The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93062.19.peg.2390: Staphylococcus aureus subsp. aureus COL

This feature in The SEED Viewer

NCBI Taxonomy Id: 93062

Current Assignment: Osmotically activated L-carnitine/choline ABC transporter, substrate-binding protein OpuCC
Translate Function Assignments



Context on contig NC_002951 from base 2504441 to 2516654 (12214 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2385 2504441 2505937 1497 +       1: 13   Beta-lactamase (EC 3.5.2.6) locus|SACOL2445, protein_id|YP_187245.1, gi|57652256, geneID|3237356
2386 2506880 2506029 852 - 91         Hypothetical protein, similar to glucose epimerase locus|SACOL2446, protein_id|YP_187246.1, gi|57652257, geneID|3237251
2387 2508137 2507202 936 - 321     9: 2 10 4 8 12 7 3 9 5   2-dehydropantoate 2-reductase (EC 1.1.1.169) locus|SACOL2448, protein_id|YP_187247.1, gi|57652258, geneID|3237252
2388 2509763 2508363 1401 - 225         putative transporter locus|SACOL2449, protein_id|YP_187248.1, gi|57652259, geneID|3237253
2389 2510752 2510057 696 - 293 36 1: 1   Choline ABC transport system, permease protein OpuBD locus|SACOL2450, protein_id|YP_187249.1, gi|57652260, geneID|3237254
2390 2511693 2510752 942 - -1   1: 1   Osmotically activated L-carnitine/choline ABC transporter, substrate-binding protein OpuCC locus|SACOL2451, protein_id|YP_187250.1, gi|57652261, geneID|3237255
2391 2512345 2511710 636 - 16 35 1: 1   Choline ABC transport system, permease protein OpuBB locus|SACOL2452, protein_id|YP_187251.1, gi|57652262, geneID|3237256
2392 2513568 2512342 1227 - -4 43 1: 1   Osmotically activated L-carnitine/choline ABC transporter, ATP-binding protein OpuCA locus|SACOL2453, protein_id|YP_187252.1, gi|57652263, geneID|3237257
2393 2514837 2514238 600 - 669     2: 6 11   DUF1801 domain-containing protein locus|SACOL2456, protein_id|YP_187254.1, gi|57652265, geneID|3237244
2394 2515017 2516654 1638 + 179         Amino acid transporter locus|SACOL2458, protein_id|YP_187256.1, gi|57652267, geneID|3237246

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Choline_and_Betaine_Uptake_and_Betaine_Biosynthesis OlgaZ Osmotically activated L-carnitine/choline ABC transporter, substrate-binding protein OpuCC


  Protein Sequence

>fig|93062.19.peg.2390 Osmotically activated L-carnitine/choline ABC transporter, substrate-binding protein OpuCC
MKKIKYILVVFVLSLTVLSGCSLPGLGSKSTKNDVKITALSTSESQIISHMLRLLIEHDT
HGKIKPTLVNNLGSSTIQHNALINGDANISGVRYNGTDLTGALKEAPIKNPKKAMIATQQ
GFKKKFDQTFFDSYGFANTYAFMVTKETAKKYHLETVSDLAKHSKDLRLGMDSSWMNRKG
DGYEGFKKEYGFDFGTVRPMQIGLVYDALNSEKLDVALGYSTDGRIAAYDLKVLKDDKQF
FPPYAASAVATNELLRQHPELKTTINKLTGKISTSEMQRLNYEADGKGKEPAVVAEEFLK
KHHYFDKQKGGHK

MD5 = e3e6ad081c000662af7c85640b24c8c4


  DNA Sequence

>fig|93062.19.peg.2390 Osmotically activated L-carnitine/choline ABC transporter, substrate-binding protein OpuCC
atgaagaaaattaaatatatacttgtcgtgtttgtcttatcgcttaccgtattatctgga
tgtagtttgcccggactaggtagtaagagcacgaaaaatgatgtcaaaattacagcatta
tcaacaagcgaatcgcaaattatttcacatatgttacggttgttaatagagcatgataca
cacggtaagataaagccaacattagtaaataatttagggtcaagtacgattcaacataat
gccttaattaatggggatgctaatatatcaggtgttagatataatggcacagatttaacg
ggagctttgaaggaagcaccaattaaaaatcctaagaaagcaatgatagcaacacaacaa
ggatttaaaaagaaatttgatcaaacgttttttgattcgtatggttttgcgaatacgtat
gcattcatggtaacgaaggaaaccgctaaaaaatatcatttagagacagtttcagattta
gcaaagcatagtaaagatttacgtttaggtatggatagttcatggatgaatcgtaaaggc
gatggctatgaaggatttaaaaaagagtatggttttgactttggtacagtgagaccaatg
caaataggtctagtctacgacgcattaaactcagagaagttagacgttgcattaggttat
tctacagatggtcgaattgcggcgtatgatttgaaagtacttaaagatgataaacaattt
ttcccaccttatgctgcgagtgctgttgcaacaaatgaattattacggcaacacccagaa
cttaaaacgacgattaataagttgacaggaaagatttcgacttcagagatgcaacgcttg
aattatgaagcggatggtaaaggtaaagaacctgctgtcgtcgcagaagaatttttgaaa
aaacaccactattttgataaacagaaaggtggtcataagtaa


  DNA with Flanking Sequence

>fig|93062.19.peg.2390 Osmotically activated L-carnitine/choline ABC transporter, substrate-binding protein OpuCC
attaactgtggcaggtgtcttacaaactattccaacactagctgtacttgctattatgat
accgatttttggtgttggtaaaacgcctgcaattgtagcgctatttatttatgtattatt
acctattttaaataacacggtactcggtgttcaaaatattgatagcaacattaaagaagc
tggaaaaagtatgggaatgacacaatttcaattgatgaaggatgttgaattgccgttagc
attgccgcttatcattggtggcattcgtttgtcatctgtgtatgtaattagttgggctac
acttgcaagttatgtaggtgcgggtggattaggtgatttcattttcaatggtttaaattt
atatgatccactgatgattgtaactgcaacggtactcgttactgcactagcattaggtgt
tgatgccttattagctttagttgaaaaatgggtagttcccaaaggcttaaaagtatctgg
ataattaggaggctaagataatgaagaaaattaaatatatacttgtcgtgtttgtcttat
cgcttaccgtattatctggatgtagtttgcccggactaggtagtaagagcacgaaaaatg
atgtcaaaattacagcattatcaacaagcgaatcgcaaattatttcacatatgttacggt
tgttaatagagcatgatacacacggtaagataaagccaacattagtaaataatttagggt
caagtacgattcaacataatgccttaattaatggggatgctaatatatcaggtgttagat
ataatggcacagatttaacgggagctttgaaggaagcaccaattaaaaatcctaagaaag
caatgatagcaacacaacaaggatttaaaaagaaatttgatcaaacgttttttgattcgt
atggttttgcgaatacgtatgcattcatggtaacgaaggaaaccgctaaaaaatatcatt
tagagacagtttcagatttagcaaagcatagtaaagatttacgtttaggtatggatagtt
catggatgaatcgtaaaggcgatggctatgaaggatttaaaaaagagtatggttttgact
ttggtacagtgagaccaatgcaaataggtctagtctacgacgcattaaactcagagaagt
tagacgttgcattaggttattctacagatggtcgaattgcggcgtatgatttgaaagtac
ttaaagatgataaacaatttttcccaccttatgctgcgagtgctgttgcaacaaatgaat
tattacggcaacacccagaacttaaaacgacgattaataagttgacaggaaagatttcga
cttcagagatgcaacgcttgaattatgaagcggatggtaaaggtaaagaacctgctgtcg
tcgcagaagaatttttgaaaaaacaccactattttgataaacagaaaggtggtcataagt
aatggaaggtaatttattacagcaattattcaattattatgttacgaactttggttatct
atgggatttatttttcaaacacttattaatgtctgtctatggtgtgctgtttgcagcttt
aattggtattccattgggaatcttgcttgcaagatacacaaaactttctggatttgtaat
tacaattgcaaatataattcaaacagttccagtcattgcaatgttagctattttaatgtt
agtcatgggcttaggttcagaaacagtagttttaacagtgtttttatatgcgttacttcc
aattataaaaaacacttatactggtatagctagtgttgatgcgaatattaaggatgctgg
caaaggtatgggaatgacacgcaatcaagtgctacgaatgattgaattaccgttatctgt
ttcggttattatcggtggcattcgtattgccttggttgttgcgataggtgttgttgccgt
tggatcatttataggagcacct


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0005215       F:transporter activity
GO:0005488       F:binding
GO:0006810       P:transport
GO:0015418       F:quaternary-ammonium-compound-transporting A...
cmr|NT05SA2465 Staphylococcus aureus NCTC 8325     glycine betaine/carnitine/choline-binding protein
cmr|SACOL2451 Staphylococcus aureus subsp. aureus COL     amino acid ABC transporter, amino acid-binding protein
cmr|SAUSA300_2391 Staphylococcus aureus subsp. aureus USA300-FPR3757     glycine betaine/carnitine/choline ABC transporter
dbj|BAF68617.1 Staphylococcus aureus subsp. aureus str. Newman     glycine betaine/carnitine/choline ABC transporter
fig|367830.3.peg.605 Staphylococcus aureus subsp. aureus USA300 FIG   Osmotically activated L-carnitine/choline ABC transporter, substrate-binding protein OpuCC
fig|426430.6.peg.2271 Staphylococcus aureus subsp. aureus str. Newman FIG   Osmotically activated L-carnitine/choline ABC transporter, substrate-binding protein OpuCC
fig|426430.8.peg.2550 Staphylococcus aureus subsp. aureus str. Newman FIG   Osmotically activated L-carnitine/choline ABC transporter, substrate-binding protein OpuCC
fig|451515.3.peg.2551 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Osmotically activated L-carnitine/choline ABC transporter, substrate-binding protein OpuCC
fig|451516.9.peg.2541 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Osmotically activated L-carnitine/choline ABC transporter, substrate-binding protein OpuCC
fig|452948.4.peg.503 Staphylococcus aureus 930918-3 FIG   Osmotically activated L-carnitine/choline ABC transporter, substrate-binding protein OpuCC
fig|455227.3.peg.761 Staphylococcus aureus D30 FIG   Osmotically activated L-carnitine/choline ABC transporter, substrate-binding protein OpuCC
fig|546342.3.peg.2417 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Osmotically activated L-carnitine/choline ABC transporter, substrate-binding protein OpuCC
fig|546343.3.peg.812 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Osmotically activated L-carnitine/choline ABC transporter, substrate-binding protein OpuCC
fig|553567.3.peg.733 Staphylococcus aureus A5948 FIG   Osmotically activated L-carnitine/choline ABC transporter, substrate-binding protein OpuCC
fig|553590.4.peg.1054 Staphylococcus aureus A9754 FIG   Osmotically activated L-carnitine/choline ABC transporter, substrate-binding protein OpuCC
fig|553594.3.peg.405 Staphylococcus aureus A9765 FIG   Osmotically activated L-carnitine/choline ABC transporter, substrate-binding protein OpuCC
fig|644279.4.peg.2592 Staphylococcus aureus subsp. aureus 132 FIG   Osmotically activated L-carnitine/choline ABC transporter, substrate-binding protein OpuCC
fig|93061.3.peg.2595 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Osmotically activated L-carnitine/choline ABC transporter, substrate-binding protein OpuCC
fig|93061.5.peg.2480 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Osmotically activated L-carnitine/choline ABC transporter, substrate-binding protein OpuCC
fig|93062.4.peg.2505 Staphylococcus aureus subsp. aureus COL FIG   Osmotically activated L-carnitine/choline ABC transporter, substrate-binding protein OpuCC
gb|AAW38541.1 Staphylococcus aureus subsp. aureus COL     amino acid ABC transporter, amino acid-binding protein
gb|ABD22006.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     glycine betaine/carnitine/choline ABC transporter
gb|ABD31748.1 Staphylococcus aureus subsp. aureus NCTC 8325     amino acid transporter, putative
gb|ABX30425.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     glycine betaine/L-proline ABC superfamily ATP binding cassette transporter, binding protein
gb|EEV83855.1 Staphylococcus aureus A5948     glycine betaine/carnitine/choline ABC transporter
gb|EEW45592.1 Staphylococcus aureus 930918-3     glycine betaine/carnitine/choline ABC transporter opuCC
gb|EEW47667.1 Staphylococcus aureus D30     glycine betaine/carnitine/choline ABC transporter opuCC
gi|150375357 Staphylococcus aureus subsp. aureus str. Newman NCBI   glycine betaine/carnitine/choline ABC transporter
gi|151222557 Staphylococcus aureus subsp. aureus str. Newman NCBI   glycine betaine/carnitine/choline ABC transporter
gi|160369454 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   glycine betaine/L-proline ABC superfamily ATP binding cassette transporter, binding protein
gi|161510645 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   glycine betaine/L-proline ABC transporter binding protein
gi|221139366 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   glycine betaine/L-proline ABC transporter binding protein
gi|221140794 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   glycine betaine/L-proline ABC transporter binding protein
gi|257861040 Staphylococcus aureus A5948 NCBI   glycine betaine/carnitine/choline ABC transporter
gi|258451248 Staphylococcus aureus A5948 NCBI   glycine betaine/carnitine/choline ABC transporter
gi|259160569 Staphylococcus aureus 930918-3 NCBI   glycine betaine/carnitine/choline ABC transporter opuCC
gi|259163106 Staphylococcus aureus D30 NCBI   glycine betaine/carnitine/choline ABC transporter opuCC
gi|57286447 Staphylococcus aureus subsp. aureus COL NCBI   amino acid ABC transporter, amino acid-binding protein
gi|57652261 Staphylococcus aureus subsp. aureus COL NCBI   amino acid ABC transporter, amino acid-binding protein
gi|87127492 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   glycine betaine/carnitine/choline ABC transporter
gi|87161518 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   glycine betaine/carnitine/choline ABC transporter
gi|87203938 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   amino acid transporter, putative
gi|88196380 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   amino acid transporter, putative
img|637153203 Staphylococcus aureus aureus COL IMG   amino acid ABC transporter, amino acid-binding protein
img|637889034 Staphylococcus aureus aureus USA300 IMG   glycine betaine/carnitine/choline ABC transporter( EC:3.6.3.32 )
img|637895352 Staphylococcus aureus aureus NCTC 8325 IMG   amino acid transporter, putative
img|640796776 Staphylococcus aureus aureus Newman IMG   glycine betaine/carnitine/choline ABC transporter
img|641310439 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   glycine betaine/L-proline ABC superfamily ATP binding cassette transporter, binding protein
img|641771470 Staphylococcus aureus aureus USA300_TCH959 IMG   glycine betaine/L-proline ABC superfamily ATP binding cassette transporter, binding protein
kegg|saa:SAUSA300_2391 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   glycine betaine/carnitine/choline ABC transporter (EC:3.6.3.32)
kegg|sac:SACOL2451 Staphylococcus aureus subsp. aureus COL KEGG   amino acid ABC transporter, amino acid-binding protein
kegg|sae:NWMN_2345 Staphylococcus aureus subsp. aureus Newman KEGG   glycine betaine/carnitine/choline ABC transporter
kegg|sao:SAOUHSC_02742 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   amino acid transporter, putative
kegg|sax:USA300HOU_2435 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   glycine betaine/L-proline ABC transporter binding protein
ref|YP_001333379.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   glycine betaine/carnitine/choline ABC transporter
ref|YP_001576304.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   glycine betaine/L-proline ABC transporter binding protein
ref|YP_187250.1 Staphylococcus aureus subsp. aureus COL RefSeq   amino acid ABC transporter, amino acid-binding protein
ref|YP_495026.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   glycine betaine/carnitine/choline ABC transporter
ref|YP_501203.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   amino acid transporter, putative
ref|ZP_03564165.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   glycine betaine/L-proline ABC transporter binding protein
ref|ZP_03565287.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   glycine betaine/L-proline ABC transporter binding protein
ref|ZP_05699281.1 Staphylococcus aureus A5948 RefSeq   glycine betaine/carnitine/choline ABC transporter
tr|A6QJT5 Staphylococcus aureus (strain Newman) TrEMBL   Glycine betaine/carnitine/choline ABC transporter
tr|A8YYK1 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Glycine betaine/L-proline ABC superfamily ATP binding cassette transporter, binding protein
tr|Q2FE52 Staphylococcus aureus (strain USA300) TrEMBL   Glycine betaine/carnitine/choline ABC transporter
tr|Q2FVH0 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Amino acid transporter, putative
tr|Q5HDA7 Staphylococcus aureus (strain COL) TrEMBL   Amino acid ABC transporter, amino acid-binding protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
36 fig|93062.19.peg.2389 Choline ABC transport system, permease protein OpuBD
35 fig|93062.19.peg.2391 Choline ABC transport system, permease protein OpuBB
43 fig|93062.19.peg.2392 Osmotically activated L-carnitine/choline ABC transporter, ATP-binding protein OpuCA


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search