacatgatgtatcacatttcgtgttagatagtcagcatt
ctcatcatggatctcttacgcaaaaacatttgagtcttcctgaaatctcatttaaatagt
ttatcctctgtgtttcaacattcatttcccatatcgattcatttatctatcatctagacc
actacatcttagatgatttttttattttctcatttcactctttcttaaaagtcgatataa
tgaattaaatcattatcatacaccgacatattttatgttgttggtgttaagttttaaagg
ggtgagatacttggcgaataatcattcagctttgcgtttaaaaggaattatacttgccat
tgtcggtgcttgtttatggggattaggtggtactgtttctgatttcttgttcaaatataa
gaatattaatgtcgattggtacgtcactgctcgacttgtagtcagtggtgttttcttact
tattatgtacaaaatgatgcaacccaaacgttcaatatttagcgtattccaagatcgacg
tatgttaggcaaattacttatcttcagtatactgggcatgttagtagtacaatatgctta
tatggcatctattaataca


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
fig|359787.11.peg.2660 Staphylococcus aureus subsp. aureus JH1 FIG   FIG01107948: hypothetical protein
fig|418127.6.peg.2582 Staphylococcus aureus subsp. aureus Mu3 FIG   FIG01107948: hypothetical protein
fig|426430.8.peg.2641 Staphylococcus aureus subsp. aureus str. Newman FIG   FIG01107948: hypothetical protein
fig|546342.3.peg.965 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   FIG01107948: hypothetical protein
fig|553574.3.peg.2237 Staphylococcus aureus A8117 FIG   FIG01107948: hypothetical protein
fig|553590.4.peg.1702 Staphylococcus aureus A9754 FIG   FIG01107948: hypothetical protein
fig|553596.3.peg.1198 Staphylococcus aureus A9781 FIG   FIG01107948: hypothetical protein
fig|585147.3.peg.2162 Staphylococcus aureus subsp. aureus A017934/97 FIG   FIG01107948: hypothetical protein
fig|585159.3.peg.9 Staphylococcus aureus subsp. aureus M899 FIG   FIG01107948: hypothetical protein
fig|585161.3.peg.2402 Staphylococcus aureus subsp. aureus WW2703/97 FIG   FIG01107948: hypothetical protein
fig|644279.4.peg.2683 Staphylococcus aureus subsp. aureus 132 FIG   FIG01107948: hypothetical protein
fig|680649.3.peg.299 Staphylococcus aureus subsp. aureus MR1 FIG   FIG01107948: hypothetical protein
fig|762962.3.peg.1972 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   FIG01107948: hypothetical protein
gb|EES94747.1 Staphylococcus aureus subsp. aureus USA300_TCH959     conserved hypothetical protein
gi|253726018 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   conserved hypothetical protein
gi|253730209 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   conserved hypothetical protein
ref|ZP_04864374.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   conserved hypothetical protein
tr|C5N082 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search