The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93062.19.peg.2242: Staphylococcus aureus subsp. aureus COL

This feature in The SEED Viewer

NCBI Taxonomy Id: 93062

Current Assignment: Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
Translate Function Assignments



Context on contig NC_002951 from base 2354063 to 2365629 (11567 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2236 2355145 2354063 1083 -           Opine dehydrogenase-like protein locus|SACOL2293, protein_id|YP_187100.1, gi|57652233, geneID|3237365
2237 2355384 2355815 432 + 238         Hypothetical protein SAV2303 locus|SACOL2294, protein_id|YP_187101.1, gi|57652234, geneID|3237366
2238 2356052 2356552 501 + 236         Secretory antigen SsaA homolog locus|SACOL2295, protein_id|YP_187102.1, gi|57652235, geneID|3237367
2239 2356600 2356857 258 + 47         FIG01108466: hypothetical protein  
2240 2356914 2357867 954 + 56     2: 5 11   Glyoxylate reductase (EC 1.1.1.79) / Glyoxylate reductase (EC 1.1.1.26) / Hydroxypyruvate reductase (EC 1.1.1.81) locus|SACOL2296, protein_id|YP_187103.1, gi|57652236, geneID|3237368
2241 2359083 2357959 1125 - 91     3: 2 8 6   Salicylate hydroxylase (EC 1.14.13.1) locus|SACOL2297, protein_id|YP_187104.1, gi|57652237, geneID|3237369
2242 2360170 2359394 777 - 310     6: 4 13 7 3 9 10   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96) locus|SACOL2298, protein_id|YP_187105.1, gi|57652238, geneID|3237370
2243 2360443 2360192 252 - 21         FIG01108068: hypothetical protein locus|SACOL2299, protein_id|YP_187106.1, gi|57652239, geneID|3237371
2244 2361126 2360653 474 - 209     1: 1   Uncharacterized protein SAV2308 locus|SACOL2300, protein_id|YP_187107.1, gi|57652240, geneID|3237372
2245 2363453 2361126 2328 - -1     1: 1   Formate dehydrogenase related protein locus|SACOL2301, protein_id|YP_187108.1, gi|57652241, geneID|3237357
2246 2365629 2364682 948 - 1228     1: 12   Cell envelope-associated transcriptional attenuator LytR-CpsA-Psr, subfamily F2 locus|SACOL2302, protein_id|YP_187109.1, gi|57652242, geneID|3237358

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Raj_MurE Packiam_Mathanraj_user N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28)
Hfq_and_related_genes Gottesman_Susan__user N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28)
Pf06050_Allatoin? ZALLOT_Remi_user N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28)
NANA_exploration ZALLOT_Remi_user N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28)
YjeE_Cluster vcrecy N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28)
RsmG_Cluster vcrecy N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28)


  Protein Sequence

>fig|93062.19.peg.2242 Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
MKKNFKLRISTLLLIVILVVFAVLLIVNETKLFKNDVNYSFDEAVSMQQGKGIVQTKEED
GKFVEANNNEIAKAMTISHKDNDMKYMDITEKVPMSESEVNQLLKGKGILENRGKVFLEA
QEKYEVNVIYLVSHALVETGNGKSELAKGIKDGKKRYYNFFGIGAFDSSAVRSGKSYAEK
EQWTSPDKAIIGGAKFIRNEYFENNQLNLYQMRWNPENPAQHQYASDIRWADKIAKLMDK
SYKQFGIKKDDIRQTYYK

MD5 = 94fce9f5ac509d9fc679c6978bef44e4


  DNA Sequence

>fig|93062.19.peg.2242 Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
atgaagaagaatttcaagttacgcatttcaacgctactattgatagttattttagttgtt
tttgctgtattactcatcgtgaatgaaactaaattgtttaaaaatgatgtgaattactct
tttgatgaggctgtttcaatgcaacaagggaaaggtattgtacagacaaaagaagaggat
ggtaaatttgttgaagcaaataataatgaaattgctaaagcaatgactatttcacataaa
gacaatgatatgaagtatatggatatcacagaaaaagtgccaatgtcggaatctgaagtt
aaccaattgctaaaaggtaaggggattttagaaaatcgagggaaagtttttctagaagct
caagaaaaatatgaggttaatgtcatttatcttgttagccatgcattagtagaaacaggt
aacggcaaatcagaattagcaaaaggcattaaagatgggaaaaaacgctattacaacttt
tttggtataggagcattcgatagtagtgctgttcgtagtgggaaaagttatgctgaaaag
gaacaatggacatcaccagataaggcgattattggtggtgcaaagttcattcgtaatgaa
tattttgaaaacaatcaactgaatttatatcaaatgcgatggaatccagaaaatcctgcg
caacatcaatatgcgagtgacattcgctgggcagataaaattgccaaattaatggataaa
tcctataagcagtttggtataaagaaagatgatattagacaaacatattataaataa


  DNA with Flanking Sequence

>fig|93062.19.peg.2242 Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
atgtctcgagaagaataacattacaatgaaaaagtgtttctacatgcaagcagtgtagga
gcactttttttaatttttgtaaaaattaaaaagggtgtttttgatggaataaatgaataa
tattgaaaaacaaaaaaatcacgtgctattgtgaatcaatcatcgacaggcctatgaaac
atcatgtattattatgattatgtaagttatttaaataaaaagggtgagtgcatattaatt
cgagaatgttaaaaacgtcagctgtaatttctaatacattattagtcataggtttagtct
gtctatttatgatgaaattagtgttagctattactttttttgctgtttcattatcaatta
gtctagttgtctttaatatgatgttcagagatagaacaacgatgaaagtaatcgttaacg
cttcttttttaatcgtaatattagcgattgtagtggcatattttttattgtctaagtaag
aaaaatgaggttttgtctatatgaagaagaatttcaagttacgcatttcaacgctactat
tgatagttattttagttgtttttgctgtattactcatcgtgaatgaaactaaattgttta
aaaatgatgtgaattactcttttgatgaggctgtttcaatgcaacaagggaaaggtattg
tacagacaaaagaagaggatggtaaatttgttgaagcaaataataatgaaattgctaaag
caatgactatttcacataaagacaatgatatgaagtatatggatatcacagaaaaagtgc
caatgtcggaatctgaagttaaccaattgctaaaaggtaaggggattttagaaaatcgag
ggaaagtttttctagaagctcaagaaaaatatgaggttaatgtcatttatcttgttagcc
atgcattagtagaaacaggtaacggcaaatcagaattagcaaaaggcattaaagatggga
aaaaacgctattacaacttttttggtataggagcattcgatagtagtgctgttcgtagtg
ggaaaagttatgctgaaaaggaacaatggacatcaccagataaggcgattattggtggtg
caaagttcattcgtaatgaatattttgaaaacaatcaactgaatttatatcaaatgcgat
ggaatccagaaaatcctgcgcaacatcaatatgcgagtgacattcgctgggcagataaaa
ttgccaaattaatggataaatcctataagcagtttggtataaagaaagatgatattagac
aaacatattataaataagacatcggtgcttaaaggagctggaacaatttattgtttcgag
ctcctttagcgcattctgagtgtgttagttaaatggattttaacctaacaaaaaacgcta
tatagcatcaaatatgctatatcccacatcattgttacaaatgtacatgatgtaaatgaa
tattgctgtctaaatgtgcatgtaatatacaatggtgcagataatacacttaagtcctta
aaaatgaaacgttagttccaagagtcatttttaaacaatagtgcatgtgataaaatagaa
aagaatgaaaaatatagaggtgacaatatgaagatagcaattataggtgcaggcatcggt
ggattaacagctgctgcattattacaagaacaaggtcatactattaaagtctttgaaaaa
aatgagtcagttaaagaaattggcgctgggattggtatcggagataatgtgcttaaaaaa
ctaggtaatcatgacttagctaaaggtattaaaaatg


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0004040       F:amidase activity
GO:0008745       F:N-acetylmuramoyl-L-alanine amidase activity
GO:0009253       P:peptidoglycan catabolic process
GO:0010382       P:cellular cell wall macromolecule metabolic ...
GO:0033925       F:mannosyl-glycoprotein endo-beta-N-acetylglu...
cmr|NT05SA2321 Staphylococcus aureus NCTC 8325     bifunctional autolysin
cmr|SACOL2298 Staphylococcus aureus subsp. aureus COL     N-acetylmuramoyl-L-alanine amidase, family 4
cmr|SAUSA300_2256 Staphylococcus aureus subsp. aureus USA300-FPR3757     putative N-acetylmuramoyl-L-alanine amidase
dbj|BAB43399.1 Staphylococcus aureus subsp. aureus N315     SA2100
dbj|BAB58469.1 Staphylococcus aureus subsp. aureus Mu50     autolysin E (1e-98,63%,84%,258-258)
dbj|BAB96091.1 Staphylococcus aureus subsp. aureus MW2     MW2226
dbj|BAF68479.1 Staphylococcus aureus subsp. aureus str. Newman     N-acetylmuramoyl-L-alanine amidase, family 4
dbj|BAF79174.1 Staphylococcus aureus subsp. aureus Mu3     hypothetical protein
emb|CAG44009.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   putative N-acetylmuramoyl-L-alanine amidase
fig|158878.1.peg.2307 Staphylococcus aureus subsp. aureus Mu50 FIG   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
fig|158878.14.peg.2386 Staphylococcus aureus subsp. aureus Mu50 FIG   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
fig|158879.1.peg.2182 Staphylococcus aureus subsp. aureus N315 FIG   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
fig|158879.11.peg.2277 Staphylococcus aureus subsp. aureus N315 FIG   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
fig|196620.1.peg.2226 Staphylococcus aureus subsp. aureus MW2 FIG   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
fig|196620.5.peg.2300 Staphylococcus aureus subsp. aureus MW2 FIG   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
fig|282459.1.peg.2176 Staphylococcus aureus subsp. aureus MSSA476 FIG   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
fig|282459.5.peg.2285 Staphylococcus aureus subsp. aureus MSSA476 FIG   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
fig|359786.13.peg.2466 Staphylococcus aureus subsp. aureus JH9 FIG   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
fig|359786.3.peg.2318 Staphylococcus aureus subsp. aureus JH9 FIG   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
fig|359787.11.peg.2428 Staphylococcus aureus subsp. aureus JH1 FIG   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
fig|359787.3.peg.2158 Staphylococcus aureus subsp. aureus JH1 FIG   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
fig|367830.3.peg.2166 Staphylococcus aureus subsp. aureus USA300 FIG   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
fig|418127.4.peg.2117 Staphylococcus aureus subsp. aureus Mu3 FIG   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
fig|418127.6.peg.2350 Staphylococcus aureus subsp. aureus Mu3 FIG   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
fig|426430.6.peg.2141 Staphylococcus aureus subsp. aureus str. Newman FIG   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
fig|426430.8.peg.2400 Staphylococcus aureus subsp. aureus str. Newman FIG   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
fig|450394.6.peg.1518 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
fig|451515.3.peg.2404 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
fig|451516.9.peg.2393 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
fig|452948.4.peg.1452 Staphylococcus aureus 930918-3 FIG   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
fig|455227.3.peg.529 Staphylococcus aureus D30 FIG   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
fig|505321.3.peg.88 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
fig|546342.3.peg.105 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
fig|546343.3.peg.243 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
fig|548474.3.peg.574 Staphylococcus aureus subsp. aureus TCH130 FIG   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
fig|548475.3.peg.1865 Staphylococcus aureus subsp. aureus TCH70 FIG   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
fig|553565.3.peg.2099 Staphylococcus aureus A5937 FIG   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
fig|553567.3.peg.187 Staphylococcus aureus A5948 FIG   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
fig|553568.3.peg.2635 Staphylococcus aureus A6224 FIG   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
fig|553571.3.peg.1622 Staphylococcus aureus A6300 FIG   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
fig|553573.3.peg.696 Staphylococcus aureus A8115 FIG   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
fig|553577.3.peg.132 Staphylococcus aureus A8796 FIG   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
fig|553581.3.peg.2589 Staphylococcus aureus A9299 FIG   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
fig|553588.3.peg.2678 Staphylococcus aureus A9719 FIG   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
fig|553590.4.peg.907 Staphylococcus aureus A9754 FIG   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
fig|553592.3.peg.1038 Staphylococcus aureus A9763 FIG   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
fig|553594.3.peg.1190 Staphylococcus aureus A9765 FIG   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
fig|553596.3.peg.1552 Staphylococcus aureus A9781 FIG   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
fig|553601.3.peg.534 Staphylococcus aureus A10102 FIG   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
fig|585891.3.peg.2382 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
fig|644279.4.peg.2444 Staphylococcus aureus subsp. aureus 132 FIG   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
fig|681288.4.peg.2330 Staphylococcus aureus subsp. aureus ED98 FIG   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
fig|703339.3.peg.2292 Staphylococcus aureus 04-02981 FIG   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
fig|762962.3.peg.2208 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
fig|93061.5.peg.2328 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
fig|93062.4.peg.2360 Staphylococcus aureus subsp. aureus COL FIG   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
gb|AAW38518.1 Staphylococcus aureus subsp. aureus COL     N-acetylmuramoyl-L-alanine amidase, family 4
gb|ABD20782.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     putative N-acetylmuramoyl-L-alanine amidase
gb|ABQ50110.1 Staphylococcus aureus subsp. aureus JH9     Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase
gb|ABR53198.1 Staphylococcus aureus subsp. aureus JH1     Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase
gb|ABX30281.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     N-acetylmuramoyl-L-alanine amidase
gb|EES55900.1 Staphylococcus aureus subsp. aureus TCH70     N-acetylmuramoyl-L-alanine amidase
gb|EES95150.1 Staphylococcus aureus subsp. aureus USA300_TCH959     N-acetylmuramoyl-L-alanine amidase
gb|EES96428.1 Staphylococcus aureus subsp. aureus TCH130     N-acetylmuramoyl-L-alanine amidase
gb|EEV26961.1 Staphylococcus aureus A9781     mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase
gb|EEV64890.1 Staphylococcus aureus A9763     mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase
gb|EEV66213.1 Staphylococcus aureus A9719     autolysin E
gb|EEV71513.1 Staphylococcus aureus A9299     N-acetylmuramoyl-L-alanine amidase, family 4
gb|EEV75764.1 Staphylococcus aureus A8115     mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase
gb|EEV77608.1 Staphylococcus aureus A6300     mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase
gb|EEV79291.1 Staphylococcus aureus A6224     mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase
gb|EEV84285.1 Staphylococcus aureus A5948     mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase
gb|EEV85316.1 Staphylococcus aureus A5937     conserved hypothetical protein
gb|EEW44868.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_0964
gb|EEW47982.1 Staphylococcus aureus D30     hypothetical protein SAD30_0105
gi|13702107 Staphylococcus aureus subsp. aureus N315 NCBI   SA2100
gi|14248081 Staphylococcus aureus subsp. aureus Mu50 NCBI   autolysin E (1e-98,63%,84%,258-258)
gi|147741812 Staphylococcus aureus subsp. aureus JH9 NCBI   Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase
gi|148268743 Staphylococcus aureus subsp. aureus JH9 NCBI   mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase
gi|149947262 Staphylococcus aureus subsp. aureus JH1 NCBI   Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase
gi|150375219 Staphylococcus aureus subsp. aureus str. Newman NCBI   N-acetylmuramoyl-L-alanine amidase, family 4
gi|150394810 Staphylococcus aureus subsp. aureus JH1 NCBI   mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase
gi|151222419 Staphylococcus aureus subsp. aureus str. Newman NCBI   N-acetylmuramoyl-L-alanine amidase
gi|156722757 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein
gi|156980622 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_2291
gi|15925297 Staphylococcus aureus subsp. aureus Mu50 NCBI   autolysin E (1e-98,63%,84%,258-258)
gi|15927887 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA2100
gi|160369310 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   N-acetylmuramoyl-L-alanine amidase
gi|161510501 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   N-acetylmuramoyl-L-alanine amidase
gi|21205397 Staphylococcus aureus subsp. aureus MW2 NCBI   MW2226
gi|21283955 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein MW2226
gi|221137119 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   N-acetylmuramoyl-L-alanine amidase
gi|221140235 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   N-acetylmuramoyl-L-alanine amidase
gi|251803243 Staphylococcus aureus subsp. aureus TCH70 NCBI   N-acetylmuramoyl-L-alanine amidase
gi|251813264 Staphylococcus aureus subsp. aureus TCH70 NCBI   N-acetylmuramoyl-L-alanine amidase
gi|253314646 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   putative N-acetylmuramoyl-L-alanine amidase
gi|253726421 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   N-acetylmuramoyl-L-alanine amidase
gi|253727699 Staphylococcus aureus subsp. aureus TCH130 NCBI   N-acetylmuramoyl-L-alanine amidase
gi|253729974 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   N-acetylmuramoyl-L-alanine amidase
gi|253734283 Staphylococcus aureus subsp. aureus TCH130 NCBI   N-acetylmuramoyl-L-alanine amidase
gi|255007083 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   putative N-acetylmuramoyl-L-alanine amidase
gi|257788621 Staphylococcus aureus A9781 NCBI   mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase
gi|257794649 Staphylococcus aureus A9781 NCBI   mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase
gi|257840430 Staphylococcus aureus A9763 NCBI   mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase
gi|257841776 Staphylococcus aureus A9719 NCBI   autolysin E
gi|257847511 Staphylococcus aureus A9299 NCBI   N-acetylmuramoyl-L-alanine amidase, family 4
gi|257851830 Staphylococcus aureus A8115 NCBI   mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase
gi|257854660 Staphylococcus aureus A6300 NCBI   mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase
gi|257856382 Staphylococcus aureus A6224 NCBI   mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase
gi|257861483 Staphylococcus aureus A5948 NCBI   mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase
gi|257862548 Staphylococcus aureus A5937 NCBI   conserved hypothetical protein
gi|258408747 Staphylococcus aureus A9763 NCBI   mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase
gi|258422345 Staphylococcus aureus A9719 NCBI   autolysin E
gi|258439735 Staphylococcus aureus A9299 NCBI   N-acetylmuramoyl-L-alanine amidase, family 4
gi|258442709 Staphylococcus aureus A8115 NCBI   mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase
gi|258446592 Staphylococcus aureus A6300 NCBI   mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase
gi|258450290 Staphylococcus aureus A6224 NCBI   mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase
gi|258450700 Staphylococcus aureus A5948 NCBI   mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase
gi|258455337 Staphylococcus aureus A5937 NCBI   conserved hypothetical protein
gi|259159828 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_0964
gi|259163424 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_0105
gi|49245532 Staphylococcus aureus subsp. aureus MSSA476 NCBI   putative N-acetylmuramoyl-L-alanine amidase
gi|49487089 Staphylococcus aureus subsp. aureus MSSA476 NCBI   putative N-acetylmuramoyl-L-alanine amidase
gi|57286424 Staphylococcus aureus subsp. aureus COL NCBI   N-acetylmuramoyl-L-alanine amidase, family 4
gi|57652238 Staphylococcus aureus subsp. aureus COL NCBI   N-acetylmuramoyl-L-alanine amidase
gi|87126268 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   putative N-acetylmuramoyl-L-alanine amidase
gi|87160294 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   putative N-acetylmuramoyl-L-alanine amidase
img|637093850 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637100864 Staphylococcus aureus aureus Mu50 IMG   autolysin E (1e-98,63%,84%,258-258)
img|637153058 Staphylococcus aureus aureus COL IMG   N-acetylmuramoyl-L-alanine amidase, family 4
img|637158467 Staphylococcus aureus aureus MSSA476 IMG   putative N-acetylmuramoyl-L-alanine amidase
img|637300043 Staphylococcus aureus aureus MW2 IMG   hypothetical protein
img|637888899 Staphylococcus aureus aureus USA300 IMG   putative N-acetylmuramoyl-L-alanine amidase
img|639109303 Staphylococcus aureus aureus JH1 IMG   Mannosyl-glycoprotein endo-beta-N-acetylglucosamidase( EC:3.2.1.96 )
img|640566718 Staphylococcus aureus aureus JH9 IMG   Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase( EC:3.2.1.96 )
img|640780485 Staphylococcus aureus aureus JH1 IMG   Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase( EC:3.2.1.96 )
img|640796638 Staphylococcus aureus aureus Newman IMG   N-acetylmuramoyl-L-alanine amidase, family 4
img|640905089 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
img|641310295 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   N-acetylmuramoyl-L-alanine amidase( EC:3.5.1.28 )
kegg|saa:SAUSA300_2256 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   putative N-acetylmuramoyl-L-alanine amidase
kegg|sac:SACOL2298 Staphylococcus aureus subsp. aureus COL KEGG   N-acetylmuramoyl-L-alanine amidase
kegg|sae:NWMN_2207 Staphylococcus aureus subsp. aureus Newman KEGG   N-acetylmuramoyl-L-alanine amidase
kegg|sah:SaurJH1_2373 Staphylococcus aureus subsp. aureus JH1 KEGG   mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase (EC:3.2.1.96)
kegg|saj:SaurJH9_2330 Staphylococcus aureus subsp. aureus JH9 KEGG   mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase (EC:3.2.1.96)
kegg|sam:MW2226 Staphylococcus aureus subsp. aureus MW2 KEGG   hypothetical protein
kegg|sas:SAS2198   KEGG   putative N-acetylmuramoyl-L-alanine amidase
kegg|sau:SA2100   KEGG   hypothetical protein
kegg|sav:SAV2307   KEGG   autolysin E
kegg|saw:SAHV_2291 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
kegg|sax:USA300HOU_2288 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   N-acetylmuramoyl-L-alanine amidase (EC:3.5.1.28)
ref|NP_372831.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   autolysin E (1e-98,63%,84%,258-258)
ref|NP_375420.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA2100
ref|NP_647043.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   hypothetical protein MW2226
ref|YP_001247686.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase
ref|YP_001317485.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase
ref|YP_001333241.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   N-acetylmuramoyl-L-alanine amidase
ref|YP_001442881.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_2291
ref|YP_001576160.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   N-acetylmuramoyl-L-alanine amidase
ref|YP_044310.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   putative N-acetylmuramoyl-L-alanine amidase
ref|YP_187105.1 Staphylococcus aureus subsp. aureus COL RefSeq   N-acetylmuramoyl-L-alanine amidase
ref|YP_494891.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   putative N-acetylmuramoyl-L-alanine amidase
ref|ZP_03561930.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   N-acetylmuramoyl-L-alanine amidase
ref|ZP_03564728.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   N-acetylmuramoyl-L-alanine amidase
ref|ZP_04827737.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   N-acetylmuramoyl-L-alanine amidase
ref|ZP_04837859.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   putative N-acetylmuramoyl-L-alanine amidase
ref|ZP_04864139.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   N-acetylmuramoyl-L-alanine amidase
ref|ZP_04868448.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   N-acetylmuramoyl-L-alanine amidase
ref|ZP_05145684.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   putative N-acetylmuramoyl-L-alanine amidase
ref|ZP_05643628.1 Staphylococcus aureus A9781 RefSeq   mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase
ref|ZP_05681031.1 Staphylococcus aureus A9763 RefSeq   mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase
ref|ZP_05685257.1 Staphylococcus aureus A9719 RefSeq   autolysin E
ref|ZP_05690481.1 Staphylococcus aureus A9299 RefSeq   N-acetylmuramoyl-L-alanine amidase, family 4
ref|ZP_05691269.1 Staphylococcus aureus A8115 RefSeq   mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase
ref|ZP_05694747.1 Staphylococcus aureus A6300 RefSeq   mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase
ref|ZP_05698382.1 Staphylococcus aureus A6224 RefSeq   mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase
ref|ZP_05698759.1 Staphylococcus aureus A5948 RefSeq   mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase
ref|ZP_05703297.1 Staphylococcus aureus A5937 RefSeq   conserved hypothetical protein
tr|A5IV87 Staphylococcus aureus (strain JH9) TrEMBL   Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase precursor
tr|A6QJE7 Staphylococcus aureus (strain Newman) TrEMBL   N-acetylmuramoyl-L-alanine amidase, family 4
tr|A6U430 Staphylococcus aureus (strain JH1) TrEMBL   Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase precursor
tr|A7X5P9 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Putative uncharacterized protein
tr|A8Z3A4 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   N-acetylmuramoyl-L-alanine amidase
tr|C5MZJ7 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   N-acetylmuramoyl-L-alanine amidase
tr|C5Q2S9 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   N-acetylmuramoyl-L-alanine amidase
tr|C5QG21 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   N-acetylmuramoyl-L-alanine amidase
tr|Q2FEI7 Staphylococcus aureus (strain USA300) TrEMBL   Putative N-acetylmuramoyl-L-alanine amidase
tr|Q5HDQ2 Staphylococcus aureus (strain COL) TrEMBL   N-acetylmuramoyl-L-alanine amidase, family 4
tr|Q6G714 Staphylococcus aureus (strain MSSA476) TrEMBL   Putative N-acetylmuramoyl-L-alanine amidase
tr|Q7A059 Staphylococcus aureus (strain MW2) TrEMBL   MW2226 protein
tr|Q7A415 Staphylococcus aureus (strain N315) TrEMBL   SA2100 protein
tr|Q99RW6 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   Autolysin E (1e-98,63%,84%,258-258)


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search