The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93062.19.peg.2203: Staphylococcus aureus subsp. aureus COL

This feature in The SEED Viewer

NCBI Taxonomy Id: 93062

Current Assignment: Molybdenum cofactor guanylyltransferase (EC 2.7.7.77)
Translate Function Assignments



Context on contig NC_002951 from base 2321426 to 2332354 (10929 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2196 2321426 2321686 261 +           Hypothetical protein SAV2263  
2197 2322442 2321678 765 - -9         Hypothetical protein SAV2264 locus|SACOL2255, protein_id|YP_187062.1, gi|57650847, geneID|3237837
2198 2322604 2323044 441 + 161     1: 3   Transcriptional regulator, MarR family locus|SACOL2256, protein_id|YP_187063.1, gi|57650848, geneID|3237838
2199 2323037 2324248 1212 + -8       dlit(9869592) Major facilitator family transporter locus|SACOL2257, protein_id|YP_187064.1, gi|57650849, geneID|3238579
2200 2324700 2324350 351 - 101       dlit(15292128) Transcriptional regulator SarV (Staphylococcal accessory regulator V) gene_name|sarV, locus|SACOL2258, protein_id|YP_187065.1, gi|57650850, geneID|3238580
2201 2325187 2325053 135 - 352         FIG01109757: hypothetical protein locus|SACOL2260, protein_id|YP_187067.1, gi|57650852, geneID|3236130
2202 2326413 2325391 1023 - 203     1: 1 dlit(26575208)
dlit(25941396)
GTP 3',8-cyclase (EC 4.1.99.22) ## MoaA gene_name|moaA, locus|SACOL2261, protein_id|YP_187068.1, gi|57650853, geneID|3238393
2203 2327032 2326433 600 - 19   2: 2 1   Molybdenum cofactor guanylyltransferase (EC 2.7.7.77) gene_name|mobA, locus|SACOL2262, protein_id|YP_187069.1, gi|57650854, geneID|3238394
2204 2327272 2327039 234 - 6     2: 2 1   Molybdopterin synthase sulfur carrier subunit ## MoaD gene_name|moaD, locus|SACOL2263, protein_id|YP_187070.1, gi|57650855, geneID|3238395
2205 2327724 2327278 447 - 5     2: 2 1   Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12) gene_name|moaE, locus|SACOL2264, protein_id|YP_187071.1, gi|57650856, geneID|3237589
2206 2328223 2327738 486 - 13 4 2: 2 1   Molybdopterin-guanine dinucleotide biosynthesis protein MobB gene_name|mobB, locus|SACOL2265, protein_id|YP_187072.1, gi|57652205, geneID|3237396
2207 2329479 2328220 1260 - -4     2: 2 1   Molybdopterin biosynthesis protein MoeA locus|SACOL2266, protein_id|YP_187073.1, gi|57652206, geneID|3237397
2208 2329542 2330036 495 + 62 5 2: 2 1   Molybdenum cofactor biosynthesis protein MoaC gene_name|moaC, locus|SACOL2267, protein_id|YP_187074.1, gi|57652207, geneID|3237398
2209 2330544 2330038 507 - 1     2: 2 1   Molybdenum cofactor biosynthesis protein MoaB gene_name|moaB, locus|SACOL2268, protein_id|YP_187075.1, gi|57652208, geneID|3237399
2210 2331579 2330575 1005 - 30     2: 2 1   Molybdopterin biosynthesis protein MoeB locus|SACOL2269, protein_id|YP_187076.1, gi|57652209, geneID|3237400
2211 2332354 2331749 606 - 169     2: 2 1   Molybdenum transport ATP-binding protein ModC (TC 3.A.1.8.1) gene_name|modC, locus|SACOL2270, protein_id|YP_187077.1, gi|57652210, geneID|3237401

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Molybdenum_cofactor_biosynthesis VeronikaV Molybdopterin-guanine dinucleotide biosynthesis protein MobA
Molybdenum_cofactor_biosynthesis_ADH ADHanson Molybdopterin-guanine dinucleotide biosynthesis protein MobA


  Protein Sequence

>fig|93062.19.peg.2203 Molybdenum cofactor guanylyltransferase (EC 2.7.7.77)
MKAIILAGGHSVRFGKPKAFAEVNGETFYSRVIKTLESTNMFNEIIISTNAQLATQFKYP
NVVIDDENHNDKGPLAGIYTIMKQHPEEELFFVVSVDTPMITGKAVSTLYQFLVSHLIEN
HLDVAAFKEDGRFIPTIAFYSPNALGAITKALHSDNYSFKNVYHELSTDYLDVRDVDAPS
YWYKNINYQHDLDALIQKL

MD5 = aa90c8b7f2ffd010036f614404d3d6d7


  DNA Sequence

>fig|93062.19.peg.2203 Molybdenum cofactor guanylyltransferase (EC 2.7.7.77)
atgaaagcaataattcttgcaggtggtcattcagtgcgatttggtaagcccaaagctttt
gcggaagtgaacggtgagaccttttatagtagagtaattaagacattagaatcaacaaat
atgttcaatgaaattattattagtacaaatgcgcaattggcaacgcaatttaaatatcca
aatgttgttatagatgatgagaatcataatgataaaggtccattagcaggaatttataca
atcatgaagcaacatcctgaagaagaattgttttttgtcgtttctgttgatacaccaatg
attactggtaaagctgtaagcacgttgtatcagtttttagtttctcatcttattgaaaat
catttagatgtcgcagcttttaaagaagatggacgttttattccaacaattgcattttat
agtccgaatgcattaggcgctataactaaagcactacattctgataattacagttttaaa
aatgtatatcatgaattatcaacggattatttggatgtaagggatgtagatgcgccctca
tattggtacaaaaatataaattatcagcatgatttggacgctttaattcaaaaattgtaa


  DNA with Flanking Sequence

>fig|93062.19.peg.2203 Molybdenum cofactor guanylyltransferase (EC 2.7.7.77)
gatgaaataaatgaaaaatggcctggaacgataacgagtattgttcatagaatagggcca
ttacaaatttcagatatcgctgtattaattgcggtttcttcaccgcatcgtaaagatgcc
tatcgagcaaatgaatatgcaattgagcgtataaaagaaattgttccgatttggaaaaaa
gaaatttgggaagatggttcaaaatggcaagggcatcaaaaagggaattatgaagaagcg
aagagggaggaataagagagatgaaggtactttacttcgcagaaattaaagatatattac
aaaaagcacaggaagatattgtgcttgaacaagcattgactgtacaacaatttgaagatt
tattgtttgaacgttatccgcaaatcaataataaaaagtttcaagttgctgtaaatgagg
aatttgtacaaaaatcggatttcattcaacctaatgatactgttgcattaattccaccgg
ttagtggaggttaagggagcatgaaagcaataattcttgcaggtggtcattcagtgcgat
ttggtaagcccaaagcttttgcggaagtgaacggtgagaccttttatagtagagtaatta
agacattagaatcaacaaatatgttcaatgaaattattattagtacaaatgcgcaattgg
caacgcaatttaaatatccaaatgttgttatagatgatgagaatcataatgataaaggtc
cattagcaggaatttatacaatcatgaagcaacatcctgaagaagaattgttttttgtcg
tttctgttgatacaccaatgattactggtaaagctgtaagcacgttgtatcagtttttag
tttctcatcttattgaaaatcatttagatgtcgcagcttttaaagaagatggacgtttta
ttccaacaattgcattttatagtccgaatgcattaggcgctataactaaagcactacatt
ctgataattacagttttaaaaatgtatatcatgaattatcaacggattatttggatgtaa
gggatgtagatgcgccctcatattggtacaaaaatataaattatcagcatgatttggacg
ctttaattcaaaaattgtaagctgttaggaggtccacaaatggtagaacaaataaaagat
aaactaggacgtcccatccgtgacttacggttatctgtgacagatcggtgtaactttagg
tgtgattattgcatgcctaaagaggtatttggagatgatttcgtatttttacctaaaaat
gaacttttaacgtttgatgaaatggctagaatcgctaaggtatatgcagaattaggtgta
aaaaaaatacgcattacaggtggagaaccattgatgcgacgggatttagatgtacttata
gctaaattaaatcaaatcgatggtattgaagatattggtttgactacaaatggtttgtta
ttaaaaaagcatggacaaaagttatatgatgctgggctgcgcagaattaatgtcagtttg
gatgctattgatgatacgctatttcaatcaatcaataatcgtaatattaaagcgactacg
attttagaacaaattgattacgcgacgtctattggtttga


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0005525       F:GTP binding
GO:0005737       C:cytoplasm
GO:0006777       P:Mo-molybdopterin cofactor biosynthetic process
cmr|NT03SA2363 Staphylococcus aureus MW2     molybdopterin-guanine dinucleotide biosynthesis protein A, putative
cmr|NT05SA2284 Staphylococcus aureus NCTC 8325     molybdopterin-guanine dinucleotide biosynthesis
cmr|NT08SA2328 Staphylococcus aureus subsp. aureus MRSA252     Molybdopterin-guanine dinucleotide biosynthesis protein A
cmr|NT09SA2174 Staphylococcus aureus subsp. aureus MSSA476     Molybdopterin-guanine dinucleotide biosynthesis protein A
cmr|SACOL2262 Staphylococcus aureus subsp. aureus COL     molybdopterin-guanine dinucleotide biosynthesis protein A
cmr|SAUSA300_2220 Staphylococcus aureus subsp. aureus USA300-FPR3757     molybdopterin-guanine dinucleotide biosynthesis protein A
dbj|BAB96052.1 Staphylococcus aureus subsp. aureus MW2     molybdopterin-guanine dinucleotide biosynthesis mobA
dbj|BAF68441.1 Staphylococcus aureus subsp. aureus str. Newman     molybdopterin-guanine dinucleotide biosynthesis protein A
emb|CAG41334.1 Staphylococcus aureus subsp. aureus MRSA252 EMBL   putative molybdopterin-guanine dinucleotide biosynthesis protein A
emb|CAG43970.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   putative molybdopterin-guanine dinucleotide biosynthesis protein A
fig|196620.1.peg.2187 Staphylococcus aureus subsp. aureus MW2 FIG   Molybdenum cofactor guanylyltransferase (EC 2.7.7.77)
fig|196620.5.peg.2259 Staphylococcus aureus subsp. aureus MW2 FIG   Molybdenum cofactor guanylyltransferase (EC 2.7.7.77)
fig|282458.1.peg.2225 Staphylococcus aureus subsp. aureus MRSA252 FIG   Molybdenum cofactor guanylyltransferase (EC 2.7.7.77)
fig|282458.4.peg.2366 Staphylococcus aureus subsp. aureus MRSA252 FIG   Molybdenum cofactor guanylyltransferase (EC 2.7.7.77)
fig|282459.1.peg.2137 Staphylococcus aureus subsp. aureus MSSA476 FIG   Molybdenum cofactor guanylyltransferase (EC 2.7.7.77)
fig|282459.5.peg.2244 Staphylococcus aureus subsp. aureus MSSA476 FIG   Molybdenum cofactor guanylyltransferase (EC 2.7.7.77)
fig|367830.3.peg.1961 Staphylococcus aureus subsp. aureus USA300 FIG   Molybdenum cofactor guanylyltransferase (EC 2.7.7.77)
fig|426430.6.peg.2106 Staphylococcus aureus subsp. aureus str. Newman FIG   Molybdenum cofactor guanylyltransferase (EC 2.7.7.77)
fig|426430.8.peg.2360 Staphylococcus aureus subsp. aureus str. Newman FIG   Molybdenum cofactor guanylyltransferase (EC 2.7.7.77)
fig|450394.6.peg.1479 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   Molybdenum cofactor guanylyltransferase (EC 2.7.7.77)
fig|451515.3.peg.2365 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Molybdenum cofactor guanylyltransferase (EC 2.7.7.77)
fig|451516.9.peg.2354 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Molybdenum cofactor guanylyltransferase (EC 2.7.7.77)
fig|452948.4.peg.1413 Staphylococcus aureus 930918-3 FIG   Molybdenum cofactor guanylyltransferase (EC 2.7.7.77)
fig|455227.3.peg.490 Staphylococcus aureus D30 FIG   Molybdenum cofactor guanylyltransferase (EC 2.7.7.77)
fig|546342.3.peg.144 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Molybdenum cofactor guanylyltransferase (EC 2.7.7.77)
fig|546343.3.peg.204 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Molybdenum cofactor guanylyltransferase (EC 2.7.7.77)
fig|548470.3.peg.1084 Staphylococcus aureus subsp. aureus MN8 FIG   Molybdenum cofactor guanylyltransferase (EC 2.7.7.77)
fig|548473.3.peg.330 Staphylococcus aureus subsp. aureus TCH60 FIG   Molybdenum cofactor guanylyltransferase (EC 2.7.7.77)
fig|548474.3.peg.613 Staphylococcus aureus subsp. aureus TCH130 FIG   Molybdenum cofactor guanylyltransferase (EC 2.7.7.77)
fig|548475.3.peg.1904 Staphylococcus aureus subsp. aureus TCH70 FIG   Molybdenum cofactor guanylyltransferase (EC 2.7.7.77)
fig|553567.3.peg.226 Staphylococcus aureus A5948 FIG   Molybdenum cofactor guanylyltransferase (EC 2.7.7.77)
fig|553590.4.peg.868 Staphylococcus aureus A9754 FIG   Molybdenum cofactor guanylyltransferase (EC 2.7.7.77)
fig|585147.3.peg.1819 Staphylococcus aureus subsp. aureus A017934/97 FIG   Molybdenum cofactor guanylyltransferase (EC 2.7.7.77)
fig|585148.3.peg.2043 Staphylococcus aureus subsp. aureus Btn1260 FIG   Molybdenum cofactor guanylyltransferase (EC 2.7.7.77)
fig|585150.3.peg.652 Staphylococcus aureus subsp. aureus C160 FIG   Molybdenum cofactor guanylyltransferase (EC 2.7.7.77)
fig|585151.3.peg.1978 Staphylococcus aureus subsp. aureus C427 FIG   Molybdenum cofactor guanylyltransferase (EC 2.7.7.77)
fig|585152.3.peg.2239 Staphylococcus aureus subsp. aureus D139 FIG   Molybdenum cofactor guanylyltransferase (EC 2.7.7.77)
fig|585154.3.peg.2324 Staphylococcus aureus subsp. aureus EMRSA16 FIG   Molybdenum cofactor guanylyltransferase (EC 2.7.7.77)
fig|585155.3.peg.806 Staphylococcus aureus subsp. aureus H19 FIG   Molybdenum cofactor guanylyltransferase (EC 2.7.7.77)
fig|585160.3.peg.2076 Staphylococcus aureus subsp. aureus WBG10049 FIG   Molybdenum cofactor guanylyltransferase (EC 2.7.7.77)
fig|585161.3.peg.2096 Staphylococcus aureus subsp. aureus WW2703/97 FIG   Molybdenum cofactor guanylyltransferase (EC 2.7.7.77)
fig|644279.4.peg.2405 Staphylococcus aureus subsp. aureus 132 FIG   Molybdenum cofactor guanylyltransferase (EC 2.7.7.77)
fig|762962.3.peg.2249 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   Molybdenum cofactor guanylyltransferase (EC 2.7.7.77)
fig|93061.3.peg.2393 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Molybdenum cofactor guanylyltransferase (EC 2.7.7.77)
fig|93061.5.peg.2288 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Molybdenum cofactor guanylyltransferase (EC 2.7.7.77)
fig|93062.4.peg.2324 Staphylococcus aureus subsp. aureus COL FIG   Molybdenum cofactor guanylyltransferase (EC 2.7.7.77)
gb|AAW37134.1 Staphylococcus aureus subsp. aureus COL     molybdopterin-guanine dinucleotide biosynthesis protein A
gb|ABD22364.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     molybdopterin-guanine dinucleotide biosynthesis protein A
gb|ABD31552.1 Staphylococcus aureus subsp. aureus NCTC 8325     molybdopterin-guanine dinucleotide biosynthesis mobA, putative
gb|ABX30244.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     molybdenum (Mo2+) cofactor biosynthesis protein A
gb|EEI96516.1 Staphylococcus aureus subsp. aureus MN8     molybdopterin-guanine dinucleotide biosynthesis protein A
gb|EEJ62510.1 Staphylococcus aureus subsp. aureus TCH60     molybdopterin-guanine dinucleotide biosynthesis protein A
gb|EES55871.1 Staphylococcus aureus subsp. aureus TCH70     molybdopterin-guanine dinucleotide biosynthesis protein A
gb|EES95112.1 Staphylococcus aureus subsp. aureus USA300_TCH959     molybdopterin-guanine dinucleotide biosynthesis protein A
gb|EES96466.1 Staphylococcus aureus subsp. aureus TCH130     molybdopterin-guanine dinucleotide biosynthesis protein A
gb|EEV84322.1 Staphylococcus aureus A5948     molybdopterin-guanine dinucleotide biosynthesis protein A
gb|EEW44844.1 Staphylococcus aureus 930918-3     molybdopterin-guanine dinucleotide biosynthesis protein A
gb|EEW47946.1 Staphylococcus aureus D30     molybdopterin-guanine dinucleotide biosynthesis protein A
gi|122538842 organism not parsed/found in ncbi nr NCBI   RecName: Full=Probable molybdopterin-guanine dinucleotide biosynthesis protein A
gi|123484769 organism not parsed/found in ncbi nr NCBI   RecName: Full=Probable molybdopterin-guanine dinucleotide biosynthesis protein A
gi|150375181 Staphylococcus aureus subsp. aureus str. Newman NCBI   molybdopterin-guanine dinucleotide biosynthesis protein A
gi|151222381 Staphylococcus aureus subsp. aureus str. Newman NCBI   molybdopterin-guanine dinucleotide biosynthesis protein A
gi|160369273 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   molybdenum (Mo2+) cofactor biosynthesis protein A
gi|161510464 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   molybdopterin-guanine dinucleotide biosynthesis protein A
gi|172049051 organism not parsed/found in ncbi nr NCBI   RecName: Full=Probable molybdopterin-guanine dinucleotide biosynthesis protein A
gi|189082417 organism not parsed/found in ncbi nr NCBI   RecName: Full=Probable molybdopterin-guanine dinucleotide biosynthesis protein A
gi|21205358 Staphylococcus aureus subsp. aureus MW2 NCBI   molybdopterin-guanine dinucleotide biosynthesis mobA
gi|21283916 Staphylococcus aureus subsp. aureus MW2 NCBI   molybdopterin-guanine dinucleotide biosynthesis protein A
gi|221137155 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   molybdopterin-guanine dinucleotide biosynthesis protein A
gi|221140199 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   molybdopterin-guanine dinucleotide biosynthesis protein A
gi|227246757 Staphylococcus aureus subsp. aureus MN8 NCBI   molybdopterin-guanine dinucleotide biosynthesis protein A
gi|227556899 Staphylococcus aureus subsp. aureus MN8 NCBI   molybdopterin-guanine dinucleotide biosynthesis protein A
gi|227852712 Staphylococcus aureus subsp. aureus TCH60 NCBI   molybdopterin-guanine dinucleotide biosynthesis protein A
gi|227898959 Staphylococcus aureus subsp. aureus TCH60 NCBI   molybdopterin-guanine dinucleotide biosynthesis protein A
gi|251803214 Staphylococcus aureus subsp. aureus TCH70 NCBI   molybdopterin-guanine dinucleotide biosynthesis protein A
gi|251813304 Staphylococcus aureus subsp. aureus TCH70 NCBI   molybdopterin-guanine dinucleotide biosynthesis protein A
gi|253726383 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   molybdopterin-guanine dinucleotide biosynthesis protein A
gi|253727737 Staphylococcus aureus subsp. aureus TCH130 NCBI   molybdopterin-guanine dinucleotide biosynthesis protein A
gi|253729936 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   molybdopterin-guanine dinucleotide biosynthesis protein A
gi|253734321 Staphylococcus aureus subsp. aureus TCH130 NCBI   molybdopterin-guanine dinucleotide biosynthesis protein A
gi|257861520 Staphylococcus aureus A5948 NCBI   molybdopterin-guanine dinucleotide biosynthesis protein A
gi|258450737 Staphylococcus aureus A5948 NCBI   molybdopterin-guanine dinucleotide biosynthesis protein A
gi|259159804 Staphylococcus aureus 930918-3 NCBI   molybdopterin-guanine dinucleotide biosynthesis protein A
gi|259163388 Staphylococcus aureus D30 NCBI   molybdopterin-guanine dinucleotide biosynthesis protein A
gi|38258185 organism not parsed/found in ncbi nr NCBI   RecName: Full=Probable molybdopterin-guanine dinucleotide biosynthesis protein A
gi|49242613 Staphylococcus aureus subsp. aureus MRSA252 NCBI   putative molybdopterin-guanine dinucleotide biosynthesis protein A
gi|49245493 Staphylococcus aureus subsp. aureus MSSA476 NCBI   putative molybdopterin-guanine dinucleotide biosynthesis protein A
gi|49484484 Staphylococcus aureus subsp. aureus MRSA252 NCBI   molybdopterin-guanine dinucleotide biosynthesis protein A
gi|49487050 Staphylococcus aureus subsp. aureus MSSA476 NCBI   molybdopterin-guanine dinucleotide biosynthesis protein A
gi|56749182 organism not parsed/found in ncbi nr NCBI   RecName: Full=Probable molybdopterin-guanine dinucleotide biosynthesis protein A
gi|56749217 organism not parsed/found in ncbi nr NCBI   RecName: Full=Probable molybdopterin-guanine dinucleotide biosynthesis protein A
gi|57285040 Staphylococcus aureus subsp. aureus COL NCBI   molybdopterin-guanine dinucleotide biosynthesis protein A
gi|57650854 Staphylococcus aureus subsp. aureus COL NCBI   molybdopterin-guanine dinucleotide biosynthesis protein A
gi|71151948 organism not parsed/found in ncbi nr NCBI   RecName: Full=Probable molybdopterin-guanine dinucleotide biosynthesis protein A
gi|87127850 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   molybdopterin-guanine dinucleotide biosynthesis protein A
gi|87161876 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   molybdopterin-guanine dinucleotide biosynthesis protein A
gi|87203742 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   molybdopterin-guanine dinucleotide biosynthesis mobA, putative
gi|88196184 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   molybdopterin-guanine dinucleotide biosynthesis protein A
img|637153022 Staphylococcus aureus aureus COL IMG   molybdopterin-guanine dinucleotide biosynthesis protein A
img|637155786 Staphylococcus aureus aureus MRSA252 IMG   molybdopterin-guanine dinucleotide biosynthesis protein A
img|637158428 Staphylococcus aureus aureus MSSA476 IMG   molybdopterin-guanine dinucleotide biosynthesis protein A
img|637300004 Staphylococcus aureus aureus MW2 IMG   molybdopterin-guanine dinucleotide biosynthesis protein A
img|637888863 Staphylococcus aureus aureus USA300 IMG   molybdopterin-guanine dinucleotide biosynthesis protein A
img|637895150 Staphylococcus aureus aureus NCTC 8325 IMG   molybdopterin-guanine dinucleotide biosynthesis mobA, putative
img|640796600 Staphylococcus aureus aureus Newman IMG   molybdopterin-guanine dinucleotide biosynthesis protein A
img|641310258 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   molybdenum (Mo2+) cofactor biosynthesis protein A
img|641772932 Staphylococcus aureus aureus USA300_TCH959 IMG   molybdenum (Mo2+) cofactor biosynthesis protein A
kegg|saa:SAUSA300_2220 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   molybdopterin-guanine dinucleotide biosynthesis protein A
kegg|sac:SACOL2262 Staphylococcus aureus subsp. aureus COL KEGG   molybdopterin-guanine dinucleotide biosynthesis protein A
kegg|sae:NWMN_2169 Staphylococcus aureus subsp. aureus Newman KEGG   molybdopterin-guanine dinucleotide biosynthesis protein A
kegg|sam:MW2187 Staphylococcus aureus subsp. aureus MW2 KEGG   molybdopterin-guanine dinucleotide biosynthesis protein A
kegg|sao:SAOUHSC_02537 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   molybdopterin-guanine dinucleotide biosynthesis protein A
kegg|sar:SAR2353   KEGG   molybdopterin-guanine dinucleotide biosynthesis protein A
kegg|sas:SAS2159   KEGG   molybdopterin-guanine dinucleotide biosynthesis protein A
kegg|sax:USA300HOU_2251 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   molybdopterin-guanine dinucleotide biosynthesis protein A
ref|NP_647004.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   molybdopterin-guanine dinucleotide biosynthesis protein A
ref|YP_001333203.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   molybdopterin-guanine dinucleotide biosynthesis protein A
ref|YP_001576123.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   molybdopterin-guanine dinucleotide biosynthesis protein A
ref|YP_041708.1 Staphylococcus aureus subsp. aureus MRSA252 RefSeq   molybdopterin-guanine dinucleotide biosynthesis protein A
ref|YP_044271.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   molybdopterin-guanine dinucleotide biosynthesis protein A
ref|YP_187069.1 Staphylococcus aureus subsp. aureus COL RefSeq   molybdopterin-guanine dinucleotide biosynthesis protein A
ref|YP_494855.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   molybdopterin-guanine dinucleotide biosynthesis protein A
ref|YP_501001.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   molybdopterin-guanine dinucleotide biosynthesis protein A
ref|ZP_03561966.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   molybdopterin-guanine dinucleotide biosynthesis protein A
ref|ZP_03564692.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   molybdopterin-guanine dinucleotide biosynthesis protein A
ref|ZP_03986946.1 Staphylococcus aureus subsp. aureus MN8 RefSeq   molybdopterin-guanine dinucleotide biosynthesis protein A
ref|ZP_04016764.1 Staphylococcus aureus subsp. aureus TCH60 RefSeq   molybdopterin-guanine dinucleotide biosynthesis protein A
ref|ZP_04827777.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   molybdopterin-guanine dinucleotide biosynthesis protein A
ref|ZP_04864101.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   molybdopterin-guanine dinucleotide biosynthesis protein A
ref|ZP_04868486.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   molybdopterin-guanine dinucleotide biosynthesis protein A
ref|ZP_05698796.1 Staphylococcus aureus A5948 RefSeq   molybdopterin-guanine dinucleotide biosynthesis protein A
sp|A6QJA9 Staphylococcus aureus (strain Newman) SwissProt   Probable molybdopterin-guanine dinucleotide biosynthesis protein A
sp|A8Z367 Staphylococcus aureus (strain USA300 / TCH1516) SwissProt   Probable molybdopterin-guanine dinucleotide biosynthesis protein A
sp|MOBA_STAA3 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Probable molybdopterin-guanine dinucleotide biosynthesis protein A
sp|MOBA_STAA8 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Probable molybdopterin-guanine dinucleotide biosynthesis protein A
sp|MOBA_STAAC organism not parsed/found in ncbi nr SwissProt   RecName: Full=Probable molybdopterin-guanine dinucleotide biosynthesis protein A
sp|MOBA_STAAE organism not parsed/found in ncbi nr SwissProt   RecName: Full=Probable molybdopterin-guanine dinucleotide biosynthesis protein A
sp|MOBA_STAAR organism not parsed/found in ncbi nr SwissProt   RecName: Full=Probable molybdopterin-guanine dinucleotide biosynthesis protein A
sp|MOBA_STAAS organism not parsed/found in ncbi nr SwissProt   RecName: Full=Probable molybdopterin-guanine dinucleotide biosynthesis protein A
sp|MOBA_STAAT organism not parsed/found in ncbi nr SwissProt   RecName: Full=Probable molybdopterin-guanine dinucleotide biosynthesis protein A
sp|MOBA_STAAW organism not parsed/found in ncbi nr SwissProt   RecName: Full=Probable molybdopterin-guanine dinucleotide biosynthesis protein A
sp|Q2FEM3 Staphylococcus aureus (strain USA300) SwissProt   Probable molybdopterin-guanine dinucleotide biosynthesis protein A
sp|Q2FVY4 Staphylococcus aureus (strain NCTC 8325) SwissProt   Probable molybdopterin-guanine dinucleotide biosynthesis protein A
sp|Q5HDT8 Staphylococcus aureus (strain COL) SwissProt   Probable molybdopterin-guanine dinucleotide biosynthesis protein A
sp|Q6G753 Staphylococcus aureus (strain MSSA476) SwissProt   Probable molybdopterin-guanine dinucleotide biosynthesis protein A
sp|Q6GEG5 Staphylococcus aureus (strain MRSA252) SwissProt   Probable molybdopterin-guanine dinucleotide biosynthesis protein A
sp|Q8NVA4 Staphylococcus aureus (strain MW2) SwissProt   Probable molybdopterin-guanine dinucleotide biosynthesis protein A
tr|C2G8T1 Staphylococcus aureus subsp. aureus TCH60 TrEMBL   Molybdopterin-guanine dinucleotide biosynthesis protein A
tr|C2K4A6 Staphylococcus aureus subsp. aureus MN8 TrEMBL   Molybdopterin-guanine dinucleotide biosynthesis protein A
tr|C5MZF9 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   Molybdopterin-guanine dinucleotide biosynthesis protein A
tr|C5Q2W7 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   Molybdopterin-guanine dinucleotide biosynthesis protein A
tr|C5QG61 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   Molybdopterin-guanine dinucleotide biosynthesis protein A


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
4 fig|93062.19.peg.2206 Molybdopterin-guanine dinucleotide biosynthesis protein MobB
5 fig|93062.19.peg.2208 Molybdenum cofactor biosynthesis protein MoaC


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search