The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93062.19.peg.2384: Staphylococcus aureus subsp. aureus COL

This feature in The SEED Viewer

NCBI Taxonomy Id: 93062

Current Assignment: Amino acid permease
Translate Function Assignments



Context on contig NC_002951 from base 2496804 to 2509763 (12960 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2380 2496804 2497460 657 +           FIG01107870: hypothetical protein locus|SACOL2439, protein_id|YP_187240.1, gi|57652251, geneID|3237351
2381 2498329 2497523 807 - 62         Predicted phosphohydrolases locus|SACOL2440, protein_id|YP_187241.1, gi|57652252, geneID|3237352
2382 2498615 2500024 1410 + 285     2: 4 7   D-serine/D-alanine/glycine transporter locus|SACOL2441, protein_id|YP_187242.1, gi|57652253, geneID|3237353
2383 2500162 2502240 2079 + 137     1: 13   Na+/H+ antiporter locus|SACOL2442, protein_id|YP_187243.1, gi|57652254, geneID|3237354
2384 2504209 2502380 1830 - 139       Amino acid permease locus|SACOL2443, protein_id|YP_187244.1, gi|57652255, geneID|3237355
2385 2504441 2505937 1497 + 231     1: 12   Beta-lactamase (EC 3.5.2.6) locus|SACOL2445, protein_id|YP_187245.1, gi|57652256, geneID|3237356
2386 2506880 2506029 852 - 91         Hypothetical protein, similar to glucose epimerase locus|SACOL2446, protein_id|YP_187246.1, gi|57652257, geneID|3237251
2387 2508137 2507202 936 - 321 6 9: 2 8 9 5 11 1 3 6 10   2-dehydropantoate 2-reductase (EC 1.1.1.169) locus|SACOL2448, protein_id|YP_187247.1, gi|57652258, geneID|3237252
2388 2509763 2508363 1401 - 225         putative transporter locus|SACOL2449, protein_id|YP_187248.1, gi|57652259, geneID|3237253

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93062.19.peg.2384 Amino acid permease
MFNQFKRLIIGQPKKNRELKDEKISKFKGLAILSSDALSSVAYGPEQILITLSVVGAVAT
WYTLPIAGAVLILLAALIMSYRQIIYAYPKGGGAYMVSKTNLGEKWGLLAGGSLLVDYIL
TVAVSISSGADAFVAAFPSLYGHKVLIACLLVLFILILNLRGLTESATVLSYPVYLFIIG
LVILIFIGTFRVATGDIQPHMHASVGTAVPGVTLFLLLKAFSSGASSLTGVEAISNAVTN
FREPSAKNAVKTLIAMGSILAFLLVGIVGLAYVYGILPQTETTVLSQLAMQIFGDNAAFY
FVQATTVMILVLAANTGFTAFPMLAASMSKDKYMPRMFTVRGDRLGYSNSIIILGVLAII
LIIVFDGMTEDLIPLYAVGVFIPFTLAQFGMVIKWIHERPKNWLSKLSVNLLGGIVTFIV
FMILLITKFSQVWPILIFLPFVVIFFLKINKHYRDIAEQLRSDIDVLNVDVVDRNLAIVP
ITSITTAVDKSIYYAQMLANNDVIAVHVSFGDEDEKAFQEKWKRHFPDVRLVILHSEYRS
IIRPISRFIDKINRKANDQNYMITVVIPEFITKKRWHNLLHNQTSLRMKLYLIYQKNVNV
CTIPFKLKK

MD5 = bb0f8440f8e293e1d3ad5b5cf49019db


  DNA Sequence

>fig|93062.19.peg.2384 Amino acid permease
atgttcaatcaatttaaaagacttattatagggcaacctaaaaaaaacagagaactaaaa
gacgaaaagatatcgaagtttaaagggttagcgattctttcgtcggatgcattatcttca
gtggcttacggtcccgaacaaatactgattacactatcagtagtgggtgcagttgcaact
tggtatactttaccgattgcaggtgctgttctgatcttattagctgctttaattatgtct
tataggcaaattatttatgcatatcctaaaggtggcggcgcgtatatggtgtccaagacc
aatttaggagaaaaatggggattgcttgcaggaggctcattattagtcgattacatactg
actgtcgctgttagtatatcatctggtgctgatgcatttgttgctgcattcccaagttta
tatgggcataaagtactgattgcatgtttacttgtactttttattttaatattaaattta
cgtggtttaactgaatctgccaccgtattatcctatccagtatatcttttcattataggg
ttagtgatattaatatttataggtactttccgtgtggcgacaggagatattcaaccacat
atgcatgcatcagtaggaactgcggttcctggagtaacattattcttgctattaaaagca
ttttcatcaggggcttcatcgttaacgggtgttgaagctatttcaaatgcggtaaccaat
tttagagagccaagtgctaaaaatgctgtgaaaacgttaattgctatgggttcaatttta
gcgtttttattagttggtatcgttggtttagcatatgtttatggaattttgccacaaacg
gaaacgacagttttatcacaattagctatgcaaatatttggtgataatgctgccttctat
tttgtacaggcaacgaccgtgatgattttggtattagcagccaacactggatttacagct
tttccgatgttagcggcttcaatgtctaaagataaatatatgcctagaatgtttactgtt
agaggtgatcgcttaggctactctaactcgattattattttaggtgtattagccattatt
ttaattattgtatttgatggtatgactgaagatttaattccattgtatgcggttggtgta
tttattccatttacactagcacaattcggtatggttattaaatggattcatgaacgtcct
aagaattggttaagtaagttgtctgtgaacttacttggtggtatcgtgacatttattgtt
tttatgattttactcataactaaatttagccaagtatggccgatacttattttcttgccg
ttcgtggtgattttcttcttgaaaattaacaaacattatcgagatatcgcagaacaatta
cgttctgacattgatgttcttaatgtggacgtggtagatcgtaatttagcaattgtgccg
ataacaagtattacaacagcagttgataagtctatttattacgcacaaatgcttgcgaat
aatgatgtcatagcagtacatgtatcatttggagatgaagatgaaaaagcattccaagag
aaatggaaacgtcatttcccagatgtaagattagttattttacattcggaatatcgcagt
attatacgaccaatttcacgttttatcgataagattaatcgtaaagccaacgatcaaaac
tatatgattacagtagtgataccagaatttattactaagaaacgttggcataatttatta
cacaatcaaactagtttgcgtatgaaattgtatttaatttatcaaaagaatgttaacgta
tgtacaattccatttaaacttaaaaaatag


  DNA with Flanking Sequence

>fig|93062.19.peg.2384 Amino acid permease
gttgtgggagaagctttgacttttttatcaacatcttgataaccataacctttatttaaa
aaaactttgccattttttactattaaaattgatgctccaggaatgtgtcccttttgtaaa
tcatgctcgataattgtatctatttgttgttgcgaatcattggttaaccgtgtcttcgta
ttgctatttaatgttatatatatagcaattgaaatggcgactataatgataatagaaatg
gatagaaaatacagttttttagtagtcataaacgttcctttttatatgttaaatttactt
aagtgcctaatgagatttattttattataccagttctattgaataaattaattaaagagg
tatatttaccattatttttgacaccttatatgttaataggtgtataattacataaaaaat
attaattaactctctatactttttggaaagataggcgtatagtgatatccatcaaaaact
ataaaaaggaataggagattatgttcaatcaatttaaaagacttattatagggcaaccta
aaaaaaacagagaactaaaagacgaaaagatatcgaagtttaaagggttagcgattcttt
cgtcggatgcattatcttcagtggcttacggtcccgaacaaatactgattacactatcag
tagtgggtgcagttgcaacttggtatactttaccgattgcaggtgctgttctgatcttat
tagctgctttaattatgtcttataggcaaattatttatgcatatcctaaaggtggcggcg
cgtatatggtgtccaagaccaatttaggagaaaaatggggattgcttgcaggaggctcat
tattagtcgattacatactgactgtcgctgttagtatatcatctggtgctgatgcatttg
ttgctgcattcccaagtttatatgggcataaagtactgattgcatgtttacttgtacttt
ttattttaatattaaatttacgtggtttaactgaatctgccaccgtattatcctatccag
tatatcttttcattatagggttagtgatattaatatttataggtactttccgtgtggcga
caggagatattcaaccacatatgcatgcatcagtaggaactgcggttcctggagtaacat
tattcttgctattaaaagcattttcatcaggggcttcatcgttaacgggtgttgaagcta
tttcaaatgcggtaaccaattttagagagccaagtgctaaaaatgctgtgaaaacgttaa
ttgctatgggttcaattttagcgtttttattagttggtatcgttggtttagcatatgttt
atggaattttgccacaaacggaaacgacagttttatcacaattagctatgcaaatatttg
gtgataatgctgccttctattttgtacaggcaacgaccgtgatgattttggtattagcag
ccaacactggatttacagcttttccgatgttagcggcttcaatgtctaaagataaatata
tgcctagaatgtttactgttagaggtgatcgcttaggctactctaactcgattattattt
taggtgtattagccattattttaattattgtatttgatggtatgactgaagatttaattc
cattgtatgcggttggtgtatttattccatttacactagcacaattcggtatggttatta
aatggattcatgaacgtcctaagaattggttaagtaagttgtctgtgaacttacttggtg
gtatcgtgacatttattgtttttatgattttactcataactaaatttagccaagtatggc
cgatacttattttcttgccgttcgtggtgattttcttcttgaaaattaacaaacattatc
gagatatcgcagaacaattacgttctgacattgatgttcttaatgtggacgtggtagatc
gtaatttagcaattgtgccgataacaagtattacaacagcagttgataagtctatttatt
acgcacaaatgcttgcgaataatgatgtcatagcagtacatgtatcatttggagatgaag
atgaaaaagcattccaagagaaatggaaacgtcatttcccagatgtaagattagttattt
tacattcggaatatcgcagtattatacgaccaatttcacgttttatcgataagattaatc
gtaaagccaacgatcaaaactatatgattacagtagtgataccagaatttattactaaga
aacgttggcataatttattacacaatcaaactagtttgcgtatgaaattgtatttaattt
atcaaaagaatgttaacgtatgtacaattccatttaaacttaaaaaatagattctataat
caaatcggattgatgaaaggttatttacttttcatcaatctgattttttgatgttgaata
taaaaaccccgtacatatgagatgataatgactttgtctcatatgtacgggggtattgtt
atgtcttgcttaatgtttggactgtaaagacaagacaatttcgttgtaattgatattttc
tcgaatttgagctgcaacgatattgttgattttatttttgcgaattaattcatctaaaag
atgacgttgtaagtacaatgcttccaatttgtggttatggaacatagcttgcggtatgat
ttgattgctgttttcttgacgttcttttcgacgttgtgcacgccactttaatgagcgact
catatcatagtaatgattaatgactaagctaacctcaagtacatttgtactattttgttc
ttcttttaagcgtaaaataatattgtgattcacaatacgcataattttttgaacatcttt
gaatgaattt


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT05SA2459 Staphylococcus aureus NCTC 8325     amino acid permease-associated region
cmr|SACOL2443 Staphylococcus aureus subsp. aureus COL     membrane protein, putative
cmr|SAUSA300_2385 Staphylococcus aureus subsp. aureus USA300-FPR3757     putative membrane protein
dbj|BAF68611.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
fig|367830.3.peg.599 Staphylococcus aureus subsp. aureus USA300 FIG   Amino acid permease
fig|426430.6.peg.2265 Staphylococcus aureus subsp. aureus str. Newman FIG   Amino acid permease
fig|426430.8.peg.2544 Staphylococcus aureus subsp. aureus str. Newman FIG   Amino acid permease
fig|451515.3.peg.2545 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Amino acid permease
fig|451516.9.peg.2535 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Amino acid permease
fig|452948.4.peg.509 Staphylococcus aureus 930918-3 FIG   Amino acid permease
fig|455227.3.peg.767 Staphylococcus aureus D30 FIG   Amino acid permease
fig|546342.3.peg.2411 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Amino acid permease
fig|546343.3.peg.818 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Amino acid permease
fig|553567.3.peg.739 Staphylococcus aureus A5948 FIG   Amino acid permease
fig|553590.4.peg.1048 Staphylococcus aureus A9754 FIG   Amino acid permease
fig|553594.3.peg.399 Staphylococcus aureus A9765 FIG   Amino acid permease
fig|644279.4.peg.2586 Staphylococcus aureus subsp. aureus 132 FIG   Amino acid permease
fig|93061.3.peg.2587 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Amino acid permease
fig|93061.5.peg.2474 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Amino acid permease
fig|93062.4.peg.2499 Staphylococcus aureus subsp. aureus COL FIG   Amino acid permease
gb|AAW38535.1 Staphylococcus aureus subsp. aureus COL     membrane protein, putative
gb|ABD20385.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     putative membrane protein
gb|ABD31740.1 Staphylococcus aureus subsp. aureus NCTC 8325     membrane protein, putative
gb|ABX30417.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     APC family amino acid-polyamine-organocation transporter
gb|EEV83861.1 Staphylococcus aureus A5948     conserved hypothetical protein
gb|EEW45587.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_1348
gb|EEW47661.1 Staphylococcus aureus D30     hypothetical protein SAD30_0689
gi|150375351 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|151222551 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_2339
gi|160369446 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   APC family amino acid-polyamine-organocation transporter
gi|161510637 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   APC family amino acid-polyamine-organocation transporter
gi|221139360 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   APC family amino acid-polyamine-organocation transporter
gi|221140800 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   APC family amino acid-polyamine-organocation transporter
gi|257861046 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|258451254 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|259160564 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_1348
gi|259163100 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_0689
gi|57286441 Staphylococcus aureus subsp. aureus COL NCBI   membrane protein, putative
gi|57652255 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL2443
gi|87125871 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   putative membrane protein
gi|87159897 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   hypothetical protein SAUSA300_2385
gi|87203930 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   membrane protein, putative
gi|88196372 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_02733
img|637153197 Staphylococcus aureus aureus COL IMG   hypothetical protein
img|637889028 Staphylococcus aureus aureus USA300 IMG   hypothetical protein
img|637895344 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|640796770 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|641310431 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   APC family amino acid-polyamine-organocation transporter
img|641771462 Staphylococcus aureus aureus USA300_TCH959 IMG   APC family amino acid-polyamine-organocation transporter
kegg|saa:SAUSA300_2385 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   hypothetical protein
kegg|sac:SACOL2443 Staphylococcus aureus subsp. aureus COL KEGG   hypothetical protein
kegg|sae:NWMN_2339 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sao:SAOUHSC_02733 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sax:USA300HOU_2427 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   APC family amino acid-polyamine-organocation transporter
ref|YP_001333373.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_2339
ref|YP_001576296.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   APC family amino acid-polyamine-organocation transporter
ref|YP_187244.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL2443
ref|YP_495020.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   hypothetical protein SAUSA300_2385
ref|YP_501195.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_02733
ref|ZP_03564159.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   APC family amino acid-polyamine-organocation transporter
ref|ZP_03565293.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   APC family amino acid-polyamine-organocation transporter
ref|ZP_05699287.1 Staphylococcus aureus A5948 RefSeq   conserved hypothetical protein
tr|A6QJS9 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein
tr|A8YYJ3 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   APC family amino acid-polyamine-organocation transporter
tr|Q2FE58 Staphylococcus aureus (strain USA300) TrEMBL   Putative membrane protein
tr|Q2FVH8 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Membrane protein, putative
tr|Q5HDB3 Staphylococcus aureus (strain COL) TrEMBL   Membrane protein, putative


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
6 fig|93062.19.peg.2387 2-dehydropantoate 2-reductase (EC 1.1.1.169)


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search