The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93062.19.peg.2237: Staphylococcus aureus subsp. aureus COL

This feature in The SEED Viewer

NCBI Taxonomy Id: 93062

Current Assignment: Hypothetical protein SAV2303
Translate Function Assignments



Context on contig NC_002951 from base 2348767 to 2361126 (12360 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2232 2350722 2348767 1956 -           Transcription regulator locus|SACOL2290, protein_id|YP_187097.1, gi|57652230, geneID|3237379
2233 2351767 2352135 369 + 1044         Secretory antigen precursor SsaA locus|SACOL2291, protein_id|YP_187098.1, gi|57652231, geneID|3237380
2234 2352394 2352152 243 - 16         Hypothetical protein SAV2300  
2235 2353968 2352568 1401 - 173         Na+/H+ antiporter NhaC gene_name|nhaC, locus|SACOL2292, protein_id|YP_187099.1, gi|57652232, geneID|3237381
2236 2355145 2354063 1083 - 94         Opine dehydrogenase-like protein locus|SACOL2293, protein_id|YP_187100.1, gi|57652233, geneID|3237365
2237 2355384 2355815 432 + 238         Hypothetical protein SAV2303 locus|SACOL2294, protein_id|YP_187101.1, gi|57652234, geneID|3237366
2238 2356052 2356552 501 + 236         Secretory antigen SsaA homolog locus|SACOL2295, protein_id|YP_187102.1, gi|57652235, geneID|3237367
2239 2356600 2356857 258 + 47         FIG01108466: hypothetical protein  
2240 2356914 2357867 954 + 56     2: 5 11   Glyoxylate reductase (EC 1.1.1.79) / Glyoxylate reductase (EC 1.1.1.26) / Hydroxypyruvate reductase (EC 1.1.1.81) locus|SACOL2296, protein_id|YP_187103.1, gi|57652236, geneID|3237368
2241 2359083 2357959 1125 - 91     3: 1 8 6   Salicylate hydroxylase (EC 1.14.13.1) locus|SACOL2297, protein_id|YP_187104.1, gi|57652237, geneID|3237369
2242 2360170 2359394 777 - 310     6: 4 12 7 2 9 10   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96) locus|SACOL2298, protein_id|YP_187105.1, gi|57652238, geneID|3237370
2243 2360443 2360192 252 - 21         FIG01108068: hypothetical protein locus|SACOL2299, protein_id|YP_187106.1, gi|57652239, geneID|3237371
2244 2361126 2360653 474 - 209     1: 3   Uncharacterized protein SAV2308 locus|SACOL2300, protein_id|YP_187107.1, gi|57652240, geneID|3237372

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93062.19.peg.2237 Hypothetical protein SAV2303
MSNMTTEMNDVTNHQPNRKSNDENIMAMLIYLLSLFTSIIGPLIIWLLKKDESKLVDRAG
KNYLNYTISYIIWSIVLVVITLIGVFLIATDIDFIIIIGFIITFIGILSIFAFSILSFVF
TIIACVKYYNGQEYIIPLTIRFI

MD5 = 929d1d260ac3cc3db60e242ab9e3a27a


  DNA Sequence

>fig|93062.19.peg.2237 Hypothetical protein SAV2303
gtgtctaatatgacaactgaaatgaacgacgtaacaaatcatcaaccgaatcgcaaatcc
aatgatgagaacattatggcgatgcttatctatttattaagtttattcacatctattatt
ggtccactgataatatggttattgaaaaaagatgaatcgaaactagttgatcgtgctgga
aaaaattatcttaactatacgatttcttatattatttggtctatcgttttagtcgttatc
actttaataggcgttttcctaattgctacagatattgatttcattattattataggtttc
atcattacgtttatcggtattttatccatattcgctttctcaatattatcttttgtattc
acaattattgcgtgtgtcaaatattataatggccaagaatatataatacctttaacaatt
cgatttatttaa


  DNA with Flanking Sequence

>fig|93062.19.peg.2237 Hypothetical protein SAV2303
actctatgtatgaagatggaataatcacttgaacaatttcagcatcttttaaaacatatt
ccatatcatcactaatatcagtgaattttacgaaacgttcatcaccttcattattaaaat
caaatccgcccttttcgattgcgttttgaaacttacttatagattgattacgacaatata
atttaacatcgtggcctttgctcaccatatctactgctgccgtaactgcgccatttcctg
atcctacaattgctattttcataaacaaccctctttctatctttggttaaaattaaaaac
aaattatacgtaagacaatataaaaatgatgcgaattcattacgcatcattataaatgtt
aagtatatataaccttaaattaacctatttaaacgccgacgtccaccaattatttttatt
tttaataattgtttaataaacatgtttatttttgattatattttgttatagttaaagata
atattacaattttcaaaggagtgtctaatatgacaactgaaatgaacgacgtaacaaatc
atcaaccgaatcgcaaatccaatgatgagaacattatggcgatgcttatctatttattaa
gtttattcacatctattattggtccactgataatatggttattgaaaaaagatgaatcga
aactagttgatcgtgctggaaaaaattatcttaactatacgatttcttatattatttggt
ctatcgttttagtcgttatcactttaataggcgttttcctaattgctacagatattgatt
tcattattattataggtttcatcattacgtttatcggtattttatccatattcgctttct
caatattatcttttgtattcacaattattgcgtgtgtcaaatattataatggccaagaat
atataatacctttaacaattcgatttatttaaacatattacaaataaatatttcctatta
attatctgttaatctcattgtaactttgactaatttttattacaaaattagtcaaagttt
ttttattcttttacaaatcaataacattccccacaagaagcattaattttgttaaagtaa
ctattgtcatcaattcgagatgtgagaataaaacagtcgctacgttttatttataaaaaa
agatatagaactttggaggactttattcatgaaaaaattagtaacagcaactacgttaac
agcaggaatcggcacagcattagtaggtcaagcatatcatgcagatgctgctgaaaatta
tacaaattacaacaactataactacaacacgactcaaactacaacgactacgacaactac
gacaactacatcatcaatttcacattctggtaacttatacactgcaggacaatgtacttg
gtatgtatatgataaagttggcggagaaatcggttctacttggggaaatgct


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search